Basic Information | |
---|---|
Family ID | F077625 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 42 residues |
Representative Sequence | GATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFA |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.87 % |
% of genes near scaffold ends (potentially truncated) | 95.73 % |
% of genes from short scaffolds (< 2000 bps) | 93.16 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.231 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.641 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.205 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.120 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF00210 | Ferritin | 10.26 |
PF01068 | DNA_ligase_A_M | 7.69 |
PF01471 | PG_binding_1 | 5.98 |
PF01035 | DNA_binding_1 | 3.42 |
PF00890 | FAD_binding_2 | 3.42 |
PF06627 | DUF1153 | 1.71 |
PF02954 | HTH_8 | 1.71 |
PF13193 | AMP-binding_C | 1.71 |
PF00754 | F5_F8_type_C | 0.85 |
PF03711 | OKR_DC_1_C | 0.85 |
PF00239 | Resolvase | 0.85 |
PF01594 | AI-2E_transport | 0.85 |
PF12085 | DUF3562 | 0.85 |
PF04828 | GFA | 0.85 |
PF00593 | TonB_dep_Rec | 0.85 |
PF00990 | GGDEF | 0.85 |
PF04679 | DNA_ligase_A_C | 0.85 |
PF13340 | DUF4096 | 0.85 |
PF07311 | Dodecin | 0.85 |
PF16518 | GrlR | 0.85 |
PF14259 | Obsolete Pfam Family | 0.85 |
PF12833 | HTH_18 | 0.85 |
PF09361 | Phasin_2 | 0.85 |
PF00355 | Rieske | 0.85 |
PF00872 | Transposase_mut | 0.85 |
PF04072 | LCM | 0.85 |
PF03473 | MOSC | 0.85 |
PF00011 | HSP20 | 0.85 |
PF06628 | Catalase-rel | 0.85 |
PF05015 | HigB-like_toxin | 0.85 |
PF03050 | DDE_Tnp_IS66 | 0.85 |
PF00440 | TetR_N | 0.85 |
PF05598 | DUF772 | 0.85 |
PF10276 | zf-CHCC | 0.85 |
PF02812 | ELFV_dehydrog_N | 0.85 |
PF00196 | GerE | 0.85 |
PF00072 | Response_reg | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 8.55 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 7.69 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 3.42 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 3.42 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.85 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.85 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.85 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.85 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.85 |
COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.85 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.85 |
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.85 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.85 |
COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.23 % |
Unclassified | root | N/A | 30.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_101054165 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100577057 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10180752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 854 | Open in IMG/M |
3300004139|Ga0058897_11015172 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005187|Ga0066675_10344609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1088 | Open in IMG/M |
3300005435|Ga0070714_102495977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Prochlorotrichaceae → Prochlorothrix → Prochlorothrix hollandica | 502 | Open in IMG/M |
3300005556|Ga0066707_10001305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9280 | Open in IMG/M |
3300005602|Ga0070762_10648494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → environmental samples → uncultured Sphingomonadaceae bacterium | 705 | Open in IMG/M |
3300005764|Ga0066903_104561102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
3300006032|Ga0066696_10077270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1945 | Open in IMG/M |
3300006174|Ga0075014_100619691 | Not Available | 621 | Open in IMG/M |
3300006175|Ga0070712_100626360 | Not Available | 912 | Open in IMG/M |
3300006755|Ga0079222_10972729 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300006796|Ga0066665_10213943 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300006797|Ga0066659_10776252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
3300006806|Ga0079220_11231996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
3300006894|Ga0079215_10070591 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300009143|Ga0099792_10204222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
3300009143|Ga0099792_10913067 | Not Available | 582 | Open in IMG/M |
3300009147|Ga0114129_13185891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 534 | Open in IMG/M |
3300010046|Ga0126384_10137250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1865 | Open in IMG/M |
3300010337|Ga0134062_10684505 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300010361|Ga0126378_10124918 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
3300010376|Ga0126381_103156275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 652 | Open in IMG/M |
3300010403|Ga0134123_11096419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
3300010868|Ga0124844_1313805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 521 | Open in IMG/M |
3300011120|Ga0150983_13210962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
3300012021|Ga0120192_10109084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
3300012022|Ga0120191_10171301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
3300012169|Ga0153990_1019826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1494 | Open in IMG/M |
3300012203|Ga0137399_10798030 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300012207|Ga0137381_11354614 | Not Available | 604 | Open in IMG/M |
3300012208|Ga0137376_10210784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1682 | Open in IMG/M |
3300012212|Ga0150985_116369070 | Not Available | 518 | Open in IMG/M |
3300012918|Ga0137396_10712436 | Not Available | 740 | Open in IMG/M |
3300012925|Ga0137419_10608114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
3300012987|Ga0164307_11088677 | Not Available | 656 | Open in IMG/M |
3300016270|Ga0182036_11223181 | Not Available | 625 | Open in IMG/M |
3300016294|Ga0182041_10561173 | Not Available | 998 | Open in IMG/M |
3300016294|Ga0182041_11110128 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300016357|Ga0182032_11048420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
3300016357|Ga0182032_11930050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
3300016371|Ga0182034_10329671 | Not Available | 1233 | Open in IMG/M |
3300016387|Ga0182040_10045735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2687 | Open in IMG/M |
3300016387|Ga0182040_10742359 | Not Available | 805 | Open in IMG/M |
3300016422|Ga0182039_10474144 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300018433|Ga0066667_11155183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 672 | Open in IMG/M |
3300018468|Ga0066662_12818941 | Not Available | 516 | Open in IMG/M |
3300019882|Ga0193713_1202154 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300020580|Ga0210403_10300358 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300021086|Ga0179596_10253951 | Not Available | 869 | Open in IMG/M |
3300021168|Ga0210406_10087763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2654 | Open in IMG/M |
3300021168|Ga0210406_10516239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
3300021178|Ga0210408_10303702 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300021178|Ga0210408_10527023 | Not Available | 938 | Open in IMG/M |
3300021178|Ga0210408_11126609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 602 | Open in IMG/M |
3300021402|Ga0210385_10325486 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300021403|Ga0210397_10809565 | Not Available | 723 | Open in IMG/M |
3300021405|Ga0210387_10978963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
3300021420|Ga0210394_11058177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
3300021559|Ga0210409_10426359 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300021559|Ga0210409_10752748 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300021560|Ga0126371_11152201 | Not Available | 913 | Open in IMG/M |
3300022557|Ga0212123_10851170 | Not Available | 542 | Open in IMG/M |
3300025898|Ga0207692_10222200 | Not Available | 1120 | Open in IMG/M |
3300025928|Ga0207700_10831470 | Not Available | 826 | Open in IMG/M |
3300026369|Ga0257152_1026974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 617 | Open in IMG/M |
3300026529|Ga0209806_1121587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1057 | Open in IMG/M |
3300026555|Ga0179593_1106883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1941 | Open in IMG/M |
3300026984|Ga0208732_1016538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 646 | Open in IMG/M |
3300027105|Ga0207944_1009093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
3300027173|Ga0208097_1022713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
3300027173|Ga0208097_1029720 | Not Available | 628 | Open in IMG/M |
3300027326|Ga0209731_1048433 | Not Available | 641 | Open in IMG/M |
3300027651|Ga0209217_1216274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300027783|Ga0209448_10042440 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300027855|Ga0209693_10502224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
3300027882|Ga0209590_10836815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 583 | Open in IMG/M |
3300027889|Ga0209380_10417325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
3300027907|Ga0207428_11065340 | Not Available | 566 | Open in IMG/M |
3300030916|Ga0075386_12127103 | Not Available | 893 | Open in IMG/M |
3300031122|Ga0170822_11426360 | Not Available | 800 | Open in IMG/M |
3300031128|Ga0170823_15456415 | Not Available | 1027 | Open in IMG/M |
3300031231|Ga0170824_123882663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 793 | Open in IMG/M |
3300031446|Ga0170820_17620854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 534 | Open in IMG/M |
3300031572|Ga0318515_10442729 | Not Available | 695 | Open in IMG/M |
3300031573|Ga0310915_11197363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
3300031718|Ga0307474_10873262 | Not Available | 712 | Open in IMG/M |
3300031723|Ga0318493_10074680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1660 | Open in IMG/M |
3300031744|Ga0306918_10964863 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300031753|Ga0307477_10789435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
3300031781|Ga0318547_10007246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4858 | Open in IMG/M |
3300031805|Ga0318497_10064822 | Not Available | 1910 | Open in IMG/M |
3300031819|Ga0318568_10987916 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031833|Ga0310917_10189255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1373 | Open in IMG/M |
3300031908|Ga0310900_10222704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1341 | Open in IMG/M |
3300031910|Ga0306923_11174354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 822 | Open in IMG/M |
3300031912|Ga0306921_12258699 | Not Available | 572 | Open in IMG/M |
3300031941|Ga0310912_10348093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1151 | Open in IMG/M |
3300031942|Ga0310916_10325908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1303 | Open in IMG/M |
3300031954|Ga0306926_10701499 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
3300031981|Ga0318531_10261266 | Not Available | 782 | Open in IMG/M |
3300032001|Ga0306922_10537193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1244 | Open in IMG/M |
3300032043|Ga0318556_10020826 | Not Available | 2931 | Open in IMG/M |
3300032043|Ga0318556_10375621 | Not Available | 744 | Open in IMG/M |
3300032054|Ga0318570_10548307 | Not Available | 527 | Open in IMG/M |
3300032091|Ga0318577_10283416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
3300032091|Ga0318577_10373563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 681 | Open in IMG/M |
3300032094|Ga0318540_10311532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
3300032180|Ga0307471_102129599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 705 | Open in IMG/M |
3300032205|Ga0307472_101234229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
3300032261|Ga0306920_100822217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1362 | Open in IMG/M |
3300032261|Ga0306920_101662004 | Not Available | 906 | Open in IMG/M |
3300032261|Ga0306920_102150577 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300032828|Ga0335080_11742253 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.53% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.40% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.42% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.71% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.71% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.85% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1010541651 | 3300000956 | Soil | EYTFSPRGATYQREEQRLNLHRVSHLRLTIVPNKNGSGTATLTALRLFA* |
JGI12627J18819_100078323 | 3300001867 | Forest Soil | LVQEYNFNPRGATFQREELRFNRLQASRLRFTIVPNKNGSGTATITALRLFA* |
JGIcombinedJ26739_1005770571 | 3300002245 | Forest Soil | SPRGATYQREEQRLDLDRVTHLRLAIVPNKNGSGTATLTALHLFA* |
JGIcombinedJ51221_101807521 | 3300003505 | Forest Soil | TYQREKQRFDLHGVTHLRLTIVPNKSGSGTATLTALRLFA* |
Ga0058897_110151722 | 3300004139 | Forest Soil | QDYTFSPRGATYQREEQSFTRVLATHLRLTIVPNKNGHGPATLTALRLFA* |
Ga0066675_103446093 | 3300005187 | Soil | TYQREDQRVNLRQVTHLRLTIVPNKSGSGTATLTTLRLFA* |
Ga0070714_1024959771 | 3300005435 | Agricultural Soil | GGATYQREEQRFNLRQVTHLRLTIVSNKRGSGTATLTALRLFG* |
Ga0066707_100013051 | 3300005556 | Soil | QHEELRLELPAITHLSLTIVPNKSGSGIASLTALRLFA* |
Ga0070762_106484941 | 3300005602 | Soil | REEQRFNLRQVTHLRLTIVPNKSGSGTASLTALRLFA* |
Ga0066903_1045611021 | 3300005764 | Tropical Forest Soil | RQEQRLNLSQVSRLRLTIVPNKNGSGTATLTTFRLYA* |
Ga0068860_1024687192 | 3300005843 | Switchgrass Rhizosphere | GSTFQREDLSFNLPKVTHVRLTIVPNKGGTGTASLTSLRLFS* |
Ga0066696_100772701 | 3300006032 | Soil | AIFQHEELRLELPAITHLSLTIVPNKSGSGIASLTALRLFA* |
Ga0075014_1006196912 | 3300006174 | Watersheds | TYQREEQRFNLRQVTHLRLTFVPNKSGSGTAPLTALRLFA* |
Ga0070712_1006263604 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YQREEQRFDLHRVTHLRLTIVPNKNNSGTATLTALRLFA* |
Ga0079222_109727291 | 3300006755 | Agricultural Soil | SPRGATYQREEQRLNLRHVSRLRLTIVPNKNGSGTATLTALRLFA* |
Ga0066665_102139431 | 3300006796 | Soil | SPGGATYQREEQRLNLLQASHLRLTIVPNKNGSGTATLTALGLFA* |
Ga0066659_107762521 | 3300006797 | Soil | QRFNLHGVTHLRLTIVPNKNGPGTVTLTALRLFV* |
Ga0079220_112319961 | 3300006806 | Agricultural Soil | ATFQREQQRFNLRRATHLLLTIVPNKSGSGVATLTSLHLFA* |
Ga0079215_100705911 | 3300006894 | Agricultural Soil | GATYQREEQRLNLHQVSHLRLTIVPNKSGSGTATLTSLRLFG* |
Ga0099792_102042223 | 3300009143 | Vadose Zone Soil | YQREEQRFNLRQVTHLRLTIVPNKNGAGTATITAIRLFA* |
Ga0099792_109130671 | 3300009143 | Vadose Zone Soil | PGGATYQHEEQRFNLLQVTHLRFTIVPNKSGSGTATLTALRLFA* |
Ga0114129_131858911 | 3300009147 | Populus Rhizosphere | TFSPRGATYQREEQRLNLHQVSHLRLTIVPNKHGSGTATLTALRLFA* |
Ga0126384_101372501 | 3300010046 | Tropical Forest Soil | ATYQREEQRFNVRQVTHLHLTIVPNKSGSGTATLTALRLFRLGA* |
Ga0134062_106845051 | 3300010337 | Grasslands Soil | QQYTFSPQGAIFQHEELRLELPAITHLSLTIVPNKSGSGVATLTALRLFA* |
Ga0126378_101249181 | 3300010361 | Tropical Forest Soil | EQRFNLRQVTHLRLTIVPNKSGSGTATLISLRLFA* |
Ga0126381_1031562751 | 3300010376 | Tropical Forest Soil | NFSPGGATYQREEQRFNVRQVTHLHLTIVPNKSGSGTATLTALRLFRLGA* |
Ga0134123_110964191 | 3300010403 | Terrestrial Soil | QEQRFDLRRVTHLRLVIVPNKSGSGTATLTALRLFA* |
Ga0124844_13138052 | 3300010868 | Tropical Forest Soil | DQRFKLYQVSHLRLTIVPNKNGSGAASLTALRLFA* |
Ga0150983_132109621 | 3300011120 | Forest Soil | REEQRFNLRQVNHLRLTIVPNKSGSGTATLTALRLFA* |
Ga0120192_101090842 | 3300012021 | Terrestrial | ATYQREEQRLNLHQVSHLRLTIVPNKSGSGTATLTSLRLFA* |
Ga0120191_101713011 | 3300012022 | Terrestrial | TSPPRGAPYQREEQRLNVHQVSHLRLTIVPNKNGSGTATLTALRLFA* |
Ga0153990_10198261 | 3300012169 | Attine Ant Fungus Gardens | GATYQREEQRFNLHQVSHLRFTIVPNKNGSGTATLTALRLFA* |
Ga0137399_107980302 | 3300012203 | Vadose Zone Soil | ATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALLLFA* |
Ga0137381_113546141 | 3300012207 | Vadose Zone Soil | FSPGGATYQHEEQRFNLLQVTHLRFTIVPNKNGSGTATLTALRLFA* |
Ga0137376_102107843 | 3300012208 | Vadose Zone Soil | FSPRGATFQREEQRFNLHGVTHLRFTIVPNKSGSGAASLTALRVFA* |
Ga0150985_1163690701 | 3300012212 | Avena Fatua Rhizosphere | REDLRLALQGVTHLRLVIIPHLRGSGTATLTCLELFA* |
Ga0137396_107124362 | 3300012918 | Vadose Zone Soil | AQEYNLTPGGATYQRGSQRCKLIQFTHPLLTIVPNKSGSGTATLTALRLFA* |
Ga0137419_106081143 | 3300012925 | Vadose Zone Soil | LSPGGATYQHEEQRFNLLQVTHLRFTIVPNKNGSGTATLTALRLFA* |
Ga0164307_110886771 | 3300012987 | Soil | ATYQREEQRFDLHRVTHLRLTIVPNKNNSGTATLTALRLFA* |
Ga0182036_112231811 | 3300016270 | Soil | RGATYQREELRFNLLQVSRLRLTVVPNKNGSGTATLTTLRLFA |
Ga0182041_105611731 | 3300016294 | Soil | EQRLNLHQVSHLRLTIVPNKNGSGTATLTSLRLFA |
Ga0182041_111101282 | 3300016294 | Soil | REEQRFNLRQVTHLRLTIVPNKSGSGTATLTALSLFA |
Ga0182032_110484202 | 3300016357 | Soil | QREEQRFNLSRVSQLRLTIVPNKNGSGTATLTTLRLYA |
Ga0182032_119300502 | 3300016357 | Soil | TYQREEQRLDLDRVTHLRLTIVPNKNGSGTATLTALRLFA |
Ga0182034_103296712 | 3300016371 | Soil | EYNFSPRGATFQREEQRFNLHGVTHLRLTIVPNKNGSGTASLVPIHKE |
Ga0182040_100457351 | 3300016387 | Soil | FSPGGATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALSLFA |
Ga0182040_107423592 | 3300016387 | Soil | REDQRFNLPRASRLRLTIVPNKNGSGTATLTLLRLFA |
Ga0182039_104741442 | 3300016422 | Soil | GATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALSLFA |
Ga0066667_111551832 | 3300018433 | Grasslands Soil | FSPGGATYQREDQRVNLRQVTHLRLTIVPNKSGSGTATLTTLRLFA |
Ga0066662_128189411 | 3300018468 | Grasslands Soil | EEQRFDLHGVTHLRLTIVPNKNGSGTAILTALRLFA |
Ga0193713_12021542 | 3300019882 | Soil | AIFQHEELRLELPAVTHLSLIIVPNKSGSGVATLTALRLFA |
Ga0210403_103003582 | 3300020580 | Soil | MEDVVVLIDRPRGATYQREEQRFNLPQVTHLRLTIVPNKSGSGTVTLTRLRLFA |
Ga0179596_102539511 | 3300021086 | Vadose Zone Soil | GGATYQREEQRFNLRQVTHLRLTLVPNKSGSGTASLTALRLFA |
Ga0210406_100877638 | 3300021168 | Soil | GGATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFG |
Ga0210406_105162391 | 3300021168 | Soil | MKDLYQREELRFNLQGVTHLRLTIVPNKSGSGTATLTALRLFA |
Ga0210408_103037021 | 3300021178 | Soil | NFSPGGATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFA |
Ga0210408_105270233 | 3300021178 | Soil | PGGATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFG |
Ga0210408_111266091 | 3300021178 | Soil | NFSPGGATYQREEQRFNLRQVNHLRLTIVPNKSGSGTATLTALRLFA |
Ga0210385_103254861 | 3300021402 | Soil | FQHEELRLELPAITHLSLTIVPNKSGSGVATLTALRLFN |
Ga0210397_108095651 | 3300021403 | Soil | ATYQREEQSFTRVLATHLRLTIVPNKNGHGPATLTALRLFP |
Ga0210387_109789632 | 3300021405 | Soil | YNFRPGGATYQREELRFNLRGVTHLRLTIVPHKSGSGTATLTALRLFA |
Ga0210394_110581771 | 3300021420 | Soil | QREKQRLDLHRVNHLRLTIVPNKNGSGTATLTALRLLA |
Ga0210409_104263593 | 3300021559 | Soil | ATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFG |
Ga0210409_107527482 | 3300021559 | Soil | RGATYQREEQRLDLDWVTHLRLIIVPNKNGSSTATLTALRLFA |
Ga0126371_111522012 | 3300021560 | Tropical Forest Soil | GATYQREEQRFNLRQVTHLRLTIVPNRGGSGTATLTALRLFA |
Ga0212123_108511701 | 3300022557 | Iron-Sulfur Acid Spring | QREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFA |
Ga0207692_102222001 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EQRLNLRQVTHLRLTIVPNKSGSGTATLTALRLFA |
Ga0207700_108314703 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ATYQREEQRFDLHRVTHLRLTIVPNKNNSGTATLTALRLFA |
Ga0257152_10269741 | 3300026369 | Soil | PGGATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALLLFA |
Ga0209806_11215871 | 3300026529 | Soil | EELRLELPAITHLSSAIVPNKSGSGIASLTALRLFA |
Ga0179593_11068834 | 3300026555 | Vadose Zone Soil | FSPGGATYQREEQRVNLRQVTHLRLTIVPNKSGSGTATLTTLRLFA |
Ga0208732_10165382 | 3300026984 | Forest Soil | LVQEYTFSPRGATYQREEQRFNLHQVSHLRFTIVPNKNGSGTATLTALRLFA |
Ga0207944_10090932 | 3300027105 | Forest Soil | TYQREEQRLDLDRVTHLRLTIVPNKNGSGTATLTALRLSA |
Ga0208097_10227131 | 3300027173 | Forest Soil | EQRFNLHQVSHLRFTIVPNKNGSGTATLTALRLFA |
Ga0208097_10297201 | 3300027173 | Forest Soil | QREEQRFNLRQVSHLRLSIVPNKNGSGTSTLTALRLFA |
Ga0209731_10484332 | 3300027326 | Forest Soil | GGATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFA |
Ga0209217_12162742 | 3300027651 | Forest Soil | SPRGATYQREEQRLDLDRVTHLRLAIVPNKNGSGTATLTALHLFA |
Ga0209448_100424403 | 3300027783 | Bog Forest Soil | LVQEYTFSPGGGYQREEQRFNLLQASRLRLTIVPNKDGSGMATLTALRLFA |
Ga0209693_105022242 | 3300027855 | Soil | QREEQRFNLRQVNHLRLTIVPNKSGSGTATLTALRLFA |
Ga0209590_108368151 | 3300027882 | Vadose Zone Soil | FNPGGATYQREEQRFNLRQVTHLRLTIVPNKSGSGTAMLTALRLFA |
Ga0209380_104173251 | 3300027889 | Soil | YQREEQRFNLRQVNHLRLTIVPNKSGSGTATLTALRLFA |
Ga0207428_110653401 | 3300027907 | Populus Rhizosphere | TYQREEQRLNLHQVSHLRLTIVPNKNGSGTATLTALRLFA |
Ga0075386_121271031 | 3300030916 | Soil | GATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFA |
Ga0170822_114263603 | 3300031122 | Forest Soil | EEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRFFA |
Ga0170823_154564151 | 3300031128 | Forest Soil | YNFSPGGATYQREEQRFNLRQVTRLRLTIVPNRSGSGTATLTALCLFA |
Ga0170824_1238826631 | 3300031231 | Forest Soil | QREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFG |
Ga0170820_176208541 | 3300031446 | Forest Soil | ATYQGEEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFG |
Ga0318515_104427291 | 3300031572 | Soil | ELRFSRLQASCLRLTIVPNKNGSGTATLTTLRLFA |
Ga0310915_111973633 | 3300031573 | Soil | EQRFHLRQVSHLRLTIVPNKNGSGTATLTALRLFA |
Ga0307474_108732622 | 3300031718 | Hardwood Forest Soil | GGATYQREDQRFNLHQISHLRFTISPNKSGSGTATLTALRHFA |
Ga0318493_100746803 | 3300031723 | Soil | YQREDQRFNLHQISHLHFTISPNKGGSGTATLTALRLFA |
Ga0306918_109648631 | 3300031744 | Soil | QREDQRFDLRQVTHLRLTIVPNKSGSGPATLTALRLFA |
Ga0307477_107894351 | 3300031753 | Hardwood Forest Soil | YQREEQRFDLHGVTHLRLTIVPNKSGSGTATLTALRLFA |
Ga0318547_100072467 | 3300031781 | Soil | QREDLRFNLLQVNRLRLTIVPNKNGSGNATLTTLRLFA |
Ga0318497_100648224 | 3300031805 | Soil | HQLEDLRFNLLQVHRLRLTIVPNKNGSGNATLTTLRLFA |
Ga0318568_109879161 | 3300031819 | Soil | EYTFSPRGATYQREEQRFNLSQVSQLRLTIVPNKNGSGTATLTTLRLYA |
Ga0310917_101892552 | 3300031833 | Soil | TYQREEQRFNLSRVSHLRLTIVPNKNGSGTATLTTLRLYA |
Ga0310900_102227043 | 3300031908 | Soil | WRQVWYPRGATYQREEQGLNLHQVSHLRLTIVLNKNDSGTATLTALRLFA |
Ga0306923_111743541 | 3300031910 | Soil | PAGATYQREEQRLNFHQASHLRLTIVPNKNGSGTATLTSLRLFA |
Ga0306921_122586992 | 3300031912 | Soil | EDQRFNLPRASRLRLTIVPNKNGSGTATLTLLRLFA |
Ga0310912_103480931 | 3300031941 | Soil | GATYQREEQRFNLNRVSQLRLTIVPNKNGSGTATLTTLRLYA |
Ga0310916_103259081 | 3300031942 | Soil | ATYQREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALLLFA |
Ga0306926_107014991 | 3300031954 | Soil | PGGATYQREEHRFNLRQVTHLRLTIVPNKSGSGTATLTALSLFA |
Ga0318531_102612661 | 3300031981 | Soil | FSPRGATYQREELRFDRLQTSRLRLTIVPNKSGSGTATLTTLRLFA |
Ga0306922_105371931 | 3300032001 | Soil | RGATYQREEQRVNLRNVTHLRLTIVPNKNGSGTATLTAFRLYA |
Ga0318556_100208265 | 3300032043 | Soil | QILVQGYNFSPAGATHQREDLRFNLLQVNRLRLTIVPNKNGSGNATLTTLRLFA |
Ga0318556_103756211 | 3300032043 | Soil | GGATYQREEQRFNLRQVSHLRLTIVPNKNGSGTATLTALRLCA |
Ga0318570_105483072 | 3300032054 | Soil | ATYHREEQRFNLRQVTHLRLTIVPNKSGSGTATLTALRLFA |
Ga0318577_102834162 | 3300032091 | Soil | FSPGGATYQREDQRFNLPRASRLRLTIVPNKNGSGTAPLTALRLFA |
Ga0318577_103735631 | 3300032091 | Soil | FSPGGATYQREEQRLNLRQVTHLRLTIVPNKSGSGTATLTALLLFA |
Ga0318540_103115322 | 3300032094 | Soil | REEQRFNLSRVSQLRLTIVPNKNGSGTATLTTLRLYA |
Ga0307471_1021295992 | 3300032180 | Hardwood Forest Soil | VQEYTFSPQGAMFQHEELRLELPAVTHLSLIIVPNKSGSGVATLTALRLFA |
Ga0307472_1012342291 | 3300032205 | Hardwood Forest Soil | EQRLDLDRVTHLRLTIVPNKNGSDTATLTALRLFA |
Ga0306920_1008222171 | 3300032261 | Soil | FNPGGATYQREEQHFNLRQVSHLCLTIAPNKNGSGTATLTTFRLYA |
Ga0306920_1016620041 | 3300032261 | Soil | RGATYQHEEQRFNLRRVSHLRLTIVPNKNGSGTATLTALRLYA |
Ga0306920_1021505772 | 3300032261 | Soil | HGATFQREEQRVNLHRVTHLRLTIVPNKNGSGTASLTALRLFA |
Ga0335080_117422531 | 3300032828 | Soil | QGATFQHEDLRLDLPPITHLRLTIVPNKDGSGEATLTSLRLFA |
⦗Top⦘ |