| Basic Information | |
|---|---|
| Family ID | F077656 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 38 residues |
| Representative Sequence | LIEWGEKFPRLVRERDVEIALEREGENGRRIRVSA |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.18 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.068 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.547 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.368 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.427 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.76% β-sheet: 19.05% Coil/Unstructured: 76.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 35.90 |
| PF00326 | Peptidase_S9 | 6.84 |
| PF00753 | Lactamase_B | 3.42 |
| PF07690 | MFS_1 | 3.42 |
| PF01545 | Cation_efflux | 2.56 |
| PF00144 | Beta-lactamase | 1.71 |
| PF01061 | ABC2_membrane | 1.71 |
| PF02367 | TsaE | 1.71 |
| PF06262 | Zincin_1 | 0.85 |
| PF04073 | tRNA_edit | 0.85 |
| PF13340 | DUF4096 | 0.85 |
| PF13505 | OMP_b-brl | 0.85 |
| PF13181 | TPR_8 | 0.85 |
| PF05076 | SUFU | 0.85 |
| PF13420 | Acetyltransf_4 | 0.85 |
| PF04389 | Peptidase_M28 | 0.85 |
| PF02954 | HTH_8 | 0.85 |
| PF06127 | Mpo1-like | 0.85 |
| PF13620 | CarboxypepD_reg | 0.85 |
| PF08837 | DUF1810 | 0.85 |
| PF13578 | Methyltransf_24 | 0.85 |
| PF05977 | MFS_3 | 0.85 |
| PF02374 | ArsA_ATPase | 0.85 |
| PF01384 | PHO4 | 0.85 |
| PF11008 | DUF2846 | 0.85 |
| PF07617 | DUF1579 | 0.85 |
| PF01790 | LGT | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 2.56 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 2.56 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 2.56 |
| COG0802 | tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE | Translation, ribosomal structure and biogenesis [J] | 1.71 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.71 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.71 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.71 |
| COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.85 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.85 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 0.85 |
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.07 % |
| Unclassified | root | N/A | 23.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104716102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300000567|JGI12270J11330_10291469 | Not Available | 510 | Open in IMG/M |
| 3300001166|JGI12694J13545_1005174 | Not Available | 1614 | Open in IMG/M |
| 3300001170|JGI12704J13340_1005680 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300001867|JGI12627J18819_10300685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300005186|Ga0066676_10437754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 885 | Open in IMG/M |
| 3300005332|Ga0066388_102296806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 976 | Open in IMG/M |
| 3300005435|Ga0070714_100424840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1259 | Open in IMG/M |
| 3300005538|Ga0070731_10195403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1343 | Open in IMG/M |
| 3300005554|Ga0066661_10847969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 534 | Open in IMG/M |
| 3300005560|Ga0066670_10582858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
| 3300005602|Ga0070762_10100020 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300005602|Ga0070762_10243749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1115 | Open in IMG/M |
| 3300005610|Ga0070763_10354115 | Not Available | 817 | Open in IMG/M |
| 3300005712|Ga0070764_10446094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 771 | Open in IMG/M |
| 3300005764|Ga0066903_105070397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 698 | Open in IMG/M |
| 3300005899|Ga0075271_10014402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
| 3300006028|Ga0070717_10016377 | All Organisms → cellular organisms → Bacteria | 5747 | Open in IMG/M |
| 3300006028|Ga0070717_11684740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 574 | Open in IMG/M |
| 3300006047|Ga0075024_100885292 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006052|Ga0075029_100383347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 911 | Open in IMG/M |
| 3300006059|Ga0075017_100415043 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300006059|Ga0075017_100708142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 775 | Open in IMG/M |
| 3300006102|Ga0075015_100361626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 811 | Open in IMG/M |
| 3300006162|Ga0075030_100255528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1404 | Open in IMG/M |
| 3300006173|Ga0070716_101105923 | Not Available | 632 | Open in IMG/M |
| 3300006174|Ga0075014_100750838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 572 | Open in IMG/M |
| 3300006175|Ga0070712_101949645 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006176|Ga0070765_100060321 | All Organisms → cellular organisms → Bacteria | 3139 | Open in IMG/M |
| 3300006755|Ga0079222_11741348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 600 | Open in IMG/M |
| 3300007788|Ga0099795_10066479 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300009038|Ga0099829_11766732 | Not Available | 507 | Open in IMG/M |
| 3300009174|Ga0105241_10445595 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300009524|Ga0116225_1010725 | All Organisms → cellular organisms → Bacteria | 4990 | Open in IMG/M |
| 3300009628|Ga0116125_1040949 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300009628|Ga0116125_1060221 | Not Available | 977 | Open in IMG/M |
| 3300009839|Ga0116223_10621603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 623 | Open in IMG/M |
| 3300010043|Ga0126380_10524656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300010046|Ga0126384_11853335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300010048|Ga0126373_12199696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300010359|Ga0126376_11944022 | Not Available | 629 | Open in IMG/M |
| 3300010376|Ga0126381_100899942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1274 | Open in IMG/M |
| 3300010379|Ga0136449_100437510 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
| 3300012189|Ga0137388_10050668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3366 | Open in IMG/M |
| 3300012206|Ga0137380_11668476 | Not Available | 521 | Open in IMG/M |
| 3300012210|Ga0137378_11192694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300012211|Ga0137377_11056911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300012493|Ga0157355_1025484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012683|Ga0137398_11110283 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012925|Ga0137419_10584983 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300012986|Ga0164304_10464846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300013102|Ga0157371_10274139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1218 | Open in IMG/M |
| 3300014166|Ga0134079_10116742 | Not Available | 1039 | Open in IMG/M |
| 3300014489|Ga0182018_10213592 | Not Available | 1074 | Open in IMG/M |
| 3300014968|Ga0157379_10442612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1198 | Open in IMG/M |
| 3300015199|Ga0167647_1077423 | Not Available | 871 | Open in IMG/M |
| 3300015371|Ga0132258_10036198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11122 | Open in IMG/M |
| 3300015374|Ga0132255_100624855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1594 | Open in IMG/M |
| 3300017961|Ga0187778_10033741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3130 | Open in IMG/M |
| 3300017966|Ga0187776_11177893 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300017975|Ga0187782_11318106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300017999|Ga0187767_10232491 | Not Available | 598 | Open in IMG/M |
| 3300018003|Ga0187876_1216154 | Not Available | 637 | Open in IMG/M |
| 3300018062|Ga0187784_10346738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
| 3300018090|Ga0187770_11782300 | Not Available | 504 | Open in IMG/M |
| 3300018468|Ga0066662_10234445 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300019258|Ga0181504_1426582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300020580|Ga0210403_10488642 | Not Available | 1001 | Open in IMG/M |
| 3300020583|Ga0210401_10063265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 3483 | Open in IMG/M |
| 3300021180|Ga0210396_10929785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → unclassified Thermus → Thermus sp. CCB_US3_UF1 | 740 | Open in IMG/M |
| 3300021181|Ga0210388_10617767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 947 | Open in IMG/M |
| 3300021403|Ga0210397_10402915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300021406|Ga0210386_10211787 | Not Available | 1644 | Open in IMG/M |
| 3300021433|Ga0210391_10315136 | Not Available | 1227 | Open in IMG/M |
| 3300021445|Ga0182009_10003545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4659 | Open in IMG/M |
| 3300021475|Ga0210392_10028814 | All Organisms → cellular organisms → Bacteria | 3243 | Open in IMG/M |
| 3300021560|Ga0126371_10477429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1394 | Open in IMG/M |
| 3300021560|Ga0126371_10965543 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300021560|Ga0126371_11409483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300021560|Ga0126371_11559683 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300021861|Ga0213853_10931017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 783 | Open in IMG/M |
| 3300022724|Ga0242665_10010295 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300025903|Ga0207680_10415372 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300025921|Ga0207652_11469569 | Not Available | 585 | Open in IMG/M |
| 3300025929|Ga0207664_10915643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300025945|Ga0207679_11090197 | Not Available | 733 | Open in IMG/M |
| 3300025949|Ga0207667_12106516 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026034|Ga0208773_1024012 | Not Available | 791 | Open in IMG/M |
| 3300026035|Ga0207703_11898419 | Not Available | 572 | Open in IMG/M |
| 3300026309|Ga0209055_1036136 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
| 3300026360|Ga0257173_1022892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300027497|Ga0208199_1012926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1922 | Open in IMG/M |
| 3300027591|Ga0209733_1120845 | Not Available | 651 | Open in IMG/M |
| 3300027846|Ga0209180_10788551 | Not Available | 510 | Open in IMG/M |
| 3300027857|Ga0209166_10372779 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300027867|Ga0209167_10077546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1670 | Open in IMG/M |
| 3300027911|Ga0209698_10158267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1853 | Open in IMG/M |
| 3300027986|Ga0209168_10018248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4005 | Open in IMG/M |
| 3300028800|Ga0265338_11226163 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300028828|Ga0307312_11175388 | Not Available | 507 | Open in IMG/M |
| 3300029910|Ga0311369_10856993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300030503|Ga0311370_11597834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 675 | Open in IMG/M |
| 3300030509|Ga0302183_10364973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 555 | Open in IMG/M |
| 3300030618|Ga0311354_11064405 | Not Available | 741 | Open in IMG/M |
| 3300030646|Ga0302316_10434294 | Not Available | 526 | Open in IMG/M |
| 3300031231|Ga0170824_101164708 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031231|Ga0170824_127302404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 714 | Open in IMG/M |
| 3300031239|Ga0265328_10061557 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300031446|Ga0170820_16982526 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031446|Ga0170820_17560183 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300031753|Ga0307477_10014637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5352 | Open in IMG/M |
| 3300031823|Ga0307478_10091189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2344 | Open in IMG/M |
| 3300031938|Ga0308175_101732718 | Not Available | 699 | Open in IMG/M |
| 3300032180|Ga0307471_103559714 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300032261|Ga0306920_100291589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2431 | Open in IMG/M |
| 3300033804|Ga0314863_036927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300034163|Ga0370515_0159234 | Not Available | 968 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.84% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.13% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.71% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026034 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1047161022 | 3300000364 | Soil | DNSVLLIEWGEKFPRLVRERDIEISLDHEAETARKIRVGS* |
| JGI12270J11330_102914692 | 3300000567 | Peatlands Soil | LIEWGEKFPRLVRERDVEIALKRTSENERRVAVLR* |
| JGI12694J13545_10051743 | 3300001166 | Forest Soil | IEWGEKFPHLRRECDIEISLERQSERERKIRIRS* |
| JGI12704J13340_10056803 | 3300001170 | Forest Soil | IEWGEKFARFVRERDVEIALERTGESARRVVVSG* |
| JGI12627J18819_103006853 | 3300001867 | Forest Soil | IEWGEKFPRFARERDLEIVLERKSENERNITLTGR* |
| Ga0066676_104377542 | 3300005186 | Soil | ENSVLLIEWGEKFARFVRERDVEIAIERVSDDERRLRVITVPG* |
| Ga0066388_1022968063 | 3300005332 | Tropical Forest Soil | SILLIEWGEKFPRFMRERDLEIALERNSDSERQITVAGR* |
| Ga0070714_1004248404 | 3300005435 | Agricultural Soil | DLRSENSILLIEWGEKFPWLAMERDVEIAFERNGETDRMIRVSA* |
| Ga0070731_101954033 | 3300005538 | Surface Soil | NSVLLIEWGEKFPHLRQDQDVEIALERVGEDKRRVQLTTR* |
| Ga0066661_108479692 | 3300005554 | Soil | ILLIEWGEKFPRLVSERDVEISLLRENEGERRIKVSS* |
| Ga0066670_105828583 | 3300005560 | Soil | LRSENSILLIEWGEKLPWLAMERDVEIALDRTGETERTIRVSA* |
| Ga0070762_101000201 | 3300005602 | Soil | SILLIEWGEKFPGLIEQRDFEIALERLGENERRIRIST* |
| Ga0070762_102437492 | 3300005602 | Soil | ILLIEWGEKFARLRLDRDIEITLERLGNTGRRIHRTAR* |
| Ga0070763_103541152 | 3300005610 | Soil | LIEWGEKFPWLVRERDVEIALAREGENSRQIKVTG* |
| Ga0070764_104460942 | 3300005712 | Soil | LIEWGEKFPRFERERDVEIALERVSESERRILVSYNSLSS* |
| Ga0066903_1050703971 | 3300005764 | Tropical Forest Soil | NLLLVEWGEKFSRFVDESDLEIALERMGENDRKVRVLAR* |
| Ga0075271_100144021 | 3300005899 | Rice Paddy Soil | RNVLLIEWGEKFPRYANGRDVEITIERLGEEDRRIRIFDF* |
| Ga0070717_100163777 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ILLIEWGEKFPRFQNERDLEIGLERINQSERRIQLKD* |
| Ga0070717_116847403 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SILLIEWGEKFPRLQNERDLEISLERMNQSERRIQLKD* |
| Ga0075024_1008852922 | 3300006047 | Watersheds | LLIEWGEKFPHLRRDRDVEIALERVGENGRRIQLTTC* |
| Ga0075029_1003833471 | 3300006052 | Watersheds | LIEWGEKFPRLLREREVEIELERVGESGRRIRVTG* |
| Ga0075017_1004150431 | 3300006059 | Watersheds | EDSILLIEWGEKFPRLLRERDVEISLERQGEFGRRIRLNK* |
| Ga0075017_1007081421 | 3300006059 | Watersheds | LIEWGEKFPRLQRDRDLEIALERVGESGRSIQLSSG* |
| Ga0075015_1003616262 | 3300006102 | Watersheds | ILLIEWGEKFPRLLRDRGLEITLERVGETERRIRRVKR* |
| Ga0075030_1002555283 | 3300006162 | Watersheds | LIEWGEKFARFVRDRDVEITLERVGENDRKIQVTSR* |
| Ga0070716_1011059232 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EWGEKFPRFVRERDVEITLERVGENDRKIQISGR* |
| Ga0075014_1007508381 | 3300006174 | Watersheds | SILLIEWGEKFPRFVRDRDVEIVLKPVGESGRSIQLSTR* |
| Ga0070712_1019496451 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLIEWGEKFSRLQWDVEIEFERQGETGRRIRISG* |
| Ga0070765_1000603211 | 3300006176 | Soil | NSILLIEWGEKFPRLVRERDLEIALERDGENVRQIRVRG* |
| Ga0079222_117413481 | 3300006755 | Agricultural Soil | LLIEWGEKFARFERERDLEIALERTGEEGRRIRVTSGKG* |
| Ga0099795_100664791 | 3300007788 | Vadose Zone Soil | IEWGEKFPRFVRERDVEITFERVAENERRIQVSGL* |
| Ga0099829_117667321 | 3300009038 | Vadose Zone Soil | LLIEWGEKFARFERERDVEIALERISESERRIRVTE* |
| Ga0105241_104455951 | 3300009174 | Corn Rhizosphere | LIEWGEKFPRFQRERDVEIALERTGENQRKIVVSSSRDKA* |
| Ga0116225_10107255 | 3300009524 | Peatlands Soil | LLIEWGEKFARFERERNVEIALERINENERRVRITC* |
| Ga0116125_10409492 | 3300009628 | Peatland | LIEWGEKFPRLLRERDVEISLERQSENGRKITVVS* |
| Ga0116125_10602212 | 3300009628 | Peatland | IEWGEKFARFERERDVEIALERAGENERRVRVSRG* |
| Ga0116223_106216031 | 3300009839 | Peatlands Soil | LLIEWGEKFPRLLRERDVEIELERESENSRRIRMIS* |
| Ga0126380_105246562 | 3300010043 | Tropical Forest Soil | LLIEWGEKFPRLVRDRDVEISLERQGESERRITISGVQ* |
| Ga0126384_118533353 | 3300010046 | Tropical Forest Soil | LIEWGEKFPWFVRERDVEISLEHDGENRRKIHVAR* |
| Ga0126373_121996961 | 3300010048 | Tropical Forest Soil | EWGEKFSRFERERNVEIVLETVGENDRRIRVITA* |
| Ga0126376_119440222 | 3300010359 | Tropical Forest Soil | LLIEWGEKFDRFRKNRDVEIAFDIVGETDRKIRVEGG* |
| Ga0126381_1008999423 | 3300010376 | Tropical Forest Soil | RSENSILLIEWGEKFPRVVRERDLEISLAPSGEQSRHIRLLE* |
| Ga0136449_1004375101 | 3300010379 | Peatlands Soil | LIEWGEKFARFERERDVEIALERVGENERRVRVSS* |
| Ga0137388_100506681 | 3300012189 | Vadose Zone Soil | NSILLVEWGEKFARFERDRDVEIALERMSENERHIRISSR* |
| Ga0137380_116684761 | 3300012206 | Vadose Zone Soil | RSENSVLLIEWGEKFPRLQWDVEIDLERAGDSERRIRIRG* |
| Ga0137378_111926941 | 3300012210 | Vadose Zone Soil | DLRSENSVLLIEWGEKFPRLQWDVEIDLERAGDSERRIRIRG* |
| Ga0137377_110569114 | 3300012211 | Vadose Zone Soil | EWGEKFPRFVRERNVEIVLERVDENERRIQVTGL* |
| Ga0157355_10254842 | 3300012493 | Unplanted Soil | LLIEWGEKFPRLVRERDVEISLERDGESGRRIRIAR* |
| Ga0137398_111102831 | 3300012683 | Vadose Zone Soil | LRSEGSILLIEWGEKFPRLLRERDVEISRERQRETERKIRIRRP* |
| Ga0137419_105849831 | 3300012925 | Vadose Zone Soil | LLIEWGEKFPRFERERDVEIALETVSEQERRIKISDSRF* |
| Ga0164304_104648461 | 3300012986 | Soil | LIEWGEKFSRFERERDLEIAFERIGEDRRRIAISA* |
| Ga0157371_102741393 | 3300013102 | Corn Rhizosphere | IEWGEKFPRFLRERDVEIVLEWAGEERRKLVVRS* |
| Ga0134079_101167421 | 3300014166 | Grasslands Soil | SVLLIEWGEKFPRILQERDVEIALERVSENERQIRVIP* |
| Ga0182018_102135923 | 3300014489 | Palsa | GSILLIEWGEKFPRLQRERDVEISLERDGESGRRIRIVS* |
| Ga0157379_104426121 | 3300014968 | Switchgrass Rhizosphere | WGEKFPRFVRERDVEIELERVGENERRVLVKVELIS* |
| Ga0167647_10774231 | 3300015199 | Glacier Forefield Soil | LFSDNSVLLIEWGEKFARFERERDFEIAIARISEHARRVRVSER* |
| Ga0132258_100361989 | 3300015371 | Arabidopsis Rhizosphere | LLIEWGEKFARLVRERDLEIALVRVRESERRITVR* |
| Ga0132255_1006248553 | 3300015374 | Arabidopsis Rhizosphere | ILLIEWGEKFPRFERERDVEIALERVSEDERRIRITAP* |
| Ga0187778_100337411 | 3300017961 | Tropical Peatland | DLTSLRSLILIEWGEKFERFHRNRDVEIVFERTGENARRIRVTGL |
| Ga0187776_111778932 | 3300017966 | Tropical Peatland | LIEWGEKFARFLRERDVEITIERLGENDRKIKIAAD |
| Ga0187782_113181062 | 3300017975 | Tropical Peatland | SDDSILLIEWGEKFPRFLRERDVEIVLERVEESERRIKVNGYV |
| Ga0187767_102324912 | 3300017999 | Tropical Peatland | FPRFVRERDVEIALERVGENERRIRAISDRKLKIAD |
| Ga0187876_12161542 | 3300018003 | Peatland | LLIEWGEKFPQLQRERDVEIVLEREGEGESRRRIKISS |
| Ga0187784_103467381 | 3300018062 | Tropical Peatland | ILLIEWGEKFSRFERERDIEIRLERVTETGRRIQLTSR |
| Ga0187770_117823002 | 3300018090 | Tropical Peatland | IEWGEKFPRFVRERDVEIVLERVGENERRVIVSDQRTS |
| Ga0066662_102344451 | 3300018468 | Grasslands Soil | SENSILLIEWGEKFPWLAMERDVEISFDRTGETERMIRVSA |
| Ga0181504_14265821 | 3300019258 | Peatland | ILLIEWGEKFSQLQRDRHVEIVLERVGESERRIRRTAR |
| Ga0210403_104886423 | 3300020580 | Soil | RSDNSILLIEWGEKFPRLRWDVEIALEREGENGRRIKVSG |
| Ga0210401_100632651 | 3300020583 | Soil | LIEWGEKFPRLVRERDVEIALEREGEHNRRITVRG |
| Ga0210396_109297851 | 3300021180 | Soil | EWGEKFARFERERDVEIALERVGENERRIKISTRG |
| Ga0210388_106177671 | 3300021181 | Soil | GEKFPRFLRERDVEISLEREGESGRRIRVSGPSLS |
| Ga0210397_104029151 | 3300021403 | Soil | LIEWGEKFPRLVRERDVEIALEREGENGRRIRVSA |
| Ga0210386_102117871 | 3300021406 | Soil | SVLLIEWGEKFPRLVRQRDVEIALEREGEYKRRITVRG |
| Ga0210391_103151361 | 3300021433 | Soil | VLLIEWGEKFARLQRERDMEISLEPDGENRRQIRIVS |
| Ga0182009_100035451 | 3300021445 | Soil | SENSILLIEWGEKFPWLAMERDVEIAFERNGETDRMIRVSA |
| Ga0210392_100288141 | 3300021475 | Soil | SDNSILLIEWGEKFPGLIEQRDFEIALERLGENERRIRIST |
| Ga0126371_104774291 | 3300021560 | Tropical Forest Soil | SENSILLIEWGEKFPRFVRERDLEISLAPAGEQSRHIRLLE |
| Ga0126371_109655431 | 3300021560 | Tropical Forest Soil | LIEWGEKFARFVRDCDAEISLEQVSERERKIQVRIR |
| Ga0126371_114094831 | 3300021560 | Tropical Forest Soil | ILLIEWGEKFPRFTRERDLEIALERTGEISRVIRIVV |
| Ga0126371_115596832 | 3300021560 | Tropical Forest Soil | LIEWGEKFSRFVDESDLEIALERMGENDRKVRVLARRS |
| Ga0213853_109310172 | 3300021861 | Watersheds | LIEWGEKFPRLQRDRDIEISLERVGETGRRIQLTAR |
| Ga0242665_100102951 | 3300022724 | Soil | SILLVEWGEKFPRLMRERDVEIALEREGESGRRIRVSV |
| Ga0207680_104153721 | 3300025903 | Switchgrass Rhizosphere | LIEWGEKFPRFERERDVEIALERVSEDERRIRITAP |
| Ga0207652_114695691 | 3300025921 | Corn Rhizosphere | LLLIEWGEKFPQFQRERDVEIAIERIGESDRKFRLVEI |
| Ga0207664_109156432 | 3300025929 | Agricultural Soil | SENSVLLIEWGEKFPRLEWDVEIDLERTGESGRRIRISG |
| Ga0207679_110901973 | 3300025945 | Corn Rhizosphere | ENAILLIEWGEKFPWLAMERDVEIAFERNGETDRTIRVSA |
| Ga0207667_121065162 | 3300025949 | Corn Rhizosphere | ILLIEWGEKFARFVRERDLEIALERVRESERRVTVW |
| Ga0208773_10240122 | 3300026034 | Rice Paddy Soil | IEWGEKFPRYANGRDVEITIERLGEEDRRIRIFDF |
| Ga0207703_118984192 | 3300026035 | Switchgrass Rhizosphere | LLIEWGEKFPRFVRERDVEIRLERVGEMERRVLVKVELIS |
| Ga0209055_10361361 | 3300026309 | Soil | LIEWGEKFPRLLRERDVEISFERQGETARRIRIVGLP |
| Ga0257173_10228923 | 3300026360 | Soil | LLIEWGEKFPRFVRERNVEIVLERVDENERRIQVTGL |
| Ga0208199_10129263 | 3300027497 | Peatlands Soil | SVLLIEWGEKFARFERERNVEIALERINENERRVRITC |
| Ga0209733_11208452 | 3300027591 | Forest Soil | DNSILLIEWGEKFPRLRNERDLEIGLERINQSERRIQLKD |
| Ga0209180_107885512 | 3300027846 | Vadose Zone Soil | VLLIEWGEKFARFERERDVEIALERISESERRIRVTE |
| Ga0209166_103727791 | 3300027857 | Surface Soil | NAVLLIEWGEKFSRFVRERDVEIAITRLGENARKFEVL |
| Ga0209167_100775463 | 3300027867 | Surface Soil | VLLIEWGEKFARFERERDVEISLKREGESGRRIRIIGNDSAL |
| Ga0209698_101582673 | 3300027911 | Watersheds | DSILLIEWGEKFPRLLRERDVEIVLEREGENRRGIRVSR |
| Ga0209168_100182481 | 3300027986 | Surface Soil | DDLKDSKNILLIEWGEKFPNLVREKDLEIALERKSETERLIRVHV |
| Ga0265338_112261632 | 3300028800 | Rhizosphere | LIEWGEKFPRLQRERDVEIALEREGESVRRIRISS |
| Ga0307312_111753881 | 3300028828 | Soil | LIEWGEKFARFERDRDVEISLERLGENDRKIQVVGR |
| Ga0311369_108569931 | 3300029910 | Palsa | ILLIEWGEKFPRLHWDVEIALERVGENERRIKVRG |
| Ga0311370_115978341 | 3300030503 | Palsa | LIEWGEKFPRFLRERDVEISLERDEESGRRIRIIG |
| Ga0302183_103649731 | 3300030509 | Palsa | DLRAEPKSILLIEWGEKFPRFLRERDVEISLERDEESGRRIRIIG |
| Ga0311354_110644052 | 3300030618 | Palsa | DSVLLIEWGEKFPQLLDERDAEISLERVDEDTRKIKITMRDDGAK |
| Ga0302316_104342941 | 3300030646 | Palsa | SSGILLVEWGEKFPYLQRERDVEISFERESETRRRIKLTD |
| Ga0170824_1011647081 | 3300031231 | Forest Soil | SDNSILLIEWGEKFPRLQRECQVEISLERQSETERKIRIRRP |
| Ga0170824_1273024041 | 3300031231 | Forest Soil | SVLLIEWGEKFPQLKQEQDAQITLERVGEDGRRIKLTTS |
| Ga0265328_100615573 | 3300031239 | Rhizosphere | LLIEWGEKFPRLVRERDVEIALERESETKRRIRISS |
| Ga0170820_169825261 | 3300031446 | Forest Soil | SILLIEWGEKFPRLRWDVEIALEREGEHGRRIKVRG |
| Ga0170820_175601831 | 3300031446 | Forest Soil | LLIEWGEKFARFVKGRDVEIGLERVGENERRIMVNAEVK |
| Ga0307477_100146376 | 3300031753 | Hardwood Forest Soil | IEWGEKFPRLQREQTLEIALERVAETERRIVLTATDSGSRS |
| Ga0307478_100911891 | 3300031823 | Hardwood Forest Soil | VLLIEWGEKFTRFTKERDIEISLDRIGENERIIQVSA |
| Ga0308175_1017327183 | 3300031938 | Soil | LRSENSILLIEWGEKFPSLTAERDVEIFFERTGETERTIRVSA |
| Ga0307471_1035597142 | 3300032180 | Hardwood Forest Soil | LLIEWGEKFPHLRRDRDVEIALERVGEEGRRIRLTTG |
| Ga0306920_1002915891 | 3300032261 | Soil | LIEWGEKFPRFVRERDVEISLEREGDSGRRIRINS |
| Ga0314863_036927_2_109 | 3300033804 | Peatland | LIEWGEKFPSLRRDRDVEIVIERLAECERRIRVSP |
| Ga0370515_0159234_839_967 | 3300034163 | Untreated Peat Soil | AEINSILLIEWGEKFPRFVRERDVEISLKREGESARKVRISL |
| ⦗Top⦘ |