NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077675

Metagenome / Metatranscriptome Family F077675

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077675
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 51 residues
Representative Sequence VTLARRPWLYFGPAALVAGAIAVALVLTSDHEQHPAVATALGLFVSWSF
Number of Associated Samples 111
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.98 %
% of genes near scaffold ends (potentially truncated) 96.58 %
% of genes from short scaffolds (< 2000 bps) 97.44 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.641 % of family members)
Environment Ontology (ENVO) Unclassified
(31.624 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.701 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.95%    β-sheet: 0.00%    Coil/Unstructured: 48.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00072Response_reg 75.21
PF02518HATPase_c 21.37
PF13185GAF_2 1.71
PF13840ACT_7 0.85



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000887|AL16A1W_10177033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300000891|JGI10214J12806_11301335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300001538|A10PFW1_10084342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium856Open in IMG/M
3300001991|JGI24743J22301_10112594All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300002074|JGI24748J21848_1023361All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300004156|Ga0062589_102688383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300004480|Ga0062592_102001963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300005147|Ga0066821_1020715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300005164|Ga0066815_10024859All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005167|Ga0066672_10384276All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300005335|Ga0070666_10144019All Organisms → cellular organisms → Bacteria1660Open in IMG/M
3300005338|Ga0068868_102220787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300005367|Ga0070667_100746596All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005543|Ga0070672_102135246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300005553|Ga0066695_10161652All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300005558|Ga0066698_10853920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300005561|Ga0066699_10894121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales620Open in IMG/M
3300005569|Ga0066705_10935460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales514Open in IMG/M
3300005574|Ga0066694_10407608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales639Open in IMG/M
3300005713|Ga0066905_100953608All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005841|Ga0068863_101593512All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300006173|Ga0070716_100619292All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300006175|Ga0070712_101352258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300006576|Ga0074047_11089241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300006603|Ga0074064_10767903All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300006871|Ga0075434_101905149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300009012|Ga0066710_103334102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300009088|Ga0099830_10359667All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300009143|Ga0099792_10111428All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300009156|Ga0111538_13208255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300009162|Ga0075423_10329578All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300010043|Ga0126380_10787733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium776Open in IMG/M
3300010044|Ga0126310_10566932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300010139|Ga0127464_1202341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300010335|Ga0134063_10683620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300010336|Ga0134071_10630091All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300010396|Ga0134126_10816609All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300012189|Ga0137388_10173435All Organisms → cellular organisms → Bacteria1928Open in IMG/M
3300012198|Ga0137364_11082295All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012200|Ga0137382_10191236All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300012202|Ga0137363_10537801All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300012207|Ga0137381_11628105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300012209|Ga0137379_10432897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1224Open in IMG/M
3300012211|Ga0137377_11142427All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012212|Ga0150985_120856072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300012353|Ga0137367_10179979All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300012358|Ga0137368_10627516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300012362|Ga0137361_10709727All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300012373|Ga0134042_1111467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300012382|Ga0134038_1235544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300012389|Ga0134040_1145249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300012907|Ga0157283_10231781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300012930|Ga0137407_11917783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300012938|Ga0162651_100015286All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300012957|Ga0164303_11007940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300012957|Ga0164303_11431202All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300012961|Ga0164302_10027577All Organisms → cellular organisms → Bacteria2563Open in IMG/M
3300012976|Ga0134076_10320677All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012984|Ga0164309_10904974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium719Open in IMG/M
3300012986|Ga0164304_11372009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300013308|Ga0157375_10021645All Organisms → cellular organisms → Bacteria5901Open in IMG/M
3300013308|Ga0157375_12957959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300013501|Ga0120154_1098864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300014058|Ga0120149_1161299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300015374|Ga0132255_100467144All Organisms → cellular organisms → Bacteria1849Open in IMG/M
3300017659|Ga0134083_10480247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300018468|Ga0066662_12409965All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300018482|Ga0066669_10660561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium920Open in IMG/M
3300019255|Ga0184643_1195684All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300019279|Ga0184642_1201010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300019279|Ga0184642_1229813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300019873|Ga0193700_1003260All Organisms → cellular organisms → Bacteria2396Open in IMG/M
3300019873|Ga0193700_1020791All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300020140|Ga0179590_1217648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300021080|Ga0210382_10090231All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300021363|Ga0193699_10339814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300021415|Ga0193694_1004824All Organisms → cellular organisms → Bacteria1814Open in IMG/M
3300021418|Ga0193695_1120664All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300021560|Ga0126371_11016557All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300022756|Ga0222622_10223938All Organisms → cellular organisms → Bacteria1261Open in IMG/M
3300025915|Ga0207693_11007057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300025927|Ga0207687_10829014All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300025931|Ga0207644_10433194All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300025932|Ga0207690_11542983All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300026301|Ga0209238_1242825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300026327|Ga0209266_1260521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300026523|Ga0209808_1267399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300026524|Ga0209690_1125167All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300026550|Ga0209474_10152084All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300026552|Ga0209577_10177224All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300027787|Ga0209074_10096764All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300027882|Ga0209590_10974032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300028047|Ga0209526_10473035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium821Open in IMG/M
3300028380|Ga0268265_10566188All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300028707|Ga0307291_1149094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300028716|Ga0307311_10189011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300028717|Ga0307298_10139080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300028744|Ga0307318_10102765All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300028768|Ga0307280_10020912All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300028768|Ga0307280_10145954All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300028787|Ga0307323_10333963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300028793|Ga0307299_10285126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300028811|Ga0307292_10430861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300028814|Ga0307302_10280996All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300028819|Ga0307296_10265860All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300028824|Ga0307310_10197956All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300028872|Ga0307314_10050574All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300028872|Ga0307314_10220595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300028878|Ga0307278_10521242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300028880|Ga0307300_10117878All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300028884|Ga0307308_10048673All Organisms → cellular organisms → Bacteria1991Open in IMG/M
3300031199|Ga0307495_10133746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300031421|Ga0308194_10081516All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300031720|Ga0307469_12248090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300031996|Ga0308176_12345033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300032065|Ga0318513_10599848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300034172|Ga0334913_100759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.84%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.42%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.71%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.85%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.85%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000887Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010139Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012373Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012382Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AL16A1W_1017703323300000887PermafrostVTLARRPWLYFGPAALVAGGIAVALTAASDHEAHPAIAT
JGI10214J12806_1130133523300000891SoilVTAIRRPWLYFGPAALAAGGLGVALTSTSDHEQHPVLAIALGLFVSWSFVLAG
A10PFW1_1008434213300001538PermafrostVNLARRPWLYFGPAALVAGGIAVVLVLTSDHEPHPAVATALGLFVSWSFIFAGLI
JGI24743J22301_1011259423300001991Corn, Switchgrass And Miscanthus RhizosphereVTLAWRPWLYFGPAALIAGGLAVALTATSDHEQHP
JGI24748J21848_102336133300002074Corn, Switchgrass And Miscanthus RhizosphereVTLAWRPWLYFGPAALIAGGLAVALTATSDHEQHPGQTIALFLFVSSSFILAGLIGWT
Ga0062589_10268838323300004156SoilVTLSRRPWLYFGPAAVLAAAAGIALTLTSDHEEHPGYTVALALFVSMSFIFA
Ga0062592_10200196323300004480SoilVTAIRRPWLYFGPAALAAGGLGVALTSTSDHEQHPVLAIALGLFVSWSFVLAGLIGW
Ga0066821_102071523300005147SoilVTLAWRPWLYFGPAALIADGLAVALTATSDHEQHPEQAIALVLFV
Ga0066815_1002485933300005164SoilVTLAWRPWLYFGPAALIADGLAIALTATSDHEQHPEQAIALVLFV
Ga0066672_1038427633300005167SoilVSLSRRPWLFFGPAALLAAAVAVALTLTSDHEQHPGLTTALLLFVSMSFVVA
Ga0070666_1014401933300005335Switchgrass RhizosphereVTLAWRPWLYFGPAALIAGGLAVALTATSDHEQHPGQTIALFLFVSSS
Ga0068868_10222078713300005338Miscanthus RhizosphereVTLARRPWLYFGPAALIAGGIAVAIIAARDHEAHPAIATALGLFVSWSFILAGLIGWTRRPTN
Ga0070667_10074659613300005367Switchgrass RhizosphereVTLARRPWLYFGPAALIAGGIAVAIIAASDHEAHPAIATALGLFVSWSFI
Ga0070672_10213524623300005543Miscanthus RhizosphereVTLSRRPWLYFGPAAVLAAAAGIALTLTSDHEEHPGYTVALALFVSMSFIFAGLV
Ga0066695_1016165213300005553SoilVILSRRPWLFFGPAAVFAGAAAVALTLSSDHEEHPAFTTVLLLFVSMSFVIAGLIG
Ga0066698_1085392023300005558SoilVIAARRPWVFFGPAAVLAAGLAVALTLSSRHEEQPALAIALGLFVSLSFV
Ga0066699_1089412113300005561SoilMSVARRPWLYFGPAALIAGGVAVALTLASDHEQHPGLAIALGLFVSWSFVLAGLIGWSRR
Ga0066705_1093546023300005569SoilVIFARRPWLFFGPAAVFAGAAAVALTLTSDHEEHPALTTVLLLFVSMSFVIAGLIGWM
Ga0066694_1040760823300005574SoilVRLAQRPWLYFGPAALLAGGIGVALTVASDHEEHPALAVALGLFVSWSFIGAGLIGWSRR
Ga0066905_10095360833300005713Tropical Forest SoilVTTIRRPWLYFGPAALAAGGLAVALTSTSDHEQHPVLATALG
Ga0068863_10159351213300005841Switchgrass RhizosphereVTLAWRPWLYFGPAALIAGGLAVALTATSDHEQHPGQTIALFLFVSSSFILAGLI
Ga0070716_10061929233300006173Corn, Switchgrass And Miscanthus RhizosphereVTLAWRPWLYFGLAALIADALAVALTATSDHEQHPEQAIALVLFVSS
Ga0070712_10135225813300006175Corn, Switchgrass And Miscanthus RhizosphereVILARRPWLYYGPAALLAGALAVALSVASDHEEHPALAIALGLFVSWSFILAGL
Ga0074047_1108924123300006576SoilVTLPRRPWVLFGPAAVVAAAVSVALVVTSDHEEHPELAVALGLF
Ga0074064_1076790313300006603SoilVTLAWRPWLYFGLAALIADALAVALTATSDHEQHPEQAIALVLFVSSSFILAGLIGWTRRPQ
Ga0075434_10190514913300006871Populus RhizosphereVIRRPWLYFGPAALVAGGLAVALTATSDHEEHPALATALVLFVSWSFVLAGLIGWTRR
Ga0066710_10333410223300009012Grasslands SoilVTLARRPWLYFGPAALLAGALAVALTVASDHEEHPALAIALGLFVSWSFILAGLIGWSR
Ga0099830_1035966723300009088Vadose Zone SoilVTLARRRWLYFGPAALVAGAIAVALTVSSDHEAHPALAVALGLFVSWSSSSQA*
Ga0099792_1011142833300009143Vadose Zone SoilVIIARRPWLYFGPAALLAGAIAVALTATSDHEQHPALAIALGLFVSWSFILAGLIGWSRRPA
Ga0111538_1320825513300009156Populus RhizosphereVTPTRRLWLILGPLALIAGAIAVALTQTSDHEQHPAET
Ga0075423_1032957833300009162Populus RhizosphereVSLTRRPWLFFGPAAVLAGAAAVILTLGSDHEEHPGHTTALLLFVSLSFVIAGLI
Ga0126380_1078773333300010043Tropical Forest SoilVTFSSRPLLFFGPPAALAGAAAVALTLTSNHEQHPALTTVLLLFVSMSFVIAGLIGWMR
Ga0126310_1056693233300010044Serpentine SoilVTLRQRPWLLFGPAAIVAGAVGVTLTLTSDHEEHPGFTVALALFVRASFIVAGLIGWTRRAA
Ga0127464_120234113300010139Grasslands SoilVSLSRRPWLFFGPAAVVAGAVAVALTFTSDHDDNPGLTAALVLFVSLSFIAAGLVGWTRR
Ga0134063_1068362013300010335Grasslands SoilVSLTRRPWLFFGPAALVAGGAAVALTLTSDHEQHPGLTTALLLFVSMS
Ga0134071_1063009123300010336Grasslands SoilVTLARRPWLYFGPAALVAGGIAVALVLTSDHEEHPAVAT
Ga0134126_1081660913300010396Terrestrial SoilVTLSRRPWLYFGPAAVLAAAAGIALTLTSDHEQHPGYTVALALFVS
Ga0137388_1017343533300012189Vadose Zone SoilVTLARRRWLYFGPAALVAGALAVALTVSSDHEAHPALAVALGLFVSWSSSSQA*
Ga0137364_1108229523300012198Vadose Zone SoilVTLARRPWLYFGPAALVAGGIAVALVLTSDHEEHPAVAIALGLFVSWSFIFAGLI
Ga0137382_1019123613300012200Vadose Zone SoilVTLARRPWLYFGPAALVAGGIAVALVLTSDHEEHPAVATALGLFVS
Ga0137363_1053780133300012202Vadose Zone SoilVILARRPWLYFGPAALLAGAIAVALTVTSKHEQHP
Ga0137381_1162810513300012207Vadose Zone SoilVTLARRPWLYFGPAAFVAGAIAVALTVTSDHEPHPALATALGLFVS
Ga0137379_1043289733300012209Vadose Zone SoilVTRTQKLWLTYGSAALAAGGIAVALTLTSNHEKHPTTAIVLGLFVGWSFILAGLIGWS
Ga0137377_1114242713300012211Vadose Zone SoilVILARRPWLYFGPAALLAGAIAVALTVTSKHEQHPA
Ga0150985_12085607213300012212Avena Fatua RhizosphereVIFARRPWLFFGPAAVFAGAAAVALTLTSDHEEHPALTTVLLLFVSMSFVIAGLIG
Ga0137367_1017997913300012353Vadose Zone SoilVTLVRRPWLYFGPAALVAGGIAVALVAASDHEPHPAIAIAL
Ga0137368_1062751623300012358Vadose Zone SoilVTPERRPWLFFSPAALIAGSAAVALTLTSDHEQHPALATALLLFVSGSFVFAGLIGWSR
Ga0137361_1070972713300012362Vadose Zone SoilVTLARRPWLYYGPAALVAGGIAVALVLTSDHEEHPAVAIALGLFVSWSFIFAGLIGWT
Ga0134042_111146723300012373Grasslands SoilMSLARRPWLYFGPAALLAGAIGVALTVTSDHEEHPALA
Ga0134038_123554423300012382Grasslands SoilMSLARRPWLYFGPAALLAGAIGVALTVTSDHEEHPALATALGLFVSWSFILAGLLGWSRR
Ga0134040_114524913300012389Grasslands SoilMSLARRPWLYFGPAALLAGAIGVALTVTSDHEEHPALATALGLF
Ga0157283_1023178113300012907SoilLLFFGPPAVFAGAAAVALTLTSDHEQHPALTTVLLLFVSMSFVIA
Ga0137407_1191778313300012930Vadose Zone SoilVIIARRPWLYFGPAALLAGAIAVALTATSDHEQHPALAIALGLFVSWSFILAGL
Ga0162651_10001528623300012938SoilVTLAWRPWLYFGPAALIAAGLAVALIATSDHEQHPEQAIALALEE*
Ga0164303_1100794023300012957SoilVTLARRPWLYFGPAALVAGAISVALVLTSDHEQHPAVATALGLFVSWSFIFA
Ga0164303_1143120223300012957SoilVTLAWRPWLYFGLAALIADALAVALTATSDHEQHPEQAIALVLFVSSSFILAGLIGW
Ga0164302_1002757713300012961SoilLLYFGPAALIAGGIAVTIIAASDHEAHPAIAIALGLFVSWSFILAGLIG
Ga0134076_1032067713300012976Grasslands SoilVTLARRPWLYFGPAALVAGGIAVALVAASDHEPHPAIAIALGLFVSWSFIFAGLIG
Ga0164309_1090497413300012984SoilVTLARRPWLYFGPAALVAGAISVALVLTSDHEQHPAVATALGLFVSWSFIFAGLTGWTRR
Ga0164304_1137200913300012986SoilVTLARRPWLYFGPAALVAGAISVALVLTSDHEQHPAVATALGLF
Ga0157375_1002164563300013308Miscanthus RhizosphereVTLARRPWLYFGPAALIAGGIAVAIIAASDHEAHPAIATALGLFVSWS
Ga0157375_1295795913300013308Miscanthus RhizosphereVTLSRRPWLYFGPAAVLAAAAGIALTLTSDHEEHPGYTVALALFVSMSFIFAGL
Ga0120154_109886413300013501PermafrostVNLARRPWLYFGPAALVAGGIAVVLVLTSDHEPHPAVATALGLFVS
Ga0120149_116129913300014058PermafrostVTLARRPWLYFGPAALVAGGIAVALTAASDHEAHPAIATALGLFVSWSFI
Ga0132255_10046714413300015374Arabidopsis RhizosphereVTSTRRLWLILGPVALIASAIAVALTLTSDHEQHPAETTALLLFVSSSFIFAGLIGWSRRPRNR
Ga0134083_1048024713300017659Grasslands SoilVTRARRPWLYFGPAALLAGALAVALTVASDHDEHPALAIALGLFVSWSFILAGLIGWSRRPQNRT
Ga0066662_1240996513300018468Grasslands SoilMSLAGRPWLYFGPAALLAGALGLTLTVTSNHEEHPALAVALGLFVSWSFIL
Ga0066669_1066056113300018482Grasslands SoilMTLARRPWLYFGPAALLAGGLGVALTVTSDPEEHPALATALGLFVSWSFGLAGLIGWSRG
Ga0184643_119568413300019255Groundwater SedimentVTLARRPWLYFGPAALVAGGIAVALVLTSDHEQHPAVATAL
Ga0184642_120101023300019279Groundwater SedimentVTLARRPWLYFGPAALVAGGIAVALVLTSDHESHPAVATALGLFVSWSFIFAGLIGWTRRPTNR
Ga0184642_122981323300019279Groundwater SedimentVTLARRPWLYFGPAALVAGAIAVALAVTSDHEEHPALATALLLFVSWSF
Ga0193700_100326013300019873SoilVTLARRPWLYFGPAALVAGAIAVALVLTSAHEQHPAVATALGLFVSS
Ga0193700_102079113300019873SoilVTLAWRPWLYFGLAALIADGLAVALTATSDHEQHPEQAIALVLFV
Ga0179590_121764813300020140Vadose Zone SoilVTLAWRPWLYFGLAALIADGLAVALTATSDHEQHPEQAI
Ga0210382_1009023113300021080Groundwater SedimentVTLARRPWLYFGPAALVAGGIAVALVLTSDHEEHPAVATALGLFVSWSFIFAGLTG
Ga0193699_1033981423300021363SoilVTLAWRPWLYFGPAALIADGLAVALTATSDHEQHPEQAIAL
Ga0193694_100482433300021415SoilVTLAWRPWLYFGPAALIADGLAVALTATSDHEQHPEQAIALVLFVSSSFILAGLIGWT
Ga0193695_112066423300021418SoilVTLARRPWLYFGPAALVAGGIAVALVLTSDHEQHPAVATALGLFVSWSFIFAGLIGWTRRPKN
Ga0126371_1101655733300021560Tropical Forest SoilVISRRPWLFFGPAAVLAGAAAVALTLNSDHEEYRWLTTTLLLFVSMSFVIAGLIGWSRR
Ga0222622_1022393813300022756Groundwater SedimentVTLARRPWLYFGPAALVAGAISVALVLTSDHEQHPAVATALGLFVSWSFIFAGLIGWTRRPTNKTG
Ga0207693_1100705713300025915Corn, Switchgrass And Miscanthus RhizosphereVILARRPWLYYGPAALLAGALAVALSVASDHEEHPALAIALGLFVSWSFILAGLIGWSR
Ga0207687_1082901433300025927Miscanthus RhizosphereVTLAWRPWLYFGPAALIAGGLAVALTATSDHEQHPGQTIALFLF
Ga0207644_1043319413300025931Switchgrass RhizosphereVTLSRRPWLYFGPAAVLAAAAGIALTLTSDHEEHPGYTVALALFVSMSFIF
Ga0207690_1154298323300025932Corn RhizosphereVTLAWRPWLYFGPAALIAGGLAVALTATSDHEQHPGQTIA
Ga0209238_124282523300026301Grasslands SoilVILARPWLYFGPAALVAGAIAVALTVTSDHEQHPALATALGLFVSWSF
Ga0209266_126052113300026327SoilVRLAQRPWLYFGPAALLAGGIGVALTVTSDHEEHPALAVALGLFVSWSF
Ga0209808_126739923300026523SoilVSLARRPWLYFGPAALVAAAVSVALTFTSDHDQNPG
Ga0209690_112516713300026524SoilVIFARRPWLYFGPAALVAGAIAVALTVTSDHEQHPALATALGLFVSWSFIFAGLIGWSRRPANR
Ga0209474_1015208413300026550SoilVTLARRPWLYFGPAALLAGALAVALTVASDHEEHPALAIALGLFVSWSFILAGLIG
Ga0209577_1017722413300026552SoilMSVARRPWLYFGPAALIAGGVAVALTLASDHEQHPGLAIALGLFVS
Ga0209074_1009676413300027787Agricultural SoilVTLTRRPWLFFGPLAVFAGAAAVSLTLSSDHEAHPAFTTTLLLFVSMSFVIAGLIGWMRRPSNRT
Ga0209590_1097403223300027882Vadose Zone SoilVTLTRRPWLFFGPAALVAGGIAVALTAASDHEEHPGLAIALGLFVSWSF
Ga0209526_1047303523300028047Forest SoilVTLARRPWLYFGPAALVAGAIAVALTVTSDHEQHPALATALGLFVSWSFIFAGSET
Ga0268265_1056618813300028380Switchgrass RhizosphereVTLARRPWLYFGPAALIAGGLAVALTATSDHEQHPGQTIALFLFVSSSFILAGLIGWTRRPW
Ga0307291_114909413300028707SoilVTLARRPWLYFGPAALVAGAIAVALAVTSDHEEHPALATALLLFVSWSFIFAGLIGW
Ga0307311_1018901123300028716SoilVTRLGRPWLYLGSAALVAGAIAVTLTVTSDHEENPGIATALGLF
Ga0307298_1013908013300028717SoilVTLARRPWLYFGPAALVAGAISVALVLTSDHEQHPAVATALGLFVSWSFIFAG
Ga0307318_1010276533300028744SoilVSLSQRPWLYFGPTAIAAGALGVALTLTSDHEEHPGFTIALALFVSMSFV
Ga0307280_1002091233300028768SoilVTLARRPWLYFGPAALVAGAIAVALVLTSDHEQHPAVATALGLFVSL
Ga0307280_1014595433300028768SoilVTLARRPWLYFGPAALVAGAIAVALAVTSDHEEHPALATALLLFVSWSFI
Ga0307323_1033396323300028787SoilVTLAWRPWLYFGLAALIADGLAVALTATSDHEQHPEQAIALV
Ga0307299_1028512623300028793SoilVTLAWRPWLYFGLAALIADGLAVALTATSDHEQHPEQAIAL
Ga0307292_1043086123300028811SoilVTRLRRPWLYFGPAALVAGGIAVTLTVTSDHEENPGIATALGLFVSWSFVLAGLIGATRRPQNRT
Ga0307302_1028099613300028814SoilVTLARRPWLYFGPAALVAGGIAVALVLTSDHEEHPAVATALG
Ga0307296_1026586013300028819SoilVTLARRPWLYFGPAALVAGAIAVALVLTSDHEQHPAVATALGLFVSWSF
Ga0307310_1019795613300028824SoilVTLTRRPWLYFGPAALVAGGIAVALVLTSDHEEHPAVATALGLFVSWSFIFAG
Ga0307314_1005057433300028872SoilVTLARRPWLYFGPAALVAGAIAVALAVTSDHEEHPA
Ga0307314_1022059513300028872SoilVTLARRPWLYFGPAALVAGAIAVALVLTSDHEQHPAVATALGLFVSW
Ga0307278_1052124223300028878SoilVTPERRPWLFFGPAALIAGSAAVALTLTSDHEEHPALATALLLFVSGSFVLAGLIGWSRRPYNRT
Ga0307300_1011787833300028880SoilVTLARRPWLYFGPAALVAGAISVALVLTSDHEQHPAVATALGLFVSWSFIFAGLTG
Ga0307308_1004867333300028884SoilVTLARRPWLYFGPAALVAGGIAVALVLTSDHEEHPAV
Ga0307495_1013374623300031199SoilVTLAWRPWLYFGPAALIAGGLAVALTATSDHEQHPGQTIALFLFVSSSFILAG
Ga0308194_1008151613300031421SoilVTLAWRPWLYFGPAALIAAGLAVALIATSDHEQHPEQAIALVLF
Ga0307469_1224809013300031720Hardwood Forest SoilVTLSRRPWLYFGPAAVLAAAVGIALTLTSDHEQHPGYTVALALFVSMSFIFAGL
Ga0308176_1234503323300031996SoilVTLTRRPWLFFGPAAILAAAAGVALTLTSDHEQHPGFTIALALFVSMSFILA
Ga0318513_1059984823300032065SoilVISRRPWLFFAPAAAVAGAVAVALTLTSDHEQHRGLTTALLLFVSMS
Ga0334913_100759_436_6093300034172Sub-Biocrust SoilMTLARRPWLFFGPAALLAGAAAVALTLTSDHEEHPVFTTALILFVSMSFVVAGLIGWT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.