NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077651

Metagenome / Metatranscriptome Family F077651

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077651
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 36 residues
Representative Sequence MKWLMWALVAVAIALGLALLAGKSDLRRFQRMRRM
Number of Associated Samples 74
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 88.03 %
% of genes near scaffold ends (potentially truncated) 13.68 %
% of genes from short scaffolds (< 2000 bps) 88.03 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.812 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(29.915 % of family members)
Environment Ontology (ENVO) Unclassified
(47.009 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.120 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 52.38%    β-sheet: 0.00%    Coil/Unstructured: 47.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF01513NAD_kinase 17.09
PF00196GerE 16.24
PF01183Glyco_hydro_25 7.69
PF08450SGL 1.71
PF07883Cupin_2 0.85
PF04199Cyclase 0.85
PF12679ABC2_membrane_2 0.85
PF13560HTH_31 0.85
PF13411MerR_1 0.85
PF01636APH 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG3757Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 familyCell wall/membrane/envelope biogenesis [M] 7.69
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.71
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.71
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.81 %
UnclassifiedrootN/A34.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_115667819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1527Open in IMG/M
3300005434|Ga0070709_11562954Not Available537Open in IMG/M
3300005533|Ga0070734_10434966Not Available748Open in IMG/M
3300005713|Ga0066905_100027348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3170Open in IMG/M
3300005764|Ga0066903_100045944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5238Open in IMG/M
3300005764|Ga0066903_100275327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2631Open in IMG/M
3300005764|Ga0066903_100703723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1782Open in IMG/M
3300005764|Ga0066903_100859174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1634Open in IMG/M
3300005764|Ga0066903_101128187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → Actinophytocola oryzae1448Open in IMG/M
3300005764|Ga0066903_102104970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1086Open in IMG/M
3300005764|Ga0066903_102914809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales928Open in IMG/M
3300005764|Ga0066903_106173721Not Available626Open in IMG/M
3300005764|Ga0066903_107727065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300006028|Ga0070717_10088935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium → Cryptosporangium arvum2604Open in IMG/M
3300006173|Ga0070716_101250842Not Available598Open in IMG/M
3300006175|Ga0070712_101002767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia723Open in IMG/M
3300006755|Ga0079222_10088263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1589Open in IMG/M
3300006804|Ga0079221_10850959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia662Open in IMG/M
3300006854|Ga0075425_100187571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2376Open in IMG/M
3300006854|Ga0075425_100690942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1172Open in IMG/M
3300009090|Ga0099827_10411860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1156Open in IMG/M
3300010043|Ga0126380_10304785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1135Open in IMG/M
3300010048|Ga0126373_10344876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → Actinophytocola oryzae1499Open in IMG/M
3300010048|Ga0126373_10787483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1012Open in IMG/M
3300010048|Ga0126373_11022179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia892Open in IMG/M
3300010048|Ga0126373_12080467Not Available630Open in IMG/M
3300010152|Ga0126318_10148056Not Available738Open in IMG/M
3300010154|Ga0127503_11203792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1120Open in IMG/M
3300010358|Ga0126370_10014612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4341Open in IMG/M
3300010358|Ga0126370_10843365Not Available822Open in IMG/M
3300010358|Ga0126370_11610101Not Available622Open in IMG/M
3300010360|Ga0126372_10591968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1062Open in IMG/M
3300010360|Ga0126372_11585840Not Available693Open in IMG/M
3300010360|Ga0126372_12155325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300010361|Ga0126378_10554598Not Available1264Open in IMG/M
3300010361|Ga0126378_11016758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium932Open in IMG/M
3300010361|Ga0126378_11042234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300010361|Ga0126378_11377017Not Available798Open in IMG/M
3300010366|Ga0126379_11233137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia854Open in IMG/M
3300010366|Ga0126379_13411260Not Available532Open in IMG/M
3300010376|Ga0126381_100094388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3803Open in IMG/M
3300010376|Ga0126381_101632628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia931Open in IMG/M
3300010376|Ga0126381_102243160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Allokutzneria785Open in IMG/M
3300010376|Ga0126381_103691135Not Available599Open in IMG/M
3300010379|Ga0136449_101442552Not Available1059Open in IMG/M
3300010398|Ga0126383_11088396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium889Open in IMG/M
3300010398|Ga0126383_12609604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300010937|Ga0137776_1382459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3749Open in IMG/M
3300012096|Ga0137389_11073140Not Available690Open in IMG/M
3300012199|Ga0137383_10798209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium689Open in IMG/M
3300012207|Ga0137381_10867433Not Available781Open in IMG/M
3300012210|Ga0137378_10634566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia979Open in IMG/M
3300012210|Ga0137378_11740316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales529Open in IMG/M
3300012211|Ga0137377_10644039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia995Open in IMG/M
3300012363|Ga0137390_11935284Not Available517Open in IMG/M
3300012683|Ga0137398_10319283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1047Open in IMG/M
3300012924|Ga0137413_11453604Not Available555Open in IMG/M
3300012971|Ga0126369_10228158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1817Open in IMG/M
3300012971|Ga0126369_11687402Not Available723Open in IMG/M
3300016422|Ga0182039_10857754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia809Open in IMG/M
3300016445|Ga0182038_11108526Not Available704Open in IMG/M
3300016445|Ga0182038_12162886Not Available505Open in IMG/M
3300020199|Ga0179592_10131677Not Available1147Open in IMG/M
3300021407|Ga0210383_11675548Not Available521Open in IMG/M
3300021475|Ga0210392_11094655Not Available597Open in IMG/M
3300021478|Ga0210402_10990691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia767Open in IMG/M
3300021560|Ga0126371_10253077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1876Open in IMG/M
3300021560|Ga0126371_10291120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1757Open in IMG/M
3300021560|Ga0126371_10394302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1525Open in IMG/M
3300021560|Ga0126371_11331818Not Available851Open in IMG/M
3300021560|Ga0126371_11458186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia814Open in IMG/M
3300021560|Ga0126371_11630460Not Available770Open in IMG/M
3300021560|Ga0126371_12280987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia654Open in IMG/M
3300021560|Ga0126371_12440695Not Available632Open in IMG/M
3300021560|Ga0126371_12516523Not Available623Open in IMG/M
3300021560|Ga0126371_13068987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300022513|Ga0242667_1020156Not Available693Open in IMG/M
3300025898|Ga0207692_10947907Not Available567Open in IMG/M
3300025910|Ga0207684_11112120Not Available657Open in IMG/M
3300025922|Ga0207646_10060758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → Actinophytocola oryzae3374Open in IMG/M
3300026498|Ga0257156_1050813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia853Open in IMG/M
3300027725|Ga0209178_1047884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1367Open in IMG/M
3300027826|Ga0209060_10419047Not Available609Open in IMG/M
3300027889|Ga0209380_10721417All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300027908|Ga0209006_10789840Not Available770Open in IMG/M
3300031231|Ga0170824_122365499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300031543|Ga0318516_10001534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8961Open in IMG/M
3300031543|Ga0318516_10008759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4801Open in IMG/M
3300031543|Ga0318516_10205627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Herbidospora → Herbidospora galbida1137Open in IMG/M
3300031543|Ga0318516_10255068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300031544|Ga0318534_10075291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1914Open in IMG/M
3300031544|Ga0318534_10644792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia600Open in IMG/M
3300031545|Ga0318541_10298729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia897Open in IMG/M
3300031546|Ga0318538_10271295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia912Open in IMG/M
3300031549|Ga0318571_10339552Not Available574Open in IMG/M
3300031573|Ga0310915_10163666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1544Open in IMG/M
3300031668|Ga0318542_10196806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1016Open in IMG/M
3300031681|Ga0318572_10078684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1828Open in IMG/M
3300031713|Ga0318496_10009705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4492Open in IMG/M
3300031713|Ga0318496_10529164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300031736|Ga0318501_10294767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia865Open in IMG/M
3300031771|Ga0318546_10459460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium892Open in IMG/M
3300031782|Ga0318552_10529017Not Available602Open in IMG/M
3300031794|Ga0318503_10109935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia878Open in IMG/M
3300031795|Ga0318557_10369179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia659Open in IMG/M
3300031910|Ga0306923_12471581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae513Open in IMG/M
3300031947|Ga0310909_10751196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300031962|Ga0307479_11505003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300032009|Ga0318563_10319156Not Available841Open in IMG/M
3300032051|Ga0318532_10157248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia807Open in IMG/M
3300032160|Ga0311301_12058970Not Available663Open in IMG/M
3300032180|Ga0307471_100040419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3729Open in IMG/M
3300032205|Ga0307472_100860973Not Available835Open in IMG/M
3300032205|Ga0307472_101954159Not Available586Open in IMG/M
3300032261|Ga0306920_102987333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia639Open in IMG/M
3300032261|Ga0306920_103556345Not Available575Open in IMG/M
3300032805|Ga0335078_10021966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9496Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil29.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.08%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil8.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.13%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.56%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.71%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.71%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022513Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11566781923300000956SoilMKWLMWALVAVAIALGLALLAGKSDLRRFQRMRRM*
Ga0070709_1156295423300005434Corn, Switchgrass And Miscanthus RhizosphereMKLLRWALVAVVVALGLALLAGKSDLRRFLRMRRMEEVGA
Ga0070734_1043496623300005533Surface SoilMKLLRWALVALIVALGLALLAGKSDIRRYQRMRRM*
Ga0066905_10002734823300005713Tropical Forest SoilMKWLMWVLAAVAIAIGLALLAGKSDLRRFQRMRRM*
Ga0066903_10004594423300005764Tropical Forest SoilMKWLMWALLAVAIAIGLALLAGKSDLRRFQRMRRM*
Ga0066903_10027532733300005764Tropical Forest SoilMKWLMWALAVVAIAIGLALLAGKGDLRRFQRMRRM*
Ga0066903_10070372323300005764Tropical Forest SoilMKLLRWALVAVIVALGLALLVGQSDLRRFQRMRSM*
Ga0066903_10085917433300005764Tropical Forest SoilMKWLMWALLAVVIAIALVLLAGKSDLRRFQRMRRM*
Ga0066903_10112818723300005764Tropical Forest SoilMKLLRWALIAVVIALALVLLAGQGDLRRFQRMRRM*
Ga0066903_10210497013300005764Tropical Forest SoilMKWLMWALLAVAIAIGLFLLAGKSDLRRFQRMRRM*
Ga0066903_10291480923300005764Tropical Forest SoilMKWLMWALVAVAIAIGLALLVGQGDLRRFQRMRRM*
Ga0066903_10617372123300005764Tropical Forest SoilMKLLTWVLVAVVIALGLALLAGQSDLRRFQRMRRM*
Ga0066903_10772706513300005764Tropical Forest SoilMKWLMWALVAVAIAIGLALLAGQGDLRRFQRMRRM*
Ga0070717_1008893533300006028Corn, Switchgrass And Miscanthus RhizosphereMKLLRWTLVAVAVVLGLALLAGQGDIRRYRRMRRM*
Ga0070716_10125084213300006173Corn, Switchgrass And Miscanthus RhizosphereMKLLRWALVVVTVALGLALLAGRSDLRRYQRMRRM*
Ga0070712_10100276723300006175Corn, Switchgrass And Miscanthus RhizosphereDRQGALMKWLMWALLAVAIAIGLILLAGQGDLRRFQRMRRM*
Ga0079222_1008826333300006755Agricultural SoilMKWLMWALLAVAIAIALVLLAGKSDLRRFQRMRRM*
Ga0079221_1085095913300006804Agricultural SoilMKWLMWALLAVAIAIGLILLAGQGDLRRFQRMRRM*
Ga0075425_10018757123300006854Populus RhizosphereMKWLMWALLAVAIAIGLALLAGQNDLRRFQRMRRM*
Ga0075425_10069094233300006854Populus RhizosphereMKLLRWALVAVLVALGLALLAGQSDLRRFQRMRRM*
Ga0099827_1041186033300009090Vadose Zone SoilMKWLGWALAALAIAIGVALLAGKSDLRRYRRMRRM*
Ga0126380_1030478523300010043Tropical Forest SoilMKWLMWALLAVAIAIGLILLAGKGDLRRYQRMRRM*
Ga0126373_1034487633300010048Tropical Forest SoilMKWLMWALVAVIIAIGLVLLAGKSDLSRFQRMRRM*
Ga0126373_1078748323300010048Tropical Forest SoilMKWLMWALLAVAIAIGLALLAGQSDLRRFQRMRRM*
Ga0126373_1102217923300010048Tropical Forest SoilMKWLMWALLAVAIAIGLVLLAGKSDLRRFQRMRRM*
Ga0126373_1208046713300010048Tropical Forest SoilMKPLRWALVAVVIALGLALLAGQKDLRRFQRMRRL*
Ga0126318_1014805613300010152SoilMKLLRWALVAVVIALALALLAGQSDIRRFQRMRRM*
Ga0127503_1120379213300010154SoilSGANRQGARMKWLMWALLAVAIAIGLALLAGKSDIRRYQRMRRM*
Ga0126370_1001461213300010358Tropical Forest SoilMKWLMWALAVVAIAIGLTLLAGKGDLRRFQRMRRM*
Ga0126370_1084336533300010358Tropical Forest SoilMKLLRWALVAVIVALGLALLAGQSDLRRFQRMRRM*
Ga0126370_1161010113300010358Tropical Forest SoilMKLLRWTLVAVIVALGLAFLAGQSDLRRFQRMRRKSRRAET
Ga0126372_1059196813300010360Tropical Forest SoilMKWLLWVLVAVAIAIGLALLAGQGDLRRFQRMRRM*
Ga0126372_1158584023300010360Tropical Forest SoilMKPLRWALVAVVIALGLALLAGQKDLRRFQRMRRM*
Ga0126372_1215532523300010360Tropical Forest SoilMKWLMWALAAVVIAIGLALLAGKNDLRRFQRMRRM*
Ga0126378_1055459813300010361Tropical Forest SoilMKWLGWVLVVLVIAIGSALLAGNGDLRRFQRMRRM*
Ga0126378_1101675823300010361Tropical Forest SoilMKWLMWALVAVAIALALALLAGKGDLRRFQRMRRM*
Ga0126378_1104223413300010361Tropical Forest SoilMKLLRWALIATIVVLGLALLAGQGDLRRFQRMRRM*
Ga0126378_1137701713300010361Tropical Forest SoilMKLLIWVLVALIVALGLALLAGQSDLRRFQRMRRM*
Ga0126379_1123313733300010366Tropical Forest SoilMKWLMWALVAVIIAIGLVLLAGKGDLSRFQRMRRM*
Ga0126379_1341126013300010366Tropical Forest SoilMEHGMKWLMWALVAVAIAIGLALLAGQGDLRRFQRMRRM*
Ga0126381_10009438823300010376Tropical Forest SoilMKWLMWALLAVAIAIGLVLLAGKSDLRRYQRMRRM*
Ga0126381_10163262823300010376Tropical Forest SoilMKGLMWALLAVAIAIGLILLAGKVDLRRYQRMRRM*
Ga0126381_10224316013300010376Tropical Forest SoilMKLLRWTLIAVIVALGLALLAGKSDIRRYQRMRRM*
Ga0126381_10369113523300010376Tropical Forest SoilMKWLMWALLAVAIALGLVLLAGKSDLRRYQRMRRM*
Ga0136449_10144255233300010379Peatlands SoilMKLLRWALVAVVVALGLALLAGQSDLRRFQRMHRM*
Ga0126383_1108839623300010398Tropical Forest SoilMKWLMWALAVVAIAIGLALLAGKGDLRRFQRMRRI*
Ga0126383_1260960423300010398Tropical Forest SoilMKWLMWALLAVVIAIGLILLAGKGDLRRFQRMRRM*
Ga0137776_138245933300010937SedimentMKLLTWALIVLIVALGLALLAGKSDIRRYQRMRKM*
Ga0137389_1107314013300012096Vadose Zone SoilMKLLRWALVAVIVGLGLALLAGQSDIRRYQRMRRM*
Ga0137383_1079820913300012199Vadose Zone SoilMKLVRWALVAVAIIVVVALLAGKSDLRRFLRMRRM*
Ga0137381_1086743313300012207Vadose Zone SoilMKLVRWALVAVAIIVLVALLAGKSDLRRFRRMRRM*
Ga0137378_1063456613300012210Vadose Zone SoilMKLLRWTLVAVIVALGLALLAGQSDIRRYQRMRRM*
Ga0137378_1174031623300012210Vadose Zone SoilMKLLRWTLVAVLVALGLALLAGKSDIRRYQRMRRM*
Ga0137377_1064403913300012211Vadose Zone SoilMKWLMWALLAVAIAIGLALLAGKSDLRRYQRMRRM*
Ga0137390_1193528413300012363Vadose Zone SoilMKLLRWTLVAVLVALGIALLAGKSDIRRYQRMRRM*
Ga0137398_1031928323300012683Vadose Zone SoilMKLLRWALVAVIVGLGLALLAGKSDIRRYQRMRKM*
Ga0137413_1145360423300012924Vadose Zone SoilMKLLRWALVAVIVALGLALLAGKSDIRRYQRMRKM*
Ga0126369_1022815823300012971Tropical Forest SoilMKWLMWALLAVVIAIGLALLAGKSDLRRFQRMRRM*
Ga0126369_1168740213300012971Tropical Forest SoilMKWLMWALVALAIAIGLALLAGQGDLRRFQRMRRM*
Ga0182039_1085775423300016422SoilMKWLIWALLAVAIAIGLALLAGKSDFRHFQRMRRM
Ga0182038_1110852613300016445SoilMKLLRWALVAVIEGLGLALLAGKSDIRRYQRMRRM
Ga0182038_1216288613300016445SoilMKWLMWALLAVAIAIGLALLAGKSDFRRFQRMRRM
Ga0179592_1013167713300020199Vadose Zone SoilMKLLRWALVAVIVALGLALLAGKSDIRRYQRMRRM
Ga0210383_1167554813300021407SoilMKVLRWALVAVVIALGLALIAGKDDLRRYQRMRRM
Ga0210392_1109465513300021475SoilMKLLRWVLVAVIVVLGLALLAGKSDLRRYQRMRRM
Ga0210402_1099069123300021478SoilAPMKWLMWALLAVTIAIGLALLAGKSDFRRFQRMRRM
Ga0126371_1025307733300021560Tropical Forest SoilMKWLMWALLAVVIAIALVLLAGKSDLRRFQRMRRM
Ga0126371_1029112023300021560Tropical Forest SoilMKLLRWALVAVIVALGLALLVGQSDLRRFQRMRSM
Ga0126371_1039430223300021560Tropical Forest SoilMKWLMWALAVVAIAIGLALLAGKGDLRRFQRMRRM
Ga0126371_1133181833300021560Tropical Forest SoilMKWLMWILAAIVIAIGLVLLAGKGDLQRFQRMRRM
Ga0126371_1145818623300021560Tropical Forest SoilMKWLMWALLAVAIAIGLVLLAGKSDLRRFQRMRRM
Ga0126371_1163046023300021560Tropical Forest SoilMKWLIWALVAVAVAIALGLALLAGKSDLQRFQRMRRM
Ga0126371_1228098713300021560Tropical Forest SoilMKWLMWALLAVAIVIGLILLAGKGDLRRYQRMRRM
Ga0126371_1244069513300021560Tropical Forest SoilMKWLMWALLAVAIALGLVLLAGKSDLRRYQRMRRM
Ga0126371_1251652313300021560Tropical Forest SoilMKWLMWALLAVAIAIGLAVLAGQSDLRRFQRMRRM
Ga0126371_1306898713300021560Tropical Forest SoilMKWLMWALLAVAIAIGLVLLAGKGDLRRFQRMRRM
Ga0242667_102015613300022513SoilMKPLGWTLVAVVIALGLALLTSQDDIRRYQRMRRM
Ga0207692_1094790723300025898Corn, Switchgrass And Miscanthus RhizosphereMKLMRWVLVALVVALGLALLAGQSDIRRYQRMRRM
Ga0207684_1111212023300025910Corn, Switchgrass And Miscanthus RhizosphereMKLLRWALVAVAVVLGLALLAGQSDIRRYRRMRRM
Ga0207646_1006075833300025922Corn, Switchgrass And Miscanthus RhizosphereMKLLGWTLVAVAVVLGLALLAGQGDIRRYRRMRRM
Ga0257156_105081313300026498SoilMKWLMWALLAVAIAIGLALLAGKSDLRRYQRMRRM
Ga0209178_104788423300027725Agricultural SoilMKWLMWALLAVAIAIALVLLAGKSDLRRFQRMRRM
Ga0209060_1041904713300027826Surface SoilMKLLRWALVALIVALGLALLAGKSDIRRYQRMRRM
Ga0209380_1072141723300027889SoilPRGSRMKLLRWALVAVIVGLGLALLAGRSDIRRYQRMRRM
Ga0209006_1078984023300027908Forest SoilMKLLRWALVAVVVGLGLALLAGKNDIRRYQRMRRM
Ga0170824_12236549913300031231Forest SoilRQGARMKWLMWALLAVAIAIGLALLAGKSDIRRYQRMRRM
Ga0318516_10001534113300031543SoilMKLLRWALVAVIIALGLAFLAGQSDLRRFQRMRRM
Ga0318516_1000875933300031543SoilMKWLMWALVAVAIALGLALLAGKSDLQRFQRMRRM
Ga0318516_1020562733300031543SoilMKLLRWALIAVVIALALVLLAGQGDLRRFQRMRRM
Ga0318516_1025506823300031543SoilMKWLIWALLAVAIAIGLALLAGKSDFRRFQRMRRM
Ga0318534_1007529123300031544SoilMKWLMWALLAVVIAIGLALLAGKSDFRRFQRMRRM
Ga0318534_1064479223300031544SoilMKLLIWVLAAILIAVGLALLAGKGDLQRFQRMRRM
Ga0318541_1029872913300031545SoilMKWLMWALVAVAIAIGLALLAGQSDLRRFQRMRRM
Ga0318538_1027129513300031546SoilMKWLIWALLAVAIAVGLALLAGKSDFRRFQRMRRM
Ga0318571_1033955213300031549SoilMKWLMWALLAVAIAIGLALLAGQSDLRRFQRMRRM
Ga0310915_1016366623300031573SoilMKWLGWVLVVLVIAIGIALLAGNGDLRRFQRMRRM
Ga0318542_1019680623300031668SoilMKWLMWALVAVVIAIGLALLAGKGDLQRFQRMRRM
Ga0318572_1007868413300031681SoilRGSRMKLLRWALVAVIIALGLAFLAGQSDLRRFQRMRRM
Ga0318496_1000970523300031713SoilMKLLRWALIAVVIALALVLLAGQGGLRRFQRMRRM
Ga0318496_1052916413300031713SoilRQGAWMKWLMWALVAVAIAIGLALLAGQGDIRRYQRMRRM
Ga0318501_1029476723300031736SoilMKLLRWALVALVIALGLALLAGKSDIRRYQRMRRM
Ga0318546_1045946023300031771SoilMKWLMWALLAVAVAIGLILLAGQSDLRRFQRMRRM
Ga0318552_1052901723300031782SoilRRRGSSMKLLRWALVALVIALGLALLAGKSDIRRYQRMRRM
Ga0318503_1010993513300031794SoilGSRMKLLRWALIAVVIALALVLLAGQGDLRRFQRMRRM
Ga0318557_1036917913300031795SoilRGHGMKWLMWALVAVAIAIGLALLAGQSDLRRFQRMRRM
Ga0306923_1247158123300031910SoilMKWLMWALLAVAIAIGLVLLAGKSDLQRFQRMRRM
Ga0310909_1075119623300031947SoilMKLLRWALVAVIIALGLALLAGQSDLRRFQRMRRM
Ga0307479_1150500313300031962Hardwood Forest SoilMKWLMWALVAVAIAIGLALLAGKADLQRFQRMRRM
Ga0318563_1031915623300032009SoilMKLLRWMLIAVVIALGLALLAGQSDLRRFQRMRRM
Ga0318532_1015724823300032051SoilATDRGHGMRWLMWALVAVAIAIGLALLAGQSDLRRFQRMRRM
Ga0311301_1205897023300032160Peatlands SoilMKLLRWALVAVVVALGLALLAGQSDLRRFQRMHRM
Ga0307471_10004041923300032180Hardwood Forest SoilMKWLMWVLVTIAIAIGLALFAGKNDIRRYQRMRRM
Ga0307472_10086097323300032205Hardwood Forest SoilMKWLMWALVAVAIAIGLGLLAGQGDLRRFQRMRRM
Ga0307472_10195415913300032205Hardwood Forest SoilMKLLRWALVVVIVALGLALLAGRSDLRRYQRMRRM
Ga0306920_10298733323300032261SoilMKWLMWALVTVAIAIGLALLAGQGDIRRYQRMRRM
Ga0306920_10355634513300032261SoilMKLLRWALVAVIVGLGLALLAGKSDIRRYQRMRRM
Ga0335078_1002196633300032805SoilMKWLIWALLAVALAVGVALLAGKGDIRRFQRMKRM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.