| Basic Information | |
|---|---|
| Family ID | F077651 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MKWLMWALVAVAIALGLALLAGKSDLRRFQRMRRM |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.03 % |
| % of genes near scaffold ends (potentially truncated) | 13.68 % |
| % of genes from short scaffolds (< 2000 bps) | 88.03 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.812 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (29.915 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.009 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.120 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01513 | NAD_kinase | 17.09 |
| PF00196 | GerE | 16.24 |
| PF01183 | Glyco_hydro_25 | 7.69 |
| PF08450 | SGL | 1.71 |
| PF07883 | Cupin_2 | 0.85 |
| PF04199 | Cyclase | 0.85 |
| PF12679 | ABC2_membrane_2 | 0.85 |
| PF13560 | HTH_31 | 0.85 |
| PF13411 | MerR_1 | 0.85 |
| PF01636 | APH | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 7.69 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.71 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.71 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.81 % |
| Unclassified | root | N/A | 34.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_115667819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1527 | Open in IMG/M |
| 3300005434|Ga0070709_11562954 | Not Available | 537 | Open in IMG/M |
| 3300005533|Ga0070734_10434966 | Not Available | 748 | Open in IMG/M |
| 3300005713|Ga0066905_100027348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3170 | Open in IMG/M |
| 3300005764|Ga0066903_100045944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5238 | Open in IMG/M |
| 3300005764|Ga0066903_100275327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2631 | Open in IMG/M |
| 3300005764|Ga0066903_100703723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1782 | Open in IMG/M |
| 3300005764|Ga0066903_100859174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1634 | Open in IMG/M |
| 3300005764|Ga0066903_101128187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → Actinophytocola oryzae | 1448 | Open in IMG/M |
| 3300005764|Ga0066903_102104970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1086 | Open in IMG/M |
| 3300005764|Ga0066903_102914809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 928 | Open in IMG/M |
| 3300005764|Ga0066903_106173721 | Not Available | 626 | Open in IMG/M |
| 3300005764|Ga0066903_107727065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300006028|Ga0070717_10088935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium → Cryptosporangium arvum | 2604 | Open in IMG/M |
| 3300006173|Ga0070716_101250842 | Not Available | 598 | Open in IMG/M |
| 3300006175|Ga0070712_101002767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
| 3300006755|Ga0079222_10088263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1589 | Open in IMG/M |
| 3300006804|Ga0079221_10850959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
| 3300006854|Ga0075425_100187571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2376 | Open in IMG/M |
| 3300006854|Ga0075425_100690942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1172 | Open in IMG/M |
| 3300009090|Ga0099827_10411860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1156 | Open in IMG/M |
| 3300010043|Ga0126380_10304785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1135 | Open in IMG/M |
| 3300010048|Ga0126373_10344876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → Actinophytocola oryzae | 1499 | Open in IMG/M |
| 3300010048|Ga0126373_10787483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
| 3300010048|Ga0126373_11022179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
| 3300010048|Ga0126373_12080467 | Not Available | 630 | Open in IMG/M |
| 3300010152|Ga0126318_10148056 | Not Available | 738 | Open in IMG/M |
| 3300010154|Ga0127503_11203792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1120 | Open in IMG/M |
| 3300010358|Ga0126370_10014612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4341 | Open in IMG/M |
| 3300010358|Ga0126370_10843365 | Not Available | 822 | Open in IMG/M |
| 3300010358|Ga0126370_11610101 | Not Available | 622 | Open in IMG/M |
| 3300010360|Ga0126372_10591968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1062 | Open in IMG/M |
| 3300010360|Ga0126372_11585840 | Not Available | 693 | Open in IMG/M |
| 3300010360|Ga0126372_12155325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300010361|Ga0126378_10554598 | Not Available | 1264 | Open in IMG/M |
| 3300010361|Ga0126378_11016758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
| 3300010361|Ga0126378_11042234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 921 | Open in IMG/M |
| 3300010361|Ga0126378_11377017 | Not Available | 798 | Open in IMG/M |
| 3300010366|Ga0126379_11233137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 854 | Open in IMG/M |
| 3300010366|Ga0126379_13411260 | Not Available | 532 | Open in IMG/M |
| 3300010376|Ga0126381_100094388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3803 | Open in IMG/M |
| 3300010376|Ga0126381_101632628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 931 | Open in IMG/M |
| 3300010376|Ga0126381_102243160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Allokutzneria | 785 | Open in IMG/M |
| 3300010376|Ga0126381_103691135 | Not Available | 599 | Open in IMG/M |
| 3300010379|Ga0136449_101442552 | Not Available | 1059 | Open in IMG/M |
| 3300010398|Ga0126383_11088396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 889 | Open in IMG/M |
| 3300010398|Ga0126383_12609604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300010937|Ga0137776_1382459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3749 | Open in IMG/M |
| 3300012096|Ga0137389_11073140 | Not Available | 690 | Open in IMG/M |
| 3300012199|Ga0137383_10798209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300012207|Ga0137381_10867433 | Not Available | 781 | Open in IMG/M |
| 3300012210|Ga0137378_10634566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 979 | Open in IMG/M |
| 3300012210|Ga0137378_11740316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 529 | Open in IMG/M |
| 3300012211|Ga0137377_10644039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 995 | Open in IMG/M |
| 3300012363|Ga0137390_11935284 | Not Available | 517 | Open in IMG/M |
| 3300012683|Ga0137398_10319283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1047 | Open in IMG/M |
| 3300012924|Ga0137413_11453604 | Not Available | 555 | Open in IMG/M |
| 3300012971|Ga0126369_10228158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1817 | Open in IMG/M |
| 3300012971|Ga0126369_11687402 | Not Available | 723 | Open in IMG/M |
| 3300016422|Ga0182039_10857754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
| 3300016445|Ga0182038_11108526 | Not Available | 704 | Open in IMG/M |
| 3300016445|Ga0182038_12162886 | Not Available | 505 | Open in IMG/M |
| 3300020199|Ga0179592_10131677 | Not Available | 1147 | Open in IMG/M |
| 3300021407|Ga0210383_11675548 | Not Available | 521 | Open in IMG/M |
| 3300021475|Ga0210392_11094655 | Not Available | 597 | Open in IMG/M |
| 3300021478|Ga0210402_10990691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300021560|Ga0126371_10253077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1876 | Open in IMG/M |
| 3300021560|Ga0126371_10291120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1757 | Open in IMG/M |
| 3300021560|Ga0126371_10394302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
| 3300021560|Ga0126371_11331818 | Not Available | 851 | Open in IMG/M |
| 3300021560|Ga0126371_11458186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 814 | Open in IMG/M |
| 3300021560|Ga0126371_11630460 | Not Available | 770 | Open in IMG/M |
| 3300021560|Ga0126371_12280987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300021560|Ga0126371_12440695 | Not Available | 632 | Open in IMG/M |
| 3300021560|Ga0126371_12516523 | Not Available | 623 | Open in IMG/M |
| 3300021560|Ga0126371_13068987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300022513|Ga0242667_1020156 | Not Available | 693 | Open in IMG/M |
| 3300025898|Ga0207692_10947907 | Not Available | 567 | Open in IMG/M |
| 3300025910|Ga0207684_11112120 | Not Available | 657 | Open in IMG/M |
| 3300025922|Ga0207646_10060758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola → Actinophytocola oryzae | 3374 | Open in IMG/M |
| 3300026498|Ga0257156_1050813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 853 | Open in IMG/M |
| 3300027725|Ga0209178_1047884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1367 | Open in IMG/M |
| 3300027826|Ga0209060_10419047 | Not Available | 609 | Open in IMG/M |
| 3300027889|Ga0209380_10721417 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027908|Ga0209006_10789840 | Not Available | 770 | Open in IMG/M |
| 3300031231|Ga0170824_122365499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300031543|Ga0318516_10001534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8961 | Open in IMG/M |
| 3300031543|Ga0318516_10008759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4801 | Open in IMG/M |
| 3300031543|Ga0318516_10205627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Herbidospora → Herbidospora galbida | 1137 | Open in IMG/M |
| 3300031543|Ga0318516_10255068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300031544|Ga0318534_10075291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1914 | Open in IMG/M |
| 3300031544|Ga0318534_10644792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300031545|Ga0318541_10298729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 897 | Open in IMG/M |
| 3300031546|Ga0318538_10271295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 912 | Open in IMG/M |
| 3300031549|Ga0318571_10339552 | Not Available | 574 | Open in IMG/M |
| 3300031573|Ga0310915_10163666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1544 | Open in IMG/M |
| 3300031668|Ga0318542_10196806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1016 | Open in IMG/M |
| 3300031681|Ga0318572_10078684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1828 | Open in IMG/M |
| 3300031713|Ga0318496_10009705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4492 | Open in IMG/M |
| 3300031713|Ga0318496_10529164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
| 3300031736|Ga0318501_10294767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 865 | Open in IMG/M |
| 3300031771|Ga0318546_10459460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 892 | Open in IMG/M |
| 3300031782|Ga0318552_10529017 | Not Available | 602 | Open in IMG/M |
| 3300031794|Ga0318503_10109935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 878 | Open in IMG/M |
| 3300031795|Ga0318557_10369179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300031910|Ga0306923_12471581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 513 | Open in IMG/M |
| 3300031947|Ga0310909_10751196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300031962|Ga0307479_11505003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300032009|Ga0318563_10319156 | Not Available | 841 | Open in IMG/M |
| 3300032051|Ga0318532_10157248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 807 | Open in IMG/M |
| 3300032160|Ga0311301_12058970 | Not Available | 663 | Open in IMG/M |
| 3300032180|Ga0307471_100040419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3729 | Open in IMG/M |
| 3300032205|Ga0307472_100860973 | Not Available | 835 | Open in IMG/M |
| 3300032205|Ga0307472_101954159 | Not Available | 586 | Open in IMG/M |
| 3300032261|Ga0306920_102987333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300032261|Ga0306920_103556345 | Not Available | 575 | Open in IMG/M |
| 3300032805|Ga0335078_10021966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9496 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 29.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.13% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.71% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1156678192 | 3300000956 | Soil | MKWLMWALVAVAIALGLALLAGKSDLRRFQRMRRM* |
| Ga0070709_115629542 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLRWALVAVVVALGLALLAGKSDLRRFLRMRRMEEVGA |
| Ga0070734_104349662 | 3300005533 | Surface Soil | MKLLRWALVALIVALGLALLAGKSDIRRYQRMRRM* |
| Ga0066905_1000273482 | 3300005713 | Tropical Forest Soil | MKWLMWVLAAVAIAIGLALLAGKSDLRRFQRMRRM* |
| Ga0066903_1000459442 | 3300005764 | Tropical Forest Soil | MKWLMWALLAVAIAIGLALLAGKSDLRRFQRMRRM* |
| Ga0066903_1002753273 | 3300005764 | Tropical Forest Soil | MKWLMWALAVVAIAIGLALLAGKGDLRRFQRMRRM* |
| Ga0066903_1007037232 | 3300005764 | Tropical Forest Soil | MKLLRWALVAVIVALGLALLVGQSDLRRFQRMRSM* |
| Ga0066903_1008591743 | 3300005764 | Tropical Forest Soil | MKWLMWALLAVVIAIALVLLAGKSDLRRFQRMRRM* |
| Ga0066903_1011281872 | 3300005764 | Tropical Forest Soil | MKLLRWALIAVVIALALVLLAGQGDLRRFQRMRRM* |
| Ga0066903_1021049701 | 3300005764 | Tropical Forest Soil | MKWLMWALLAVAIAIGLFLLAGKSDLRRFQRMRRM* |
| Ga0066903_1029148092 | 3300005764 | Tropical Forest Soil | MKWLMWALVAVAIAIGLALLVGQGDLRRFQRMRRM* |
| Ga0066903_1061737212 | 3300005764 | Tropical Forest Soil | MKLLTWVLVAVVIALGLALLAGQSDLRRFQRMRRM* |
| Ga0066903_1077270651 | 3300005764 | Tropical Forest Soil | MKWLMWALVAVAIAIGLALLAGQGDLRRFQRMRRM* |
| Ga0070717_100889353 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLRWTLVAVAVVLGLALLAGQGDIRRYRRMRRM* |
| Ga0070716_1012508421 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLRWALVVVTVALGLALLAGRSDLRRYQRMRRM* |
| Ga0070712_1010027672 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DRQGALMKWLMWALLAVAIAIGLILLAGQGDLRRFQRMRRM* |
| Ga0079222_100882633 | 3300006755 | Agricultural Soil | MKWLMWALLAVAIAIALVLLAGKSDLRRFQRMRRM* |
| Ga0079221_108509591 | 3300006804 | Agricultural Soil | MKWLMWALLAVAIAIGLILLAGQGDLRRFQRMRRM* |
| Ga0075425_1001875712 | 3300006854 | Populus Rhizosphere | MKWLMWALLAVAIAIGLALLAGQNDLRRFQRMRRM* |
| Ga0075425_1006909423 | 3300006854 | Populus Rhizosphere | MKLLRWALVAVLVALGLALLAGQSDLRRFQRMRRM* |
| Ga0099827_104118603 | 3300009090 | Vadose Zone Soil | MKWLGWALAALAIAIGVALLAGKSDLRRYRRMRRM* |
| Ga0126380_103047852 | 3300010043 | Tropical Forest Soil | MKWLMWALLAVAIAIGLILLAGKGDLRRYQRMRRM* |
| Ga0126373_103448763 | 3300010048 | Tropical Forest Soil | MKWLMWALVAVIIAIGLVLLAGKSDLSRFQRMRRM* |
| Ga0126373_107874832 | 3300010048 | Tropical Forest Soil | MKWLMWALLAVAIAIGLALLAGQSDLRRFQRMRRM* |
| Ga0126373_110221792 | 3300010048 | Tropical Forest Soil | MKWLMWALLAVAIAIGLVLLAGKSDLRRFQRMRRM* |
| Ga0126373_120804671 | 3300010048 | Tropical Forest Soil | MKPLRWALVAVVIALGLALLAGQKDLRRFQRMRRL* |
| Ga0126318_101480561 | 3300010152 | Soil | MKLLRWALVAVVIALALALLAGQSDIRRFQRMRRM* |
| Ga0127503_112037921 | 3300010154 | Soil | SGANRQGARMKWLMWALLAVAIAIGLALLAGKSDIRRYQRMRRM* |
| Ga0126370_100146121 | 3300010358 | Tropical Forest Soil | MKWLMWALAVVAIAIGLTLLAGKGDLRRFQRMRRM* |
| Ga0126370_108433653 | 3300010358 | Tropical Forest Soil | MKLLRWALVAVIVALGLALLAGQSDLRRFQRMRRM* |
| Ga0126370_116101011 | 3300010358 | Tropical Forest Soil | MKLLRWTLVAVIVALGLAFLAGQSDLRRFQRMRRKSRRAET |
| Ga0126372_105919681 | 3300010360 | Tropical Forest Soil | MKWLLWVLVAVAIAIGLALLAGQGDLRRFQRMRRM* |
| Ga0126372_115858402 | 3300010360 | Tropical Forest Soil | MKPLRWALVAVVIALGLALLAGQKDLRRFQRMRRM* |
| Ga0126372_121553252 | 3300010360 | Tropical Forest Soil | MKWLMWALAAVVIAIGLALLAGKNDLRRFQRMRRM* |
| Ga0126378_105545981 | 3300010361 | Tropical Forest Soil | MKWLGWVLVVLVIAIGSALLAGNGDLRRFQRMRRM* |
| Ga0126378_110167582 | 3300010361 | Tropical Forest Soil | MKWLMWALVAVAIALALALLAGKGDLRRFQRMRRM* |
| Ga0126378_110422341 | 3300010361 | Tropical Forest Soil | MKLLRWALIATIVVLGLALLAGQGDLRRFQRMRRM* |
| Ga0126378_113770171 | 3300010361 | Tropical Forest Soil | MKLLIWVLVALIVALGLALLAGQSDLRRFQRMRRM* |
| Ga0126379_112331373 | 3300010366 | Tropical Forest Soil | MKWLMWALVAVIIAIGLVLLAGKGDLSRFQRMRRM* |
| Ga0126379_134112601 | 3300010366 | Tropical Forest Soil | MEHGMKWLMWALVAVAIAIGLALLAGQGDLRRFQRMRRM* |
| Ga0126381_1000943882 | 3300010376 | Tropical Forest Soil | MKWLMWALLAVAIAIGLVLLAGKSDLRRYQRMRRM* |
| Ga0126381_1016326282 | 3300010376 | Tropical Forest Soil | MKGLMWALLAVAIAIGLILLAGKVDLRRYQRMRRM* |
| Ga0126381_1022431601 | 3300010376 | Tropical Forest Soil | MKLLRWTLIAVIVALGLALLAGKSDIRRYQRMRRM* |
| Ga0126381_1036911352 | 3300010376 | Tropical Forest Soil | MKWLMWALLAVAIALGLVLLAGKSDLRRYQRMRRM* |
| Ga0136449_1014425523 | 3300010379 | Peatlands Soil | MKLLRWALVAVVVALGLALLAGQSDLRRFQRMHRM* |
| Ga0126383_110883962 | 3300010398 | Tropical Forest Soil | MKWLMWALAVVAIAIGLALLAGKGDLRRFQRMRRI* |
| Ga0126383_126096042 | 3300010398 | Tropical Forest Soil | MKWLMWALLAVVIAIGLILLAGKGDLRRFQRMRRM* |
| Ga0137776_13824593 | 3300010937 | Sediment | MKLLTWALIVLIVALGLALLAGKSDIRRYQRMRKM* |
| Ga0137389_110731401 | 3300012096 | Vadose Zone Soil | MKLLRWALVAVIVGLGLALLAGQSDIRRYQRMRRM* |
| Ga0137383_107982091 | 3300012199 | Vadose Zone Soil | MKLVRWALVAVAIIVVVALLAGKSDLRRFLRMRRM* |
| Ga0137381_108674331 | 3300012207 | Vadose Zone Soil | MKLVRWALVAVAIIVLVALLAGKSDLRRFRRMRRM* |
| Ga0137378_106345661 | 3300012210 | Vadose Zone Soil | MKLLRWTLVAVIVALGLALLAGQSDIRRYQRMRRM* |
| Ga0137378_117403162 | 3300012210 | Vadose Zone Soil | MKLLRWTLVAVLVALGLALLAGKSDIRRYQRMRRM* |
| Ga0137377_106440391 | 3300012211 | Vadose Zone Soil | MKWLMWALLAVAIAIGLALLAGKSDLRRYQRMRRM* |
| Ga0137390_119352841 | 3300012363 | Vadose Zone Soil | MKLLRWTLVAVLVALGIALLAGKSDIRRYQRMRRM* |
| Ga0137398_103192832 | 3300012683 | Vadose Zone Soil | MKLLRWALVAVIVGLGLALLAGKSDIRRYQRMRKM* |
| Ga0137413_114536042 | 3300012924 | Vadose Zone Soil | MKLLRWALVAVIVALGLALLAGKSDIRRYQRMRKM* |
| Ga0126369_102281582 | 3300012971 | Tropical Forest Soil | MKWLMWALLAVVIAIGLALLAGKSDLRRFQRMRRM* |
| Ga0126369_116874021 | 3300012971 | Tropical Forest Soil | MKWLMWALVALAIAIGLALLAGQGDLRRFQRMRRM* |
| Ga0182039_108577542 | 3300016422 | Soil | MKWLIWALLAVAIAIGLALLAGKSDFRHFQRMRRM |
| Ga0182038_111085261 | 3300016445 | Soil | MKLLRWALVAVIEGLGLALLAGKSDIRRYQRMRRM |
| Ga0182038_121628861 | 3300016445 | Soil | MKWLMWALLAVAIAIGLALLAGKSDFRRFQRMRRM |
| Ga0179592_101316771 | 3300020199 | Vadose Zone Soil | MKLLRWALVAVIVALGLALLAGKSDIRRYQRMRRM |
| Ga0210383_116755481 | 3300021407 | Soil | MKVLRWALVAVVIALGLALIAGKDDLRRYQRMRRM |
| Ga0210392_110946551 | 3300021475 | Soil | MKLLRWVLVAVIVVLGLALLAGKSDLRRYQRMRRM |
| Ga0210402_109906912 | 3300021478 | Soil | APMKWLMWALLAVTIAIGLALLAGKSDFRRFQRMRRM |
| Ga0126371_102530773 | 3300021560 | Tropical Forest Soil | MKWLMWALLAVVIAIALVLLAGKSDLRRFQRMRRM |
| Ga0126371_102911202 | 3300021560 | Tropical Forest Soil | MKLLRWALVAVIVALGLALLVGQSDLRRFQRMRSM |
| Ga0126371_103943022 | 3300021560 | Tropical Forest Soil | MKWLMWALAVVAIAIGLALLAGKGDLRRFQRMRRM |
| Ga0126371_113318183 | 3300021560 | Tropical Forest Soil | MKWLMWILAAIVIAIGLVLLAGKGDLQRFQRMRRM |
| Ga0126371_114581862 | 3300021560 | Tropical Forest Soil | MKWLMWALLAVAIAIGLVLLAGKSDLRRFQRMRRM |
| Ga0126371_116304602 | 3300021560 | Tropical Forest Soil | MKWLIWALVAVAVAIALGLALLAGKSDLQRFQRMRRM |
| Ga0126371_122809871 | 3300021560 | Tropical Forest Soil | MKWLMWALLAVAIVIGLILLAGKGDLRRYQRMRRM |
| Ga0126371_124406951 | 3300021560 | Tropical Forest Soil | MKWLMWALLAVAIALGLVLLAGKSDLRRYQRMRRM |
| Ga0126371_125165231 | 3300021560 | Tropical Forest Soil | MKWLMWALLAVAIAIGLAVLAGQSDLRRFQRMRRM |
| Ga0126371_130689871 | 3300021560 | Tropical Forest Soil | MKWLMWALLAVAIAIGLVLLAGKGDLRRFQRMRRM |
| Ga0242667_10201561 | 3300022513 | Soil | MKPLGWTLVAVVIALGLALLTSQDDIRRYQRMRRM |
| Ga0207692_109479072 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLMRWVLVALVVALGLALLAGQSDIRRYQRMRRM |
| Ga0207684_111121202 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLRWALVAVAVVLGLALLAGQSDIRRYRRMRRM |
| Ga0207646_100607583 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGWTLVAVAVVLGLALLAGQGDIRRYRRMRRM |
| Ga0257156_10508131 | 3300026498 | Soil | MKWLMWALLAVAIAIGLALLAGKSDLRRYQRMRRM |
| Ga0209178_10478842 | 3300027725 | Agricultural Soil | MKWLMWALLAVAIAIALVLLAGKSDLRRFQRMRRM |
| Ga0209060_104190471 | 3300027826 | Surface Soil | MKLLRWALVALIVALGLALLAGKSDIRRYQRMRRM |
| Ga0209380_107214172 | 3300027889 | Soil | PRGSRMKLLRWALVAVIVGLGLALLAGRSDIRRYQRMRRM |
| Ga0209006_107898402 | 3300027908 | Forest Soil | MKLLRWALVAVVVGLGLALLAGKNDIRRYQRMRRM |
| Ga0170824_1223654991 | 3300031231 | Forest Soil | RQGARMKWLMWALLAVAIAIGLALLAGKSDIRRYQRMRRM |
| Ga0318516_1000153411 | 3300031543 | Soil | MKLLRWALVAVIIALGLAFLAGQSDLRRFQRMRRM |
| Ga0318516_100087593 | 3300031543 | Soil | MKWLMWALVAVAIALGLALLAGKSDLQRFQRMRRM |
| Ga0318516_102056273 | 3300031543 | Soil | MKLLRWALIAVVIALALVLLAGQGDLRRFQRMRRM |
| Ga0318516_102550682 | 3300031543 | Soil | MKWLIWALLAVAIAIGLALLAGKSDFRRFQRMRRM |
| Ga0318534_100752912 | 3300031544 | Soil | MKWLMWALLAVVIAIGLALLAGKSDFRRFQRMRRM |
| Ga0318534_106447922 | 3300031544 | Soil | MKLLIWVLAAILIAVGLALLAGKGDLQRFQRMRRM |
| Ga0318541_102987291 | 3300031545 | Soil | MKWLMWALVAVAIAIGLALLAGQSDLRRFQRMRRM |
| Ga0318538_102712951 | 3300031546 | Soil | MKWLIWALLAVAIAVGLALLAGKSDFRRFQRMRRM |
| Ga0318571_103395521 | 3300031549 | Soil | MKWLMWALLAVAIAIGLALLAGQSDLRRFQRMRRM |
| Ga0310915_101636662 | 3300031573 | Soil | MKWLGWVLVVLVIAIGIALLAGNGDLRRFQRMRRM |
| Ga0318542_101968062 | 3300031668 | Soil | MKWLMWALVAVVIAIGLALLAGKGDLQRFQRMRRM |
| Ga0318572_100786841 | 3300031681 | Soil | RGSRMKLLRWALVAVIIALGLAFLAGQSDLRRFQRMRRM |
| Ga0318496_100097052 | 3300031713 | Soil | MKLLRWALIAVVIALALVLLAGQGGLRRFQRMRRM |
| Ga0318496_105291641 | 3300031713 | Soil | RQGAWMKWLMWALVAVAIAIGLALLAGQGDIRRYQRMRRM |
| Ga0318501_102947672 | 3300031736 | Soil | MKLLRWALVALVIALGLALLAGKSDIRRYQRMRRM |
| Ga0318546_104594602 | 3300031771 | Soil | MKWLMWALLAVAVAIGLILLAGQSDLRRFQRMRRM |
| Ga0318552_105290172 | 3300031782 | Soil | RRRGSSMKLLRWALVALVIALGLALLAGKSDIRRYQRMRRM |
| Ga0318503_101099351 | 3300031794 | Soil | GSRMKLLRWALIAVVIALALVLLAGQGDLRRFQRMRRM |
| Ga0318557_103691791 | 3300031795 | Soil | RGHGMKWLMWALVAVAIAIGLALLAGQSDLRRFQRMRRM |
| Ga0306923_124715812 | 3300031910 | Soil | MKWLMWALLAVAIAIGLVLLAGKSDLQRFQRMRRM |
| Ga0310909_107511962 | 3300031947 | Soil | MKLLRWALVAVIIALGLALLAGQSDLRRFQRMRRM |
| Ga0307479_115050031 | 3300031962 | Hardwood Forest Soil | MKWLMWALVAVAIAIGLALLAGKADLQRFQRMRRM |
| Ga0318563_103191562 | 3300032009 | Soil | MKLLRWMLIAVVIALGLALLAGQSDLRRFQRMRRM |
| Ga0318532_101572482 | 3300032051 | Soil | ATDRGHGMRWLMWALVAVAIAIGLALLAGQSDLRRFQRMRRM |
| Ga0311301_120589702 | 3300032160 | Peatlands Soil | MKLLRWALVAVVVALGLALLAGQSDLRRFQRMHRM |
| Ga0307471_1000404192 | 3300032180 | Hardwood Forest Soil | MKWLMWVLVTIAIAIGLALFAGKNDIRRYQRMRRM |
| Ga0307472_1008609732 | 3300032205 | Hardwood Forest Soil | MKWLMWALVAVAIAIGLGLLAGQGDLRRFQRMRRM |
| Ga0307472_1019541591 | 3300032205 | Hardwood Forest Soil | MKLLRWALVVVIVALGLALLAGRSDLRRYQRMRRM |
| Ga0306920_1029873332 | 3300032261 | Soil | MKWLMWALVTVAIAIGLALLAGQGDIRRYQRMRRM |
| Ga0306920_1035563451 | 3300032261 | Soil | MKLLRWALVAVIVGLGLALLAGKSDIRRYQRMRRM |
| Ga0335078_100219663 | 3300032805 | Soil | MKWLIWALLAVALAVGVALLAGKGDIRRFQRMKRM |
| ⦗Top⦘ |