Metagenome / Metatranscriptome Family F077656

Basic Information
Family ID	F077656
Family Type	Metagenome / Metatranscriptome
Number of Sequences	117
Average Sequence Length	38 residues
Representative Sequence	LIEWGEKFPRLVRERDVEIALEREGENGRRIRVSA
Number of Associated Samples	108
Number of Associated Scaffolds	117

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	87.18 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Bacteria (76.068 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.547 % of family members)
Environment Ontology (ENVO)	Unclassified (21.368 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (50.427 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.76% β-sheet: 19.05% Coil/Unstructured: 76.19%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF13561	adh_short_C2	35.90
PF00326	Peptidase_S9	6.84
PF00753	Lactamase_B	3.42
PF07690	MFS_1	3.42
PF01545	Cation_efflux	2.56
PF00144	Beta-lactamase	1.71
PF01061	ABC2_membrane	1.71
PF02367	TsaE	1.71
PF06262	Zincin_1	0.85
PF04073	tRNA_edit	0.85
PF13340	DUF4096	0.85
PF13505	OMP_b-brl	0.85
PF13181	TPR_8	0.85
PF05076	SUFU	0.85
PF13420	Acetyltransf_4	0.85
PF04389	Peptidase_M28	0.85
PF02954	HTH_8	0.85
PF06127	Mpo1-like	0.85
PF13620	CarboxypepD_reg	0.85
PF08837	DUF1810	0.85
PF13578	Methyltransf_24	0.85
PF05977	MFS_3	0.85
PF02374	ArsA_ATPase	0.85
PF01384	PHO4	0.85
PF11008	DUF2846	0.85
PF07617	DUF1579	0.85
PF01790	LGT	0.85

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG0053	Divalent metal cation (Fe/Co/Zn/Cd) efflux pump	Inorganic ion transport and metabolism [P]	2.56
COG1230	Co/Zn/Cd efflux system component	Inorganic ion transport and metabolism [P]	2.56
COG3965	Predicted Co/Zn/Cd cation transporter, cation efflux family	Inorganic ion transport and metabolism [P]	2.56
COG0802	tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE	Translation, ribosomal structure and biogenesis [J]	1.71
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	1.71
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	1.71
COG2367	Beta-lactamase class A	Defense mechanisms [V]	1.71
COG0306	Phosphate/sulfate permease	Inorganic ion transport and metabolism [P]	0.85
COG0682	Prolipoprotein diacylglyceryltransferase	Cell wall/membrane/envelope biogenesis [M]	0.85
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	0.85
COG3824	Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain	Posttranslational modification, protein turnover, chaperones [O]	0.85
COG4539	2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids)	Lipid transport and metabolism [I]	0.85
COG5579	Uncharacterized conserved protein, DUF1810 family	Function unknown [S]	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	76.07 %
Unclassified	root	N/A	23.93 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	76.07 %
Unclassified	root	N/A	23.93 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	76.07 %
Unclassified	root	N/A	23.93 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	47.01 %
Unclassified	root	N/A	23.93 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.56 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.85 %

Name	Rank	Taxonomy	Distribution
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	29.06 %
Unclassified	root	N/A	23.93 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	4.27 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.71 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	0.85 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	25.64 %
Unclassified	root	N/A	23.93 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.42 %
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	1.71 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1.71 %
Acidobacteria bacterium 13_1_20CM_4_56_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7	0.85 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.85 %
Deinococci	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci	0.85 %

Name	Rank	Taxonomy	Distribution
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	25.64 %
Unclassified	root	N/A	23.93 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.42 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	1.71 %
unclassified Bryobacterales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales	0.85 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.85 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.85 %
Thermales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales	0.85 %
Acidobacteria bacterium 13_1_20CM_4_56_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.93 %
Candidatus Sulfotelmatobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter	3.42 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.42 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	2.56 %
Nevskia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia	1.71 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.85 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.85 %
Granulicella	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella	0.85 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	0.85 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.85 %
Thermaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae	0.85 %
Acidobacteria bacterium 13_1_20CM_4_56_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.93 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.42 %
unclassified Candidatus Sulfotelmatobacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter	2.56 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1.71 %
Nevskia soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli	1.71 %
Candidatus Sulfotelmatobacter kueseliae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	0.85 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.85 %
Thermus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus	0.85 %
Granulicella aggregans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans	0.85 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.85 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.85 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.85 %
Acidobacteria bacterium 13_1_20CM_4_56_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.93 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.42 %
Candidatus Sulfotelmatobacter sp. SbA7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	2.56 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1.71 %
Nevskia soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli	1.71 %
unclassified Thermus	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → unclassified Thermus	0.85 %
Candidatus Sulfotelmatobacter kueseliae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	0.85 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.85 %
Granulicella aggregans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans	0.85 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.85 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.85 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.85 %
Acidobacteria bacterium 13_1_20CM_4_56_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	23.93 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.42 %
Candidatus Sulfotelmatobacter sp. SbA7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	2.56 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1.71 %
Nevskia soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli	1.71 %
Thermus sp. CCB_US3_UF1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → unclassified Thermus → Thermus sp. CCB_US3_UF1	0.85 %
Candidatus Sulfotelmatobacter kueseliae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	0.85 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.85 %
Granulicella aggregans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans	0.85 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.85 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	0.85 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.85 %
Acidobacteria bacterium 13_1_20CM_4_56_7	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_104716102	All Organisms → cellular organisms → Bacteria → Acidobacteria	780	Open in IMG/M
3300000567\|JGI12270J11330_10291469	Not Available	510	Open in IMG/M
3300001166\|JGI12694J13545_1005174	Not Available	1614	Open in IMG/M
3300001170\|JGI12704J13340_1005680	All Organisms → cellular organisms → Bacteria	1181	Open in IMG/M
3300001867\|JGI12627J18819_10300685	All Organisms → cellular organisms → Bacteria → Acidobacteria	646	Open in IMG/M
3300005186\|Ga0066676_10437754	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	885	Open in IMG/M
3300005332\|Ga0066388_102296806	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	976	Open in IMG/M
3300005435\|Ga0070714_100424840	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1259	Open in IMG/M
3300005538\|Ga0070731_10195403	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1343	Open in IMG/M
3300005554\|Ga0066661_10847969	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	534	Open in IMG/M
3300005560\|Ga0066670_10582858	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	682	Open in IMG/M
3300005602\|Ga0070762_10100020	All Organisms → cellular organisms → Bacteria	1677	Open in IMG/M
3300005602\|Ga0070762_10243749	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	1115	Open in IMG/M
3300005610\|Ga0070763_10354115	Not Available	817	Open in IMG/M
3300005712\|Ga0070764_10446094	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	771	Open in IMG/M
3300005764\|Ga0066903_105070397	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	698	Open in IMG/M
3300005899\|Ga0075271_10014402	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1420	Open in IMG/M
3300006028\|Ga0070717_10016377	All Organisms → cellular organisms → Bacteria	5747	Open in IMG/M
3300006028\|Ga0070717_11684740	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	574	Open in IMG/M
3300006047\|Ga0075024_100885292	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300006052\|Ga0075029_100383347	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	911	Open in IMG/M
3300006059\|Ga0075017_100415043	All Organisms → cellular organisms → Bacteria	1011	Open in IMG/M
3300006059\|Ga0075017_100708142	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	775	Open in IMG/M
3300006102\|Ga0075015_100361626	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	811	Open in IMG/M
3300006162\|Ga0075030_100255528	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1404	Open in IMG/M
3300006173\|Ga0070716_101105923	Not Available	632	Open in IMG/M
3300006174\|Ga0075014_100750838	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae	572	Open in IMG/M
3300006175\|Ga0070712_101949645	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300006176\|Ga0070765_100060321	All Organisms → cellular organisms → Bacteria	3139	Open in IMG/M
3300006755\|Ga0079222_11741348	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	600	Open in IMG/M
3300007788\|Ga0099795_10066479	All Organisms → cellular organisms → Bacteria	1350	Open in IMG/M
3300009038\|Ga0099829_11766732	Not Available	507	Open in IMG/M
3300009174\|Ga0105241_10445595	All Organisms → cellular organisms → Bacteria	1144	Open in IMG/M
3300009524\|Ga0116225_1010725	All Organisms → cellular organisms → Bacteria	4990	Open in IMG/M
3300009628\|Ga0116125_1040949	All Organisms → cellular organisms → Bacteria	1168	Open in IMG/M
3300009628\|Ga0116125_1060221	Not Available	977	Open in IMG/M
3300009839\|Ga0116223_10621603	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	623	Open in IMG/M
3300010043\|Ga0126380_10524656	All Organisms → cellular organisms → Bacteria → Acidobacteria	915	Open in IMG/M
3300010046\|Ga0126384_11853335	All Organisms → cellular organisms → Bacteria → Acidobacteria	574	Open in IMG/M
3300010048\|Ga0126373_12199696	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	613	Open in IMG/M
3300010359\|Ga0126376_11944022	Not Available	629	Open in IMG/M
3300010376\|Ga0126381_100899942	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	1274	Open in IMG/M
3300010379\|Ga0136449_100437510	All Organisms → cellular organisms → Bacteria	2301	Open in IMG/M
3300012189\|Ga0137388_10050668	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3366	Open in IMG/M
3300012206\|Ga0137380_11668476	Not Available	521	Open in IMG/M
3300012210\|Ga0137378_11192694	All Organisms → cellular organisms → Bacteria → Acidobacteria	677	Open in IMG/M
3300012211\|Ga0137377_11056911	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	742	Open in IMG/M
3300012493\|Ga0157355_1025484	All Organisms → cellular organisms → Bacteria → Acidobacteria	579	Open in IMG/M
3300012683\|Ga0137398_11110283	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300012925\|Ga0137419_10584983	All Organisms → cellular organisms → Bacteria	895	Open in IMG/M
3300012986\|Ga0164304_10464846	All Organisms → cellular organisms → Bacteria → Acidobacteria	915	Open in IMG/M
3300013102\|Ga0157371_10274139	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1218	Open in IMG/M
3300014166\|Ga0134079_10116742	Not Available	1039	Open in IMG/M
3300014489\|Ga0182018_10213592	Not Available	1074	Open in IMG/M
3300014968\|Ga0157379_10442612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1198	Open in IMG/M
3300015199\|Ga0167647_1077423	Not Available	871	Open in IMG/M
3300015371\|Ga0132258_10036198	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	11122	Open in IMG/M
3300015374\|Ga0132255_100624855	All Organisms → cellular organisms → Bacteria → Acidobacteria	1594	Open in IMG/M
3300017961\|Ga0187778_10033741	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3130	Open in IMG/M
3300017966\|Ga0187776_11177893	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300017975\|Ga0187782_11318106	All Organisms → cellular organisms → Bacteria → Acidobacteria	566	Open in IMG/M
3300017999\|Ga0187767_10232491	Not Available	598	Open in IMG/M
3300018003\|Ga0187876_1216154	Not Available	637	Open in IMG/M
3300018062\|Ga0187784_10346738	All Organisms → cellular organisms → Bacteria → Acidobacteria	1204	Open in IMG/M
3300018090\|Ga0187770_11782300	Not Available	504	Open in IMG/M
3300018468\|Ga0066662_10234445	All Organisms → cellular organisms → Bacteria	1485	Open in IMG/M
3300019258\|Ga0181504_1426582	All Organisms → cellular organisms → Bacteria → Acidobacteria	754	Open in IMG/M
3300020580\|Ga0210403_10488642	Not Available	1001	Open in IMG/M
3300020583\|Ga0210401_10063265	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans	3483	Open in IMG/M
3300021180\|Ga0210396_10929785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → unclassified Thermus → Thermus sp. CCB_US3_UF1	740	Open in IMG/M
3300021181\|Ga0210388_10617767	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	947	Open in IMG/M
3300021403\|Ga0210397_10402915	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1023	Open in IMG/M
3300021406\|Ga0210386_10211787	Not Available	1644	Open in IMG/M
3300021433\|Ga0210391_10315136	Not Available	1227	Open in IMG/M
3300021445\|Ga0182009_10003545	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4659	Open in IMG/M
3300021475\|Ga0210392_10028814	All Organisms → cellular organisms → Bacteria	3243	Open in IMG/M
3300021560\|Ga0126371_10477429	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7	1394	Open in IMG/M
3300021560\|Ga0126371_10965543	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300021560\|Ga0126371_11409483	All Organisms → cellular organisms → Bacteria → Acidobacteria	827	Open in IMG/M
3300021560\|Ga0126371_11559683	All Organisms → cellular organisms → Bacteria	787	Open in IMG/M
3300021861\|Ga0213853_10931017	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	783	Open in IMG/M
3300022724\|Ga0242665_10010295	All Organisms → cellular organisms → Bacteria	1895	Open in IMG/M
3300025903\|Ga0207680_10415372	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
3300025921\|Ga0207652_11469569	Not Available	585	Open in IMG/M
3300025929\|Ga0207664_10915643	All Organisms → cellular organisms → Bacteria → Acidobacteria	787	Open in IMG/M
3300025945\|Ga0207679_11090197	Not Available	733	Open in IMG/M
3300025949\|Ga0207667_12106516	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300026034\|Ga0208773_1024012	Not Available	791	Open in IMG/M
3300026035\|Ga0207703_11898419	Not Available	572	Open in IMG/M
3300026309\|Ga0209055_1036136	All Organisms → cellular organisms → Bacteria	2216	Open in IMG/M
3300026360\|Ga0257173_1022892	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	794	Open in IMG/M
3300027497\|Ga0208199_1012926	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1922	Open in IMG/M
3300027591\|Ga0209733_1120845	Not Available	651	Open in IMG/M
3300027846\|Ga0209180_10788551	Not Available	510	Open in IMG/M
3300027857\|Ga0209166_10372779	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300027867\|Ga0209167_10077546	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1670	Open in IMG/M
3300027911\|Ga0209698_10158267	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1853	Open in IMG/M
3300027986\|Ga0209168_10018248	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4005	Open in IMG/M
3300028800\|Ga0265338_11226163	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300028828\|Ga0307312_11175388	Not Available	507	Open in IMG/M
3300029910\|Ga0311369_10856993	All Organisms → cellular organisms → Bacteria → Acidobacteria	730	Open in IMG/M
3300030503\|Ga0311370_11597834	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli	675	Open in IMG/M
3300030509\|Ga0302183_10364973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli	555	Open in IMG/M
3300030618\|Ga0311354_11064405	Not Available	741	Open in IMG/M
3300030646\|Ga0302316_10434294	Not Available	526	Open in IMG/M
3300031231\|Ga0170824_101164708	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300031231\|Ga0170824_127302404	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7	714	Open in IMG/M
3300031239\|Ga0265328_10061557	All Organisms → cellular organisms → Bacteria	1378	Open in IMG/M
3300031446\|Ga0170820_16982526	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300031446\|Ga0170820_17560183	All Organisms → cellular organisms → Bacteria	880	Open in IMG/M
3300031753\|Ga0307477_10014637	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5352	Open in IMG/M
3300031823\|Ga0307478_10091189	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2344	Open in IMG/M
3300031938\|Ga0308175_101732718	Not Available	699	Open in IMG/M
3300032180\|Ga0307471_103559714	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300032261\|Ga0306920_100291589	All Organisms → cellular organisms → Bacteria → Acidobacteria	2431	Open in IMG/M
3300033804\|Ga0314863_036927	All Organisms → cellular organisms → Bacteria → Acidobacteria	991	Open in IMG/M
3300034163\|Ga0370515_0159234	Not Available	968	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	90.60%
Host-Associated	Host-Associated	9.40%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	79.49%
Aquatic	Environmental → Aquatic	11.11%
Plants	Host-Associated → Plants	9.40%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	75.21%
Sediment	Environmental → Aquatic → Sediment	6.84%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.98%
Freshwater	Environmental → Aquatic → Freshwater	4.27%
Peat	Environmental → Terrestrial → Peat	4.27%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.42%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.43%
Loam	Environmental → Terrestrial → Soil → Loam	15.38%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	9.40%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.84%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.27%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.42%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.71%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.71%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	28.21%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	15.38%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	9.40%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.98%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.13%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.56%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.71%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.71%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.85%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.85%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.85%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.85%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.55%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.69%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.69%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	6.84%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	5.13%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	4.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.27%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	4.27%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	4.27%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.42%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	3.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	3.42%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.42%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.56%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.71%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	1.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.71%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.71%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.71%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.71%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.71%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.85%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.85%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.85%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.85%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.85%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.85%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.85%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.85%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental	Open in IMG/M
3300001166	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2	Environmental	Open in IMG/M
3300001170	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005712	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005899	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental	Open in IMG/M
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009524	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG	Environmental	Open in IMG/M
3300009628	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10	Environmental	Open in IMG/M
3300009839	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012493	Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015199	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300017999	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG	Environmental	Open in IMG/M
3300018003	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018090	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019258	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022724	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026034	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes)	Environmental	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental	Open in IMG/M
3300026360	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B	Environmental	Open in IMG/M
3300027497	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)	Environmental	Open in IMG/M
3300027591	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300029910	III_Palsa_E2 coassembly	Environmental	Open in IMG/M
3300030503	III_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030509	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2	Environmental	Open in IMG/M
3300030618	II_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030646	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Host-Associated	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033804	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20	Environmental	Open in IMG/M
3300034163	Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F077656

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1047161022	3300000364	Soil	DNSVLLIEWGEKFPRLVRERDIEISLDHEAETARKIRVGS*
JGI12270J11330_102914692	3300000567	Peatlands Soil	LIEWGEKFPRLVRERDVEIALKRTSENERRVAVLR*
JGI12694J13545_10051743	3300001166	Forest Soil	IEWGEKFPHLRRECDIEISLERQSERERKIRIRS*
JGI12704J13340_10056803	3300001170	Forest Soil	IEWGEKFARFVRERDVEIALERTGESARRVVVSG*
JGI12627J18819_103006853	3300001867	Forest Soil	IEWGEKFPRFARERDLEIVLERKSENERNITLTGR*
Ga0066676_104377542	3300005186	Soil	ENSVLLIEWGEKFARFVRERDVEIAIERVSDDERRLRVITVPG*
Ga0066388_1022968063	3300005332	Tropical Forest Soil	SILLIEWGEKFPRFMRERDLEIALERNSDSERQITVAGR*
Ga0070714_1004248404	3300005435	Agricultural Soil	DLRSENSILLIEWGEKFPWLAMERDVEIAFERNGETDRMIRVSA*
Ga0070731_101954033	3300005538	Surface Soil	NSVLLIEWGEKFPHLRQDQDVEIALERVGEDKRRVQLTTR*
Ga0066661_108479692	3300005554	Soil	ILLIEWGEKFPRLVSERDVEISLLRENEGERRIKVSS*
Ga0066670_105828583	3300005560	Soil	LRSENSILLIEWGEKLPWLAMERDVEIALDRTGETERTIRVSA*
Ga0070762_101000201	3300005602	Soil	SILLIEWGEKFPGLIEQRDFEIALERLGENERRIRIST*
Ga0070762_102437492	3300005602	Soil	ILLIEWGEKFARLRLDRDIEITLERLGNTGRRIHRTAR*
Ga0070763_103541152	3300005610	Soil	LIEWGEKFPWLVRERDVEIALAREGENSRQIKVTG*
Ga0070764_104460942	3300005712	Soil	LIEWGEKFPRFERERDVEIALERVSESERRILVSYNSLSS*
Ga0066903_1050703971	3300005764	Tropical Forest Soil	NLLLVEWGEKFSRFVDESDLEIALERMGENDRKVRVLAR*
Ga0075271_100144021	3300005899	Rice Paddy Soil	RNVLLIEWGEKFPRYANGRDVEITIERLGEEDRRIRIFDF*
Ga0070717_100163777	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	ILLIEWGEKFPRFQNERDLEIGLERINQSERRIQLKD*
Ga0070717_116847403	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	SILLIEWGEKFPRLQNERDLEISLERMNQSERRIQLKD*
Ga0075024_1008852922	3300006047	Watersheds	LLIEWGEKFPHLRRDRDVEIALERVGENGRRIQLTTC*
Ga0075029_1003833471	3300006052	Watersheds	LIEWGEKFPRLLREREVEIELERVGESGRRIRVTG*
Ga0075017_1004150431	3300006059	Watersheds	EDSILLIEWGEKFPRLLRERDVEISLERQGEFGRRIRLNK*
Ga0075017_1007081421	3300006059	Watersheds	LIEWGEKFPRLQRDRDLEIALERVGESGRSIQLSSG*
Ga0075015_1003616262	3300006102	Watersheds	ILLIEWGEKFPRLLRDRGLEITLERVGETERRIRRVKR*
Ga0075030_1002555283	3300006162	Watersheds	LIEWGEKFARFVRDRDVEITLERVGENDRKIQVTSR*
Ga0070716_1011059232	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	EWGEKFPRFVRERDVEITLERVGENDRKIQISGR*
Ga0075014_1007508381	3300006174	Watersheds	SILLIEWGEKFPRFVRDRDVEIVLKPVGESGRSIQLSTR*
Ga0070712_1019496451	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	LLLIEWGEKFSRLQWDVEIEFERQGETGRRIRISG*
Ga0070765_1000603211	3300006176	Soil	NSILLIEWGEKFPRLVRERDLEIALERDGENVRQIRVRG*
Ga0079222_117413481	3300006755	Agricultural Soil	LLIEWGEKFARFERERDLEIALERTGEEGRRIRVTSGKG*
Ga0099795_100664791	3300007788	Vadose Zone Soil	IEWGEKFPRFVRERDVEITFERVAENERRIQVSGL*
Ga0099829_117667321	3300009038	Vadose Zone Soil	LLIEWGEKFARFERERDVEIALERISESERRIRVTE*
Ga0105241_104455951	3300009174	Corn Rhizosphere	LIEWGEKFPRFQRERDVEIALERTGENQRKIVVSSSRDKA*
Ga0116225_10107255	3300009524	Peatlands Soil	LLIEWGEKFARFERERNVEIALERINENERRVRITC*
Ga0116125_10409492	3300009628	Peatland	LIEWGEKFPRLLRERDVEISLERQSENGRKITVVS*
Ga0116125_10602212	3300009628	Peatland	IEWGEKFARFERERDVEIALERAGENERRVRVSRG*
Ga0116223_106216031	3300009839	Peatlands Soil	LLIEWGEKFPRLLRERDVEIELERESENSRRIRMIS*
Ga0126380_105246562	3300010043	Tropical Forest Soil	LLIEWGEKFPRLVRDRDVEISLERQGESERRITISGVQ*
Ga0126384_118533353	3300010046	Tropical Forest Soil	LIEWGEKFPWFVRERDVEISLEHDGENRRKIHVAR*
Ga0126373_121996961	3300010048	Tropical Forest Soil	EWGEKFSRFERERNVEIVLETVGENDRRIRVITA*
Ga0126376_119440222	3300010359	Tropical Forest Soil	LLIEWGEKFDRFRKNRDVEIAFDIVGETDRKIRVEGG*
Ga0126381_1008999423	3300010376	Tropical Forest Soil	RSENSILLIEWGEKFPRVVRERDLEISLAPSGEQSRHIRLLE*
Ga0136449_1004375101	3300010379	Peatlands Soil	LIEWGEKFARFERERDVEIALERVGENERRVRVSS*
Ga0137388_100506681	3300012189	Vadose Zone Soil	NSILLVEWGEKFARFERDRDVEIALERMSENERHIRISSR*
Ga0137380_116684761	3300012206	Vadose Zone Soil	RSENSVLLIEWGEKFPRLQWDVEIDLERAGDSERRIRIRG*
Ga0137378_111926941	3300012210	Vadose Zone Soil	DLRSENSVLLIEWGEKFPRLQWDVEIDLERAGDSERRIRIRG*
Ga0137377_110569114	3300012211	Vadose Zone Soil	EWGEKFPRFVRERNVEIVLERVDENERRIQVTGL*
Ga0157355_10254842	3300012493	Unplanted Soil	LLIEWGEKFPRLVRERDVEISLERDGESGRRIRIAR*
Ga0137398_111102831	3300012683	Vadose Zone Soil	LRSEGSILLIEWGEKFPRLLRERDVEISRERQRETERKIRIRRP*
Ga0137419_105849831	3300012925	Vadose Zone Soil	LLIEWGEKFPRFERERDVEIALETVSEQERRIKISDSRF*
Ga0164304_104648461	3300012986	Soil	LIEWGEKFSRFERERDLEIAFERIGEDRRRIAISA*
Ga0157371_102741393	3300013102	Corn Rhizosphere	IEWGEKFPRFLRERDVEIVLEWAGEERRKLVVRS*
Ga0134079_101167421	3300014166	Grasslands Soil	SVLLIEWGEKFPRILQERDVEIALERVSENERQIRVIP*
Ga0182018_102135923	3300014489	Palsa	GSILLIEWGEKFPRLQRERDVEISLERDGESGRRIRIVS*
Ga0157379_104426121	3300014968	Switchgrass Rhizosphere	WGEKFPRFVRERDVEIELERVGENERRVLVKVELIS*
Ga0167647_10774231	3300015199	Glacier Forefield Soil	LFSDNSVLLIEWGEKFARFERERDFEIAIARISEHARRVRVSER*
Ga0132258_100361989	3300015371	Arabidopsis Rhizosphere	LLIEWGEKFARLVRERDLEIALVRVRESERRITVR*
Ga0132255_1006248553	3300015374	Arabidopsis Rhizosphere	ILLIEWGEKFPRFERERDVEIALERVSEDERRIRITAP*
Ga0187778_100337411	3300017961	Tropical Peatland	DLTSLRSLILIEWGEKFERFHRNRDVEIVFERTGENARRIRVTGL
Ga0187776_111778932	3300017966	Tropical Peatland	LIEWGEKFARFLRERDVEITIERLGENDRKIKIAAD
Ga0187782_113181062	3300017975	Tropical Peatland	SDDSILLIEWGEKFPRFLRERDVEIVLERVEESERRIKVNGYV
Ga0187767_102324912	3300017999	Tropical Peatland	FPRFVRERDVEIALERVGENERRIRAISDRKLKIAD
Ga0187876_12161542	3300018003	Peatland	LLIEWGEKFPQLQRERDVEIVLEREGEGESRRRIKISS
Ga0187784_103467381	3300018062	Tropical Peatland	ILLIEWGEKFSRFERERDIEIRLERVTETGRRIQLTSR
Ga0187770_117823002	3300018090	Tropical Peatland	IEWGEKFPRFVRERDVEIVLERVGENERRVIVSDQRTS
Ga0066662_102344451	3300018468	Grasslands Soil	SENSILLIEWGEKFPWLAMERDVEISFDRTGETERMIRVSA
Ga0181504_14265821	3300019258	Peatland	ILLIEWGEKFSQLQRDRHVEIVLERVGESERRIRRTAR
Ga0210403_104886423	3300020580	Soil	RSDNSILLIEWGEKFPRLRWDVEIALEREGENGRRIKVSG
Ga0210401_100632651	3300020583	Soil	LIEWGEKFPRLVRERDVEIALEREGEHNRRITVRG
Ga0210396_109297851	3300021180	Soil	EWGEKFARFERERDVEIALERVGENERRIKISTRG
Ga0210388_106177671	3300021181	Soil	GEKFPRFLRERDVEISLEREGESGRRIRVSGPSLS
Ga0210397_104029151	3300021403	Soil	LIEWGEKFPRLVRERDVEIALEREGENGRRIRVSA
Ga0210386_102117871	3300021406	Soil	SVLLIEWGEKFPRLVRQRDVEIALEREGEYKRRITVRG
Ga0210391_103151361	3300021433	Soil	VLLIEWGEKFARLQRERDMEISLEPDGENRRQIRIVS
Ga0182009_100035451	3300021445	Soil	SENSILLIEWGEKFPWLAMERDVEIAFERNGETDRMIRVSA
Ga0210392_100288141	3300021475	Soil	SDNSILLIEWGEKFPGLIEQRDFEIALERLGENERRIRIST
Ga0126371_104774291	3300021560	Tropical Forest Soil	SENSILLIEWGEKFPRFVRERDLEISLAPAGEQSRHIRLLE
Ga0126371_109655431	3300021560	Tropical Forest Soil	LIEWGEKFARFVRDCDAEISLEQVSERERKIQVRIR
Ga0126371_114094831	3300021560	Tropical Forest Soil	ILLIEWGEKFPRFTRERDLEIALERTGEISRVIRIVV
Ga0126371_115596832	3300021560	Tropical Forest Soil	LIEWGEKFSRFVDESDLEIALERMGENDRKVRVLARRS
Ga0213853_109310172	3300021861	Watersheds	LIEWGEKFPRLQRDRDIEISLERVGETGRRIQLTAR
Ga0242665_100102951	3300022724	Soil	SILLVEWGEKFPRLMRERDVEIALEREGESGRRIRVSV
Ga0207680_104153721	3300025903	Switchgrass Rhizosphere	LIEWGEKFPRFERERDVEIALERVSEDERRIRITAP
Ga0207652_114695691	3300025921	Corn Rhizosphere	LLLIEWGEKFPQFQRERDVEIAIERIGESDRKFRLVEI
Ga0207664_109156432	3300025929	Agricultural Soil	SENSVLLIEWGEKFPRLEWDVEIDLERTGESGRRIRISG
Ga0207679_110901973	3300025945	Corn Rhizosphere	ENAILLIEWGEKFPWLAMERDVEIAFERNGETDRTIRVSA
Ga0207667_121065162	3300025949	Corn Rhizosphere	ILLIEWGEKFARFVRERDLEIALERVRESERRVTVW
Ga0208773_10240122	3300026034	Rice Paddy Soil	IEWGEKFPRYANGRDVEITIERLGEEDRRIRIFDF
Ga0207703_118984192	3300026035	Switchgrass Rhizosphere	LLIEWGEKFPRFVRERDVEIRLERVGEMERRVLVKVELIS
Ga0209055_10361361	3300026309	Soil	LIEWGEKFPRLLRERDVEISFERQGETARRIRIVGLP
Ga0257173_10228923	3300026360	Soil	LLIEWGEKFPRFVRERNVEIVLERVDENERRIQVTGL
Ga0208199_10129263	3300027497	Peatlands Soil	SVLLIEWGEKFARFERERNVEIALERINENERRVRITC
Ga0209733_11208452	3300027591	Forest Soil	DNSILLIEWGEKFPRLRNERDLEIGLERINQSERRIQLKD
Ga0209180_107885512	3300027846	Vadose Zone Soil	VLLIEWGEKFARFERERDVEIALERISESERRIRVTE
Ga0209166_103727791	3300027857	Surface Soil	NAVLLIEWGEKFSRFVRERDVEIAITRLGENARKFEVL
Ga0209167_100775463	3300027867	Surface Soil	VLLIEWGEKFARFERERDVEISLKREGESGRRIRIIGNDSAL
Ga0209698_101582673	3300027911	Watersheds	DSILLIEWGEKFPRLLRERDVEIVLEREGENRRGIRVSR
Ga0209168_100182481	3300027986	Surface Soil	DDLKDSKNILLIEWGEKFPNLVREKDLEIALERKSETERLIRVHV
Ga0265338_112261632	3300028800	Rhizosphere	LIEWGEKFPRLQRERDVEIALEREGESVRRIRISS
Ga0307312_111753881	3300028828	Soil	LIEWGEKFARFERDRDVEISLERLGENDRKIQVVGR
Ga0311369_108569931	3300029910	Palsa	ILLIEWGEKFPRLHWDVEIALERVGENERRIKVRG
Ga0311370_115978341	3300030503	Palsa	LIEWGEKFPRFLRERDVEISLERDEESGRRIRIIG
Ga0302183_103649731	3300030509	Palsa	DLRAEPKSILLIEWGEKFPRFLRERDVEISLERDEESGRRIRIIG
Ga0311354_110644052	3300030618	Palsa	DSVLLIEWGEKFPQLLDERDAEISLERVDEDTRKIKITMRDDGAK
Ga0302316_104342941	3300030646	Palsa	SSGILLVEWGEKFPYLQRERDVEISFERESETRRRIKLTD
Ga0170824_1011647081	3300031231	Forest Soil	SDNSILLIEWGEKFPRLQRECQVEISLERQSETERKIRIRRP
Ga0170824_1273024041	3300031231	Forest Soil	SVLLIEWGEKFPQLKQEQDAQITLERVGEDGRRIKLTTS
Ga0265328_100615573	3300031239	Rhizosphere	LLIEWGEKFPRLVRERDVEIALERESETKRRIRISS
Ga0170820_169825261	3300031446	Forest Soil	SILLIEWGEKFPRLRWDVEIALEREGEHGRRIKVRG
Ga0170820_175601831	3300031446	Forest Soil	LLIEWGEKFARFVKGRDVEIGLERVGENERRIMVNAEVK
Ga0307477_100146376	3300031753	Hardwood Forest Soil	IEWGEKFPRLQREQTLEIALERVAETERRIVLTATDSGSRS
Ga0307478_100911891	3300031823	Hardwood Forest Soil	VLLIEWGEKFTRFTKERDIEISLDRIGENERIIQVSA
Ga0308175_1017327183	3300031938	Soil	LRSENSILLIEWGEKFPSLTAERDVEIFFERTGETERTIRVSA
Ga0307471_1035597142	3300032180	Hardwood Forest Soil	LLIEWGEKFPHLRRDRDVEIALERVGEEGRRIRLTTG
Ga0306920_1002915891	3300032261	Soil	LIEWGEKFPRFVRERDVEISLEREGDSGRRIRINS
Ga0314863_036927_2_109	3300033804	Peatland	LIEWGEKFPSLRRDRDVEIVIERLAECERRIRVSP
Ga0370515_0159234_839_967	3300034163	Untreated Peat Soil	AEINSILLIEWGEKFPRFVRERDVEISLKREGESARKVRISL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign