NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077599

Metagenome / Metatranscriptome Family F077599

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077599
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 48 residues
Representative Sequence VISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYASFPPVD
Number of Associated Samples 106
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 69.23 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.31 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (56.410 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.949 % of family members)
Environment Ontology (ENVO) Unclassified
(17.094 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.299 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.00%    β-sheet: 0.00%    Coil/Unstructured: 48.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00892EamA 28.21
PF07690MFS_1 26.50
PF01455HupF_HypC 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0298Hydrogenase maturation factor HybG, HypC/HupF familyPosttranslational modification, protein turnover, chaperones [O] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A56.41 %
All OrganismsrootAll Organisms43.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ01E2P81Not Available541Open in IMG/M
3300001593|JGI12635J15846_10390187Not Available843Open in IMG/M
3300004092|Ga0062389_102285016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia713Open in IMG/M
3300005534|Ga0070735_10706347Not Available596Open in IMG/M
3300005602|Ga0070762_10605947Not Available727Open in IMG/M
3300005610|Ga0070763_10091377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1521Open in IMG/M
3300005921|Ga0070766_10190184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1278Open in IMG/M
3300005921|Ga0070766_11153470Not Available536Open in IMG/M
3300006175|Ga0070712_100355769Not Available1199Open in IMG/M
3300006804|Ga0079221_10986339Not Available630Open in IMG/M
3300006806|Ga0079220_10144673Not Available1302Open in IMG/M
3300009098|Ga0105245_11342969All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300009137|Ga0066709_100858509Not Available1320Open in IMG/M
3300009698|Ga0116216_10954147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300009698|Ga0116216_10989547Not Available503Open in IMG/M
3300009792|Ga0126374_10570615Not Available829Open in IMG/M
3300010371|Ga0134125_10871127Not Available989Open in IMG/M
3300010373|Ga0134128_11604413Not Available716Open in IMG/M
3300010376|Ga0126381_104473805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300010376|Ga0126381_104681653Not Available527Open in IMG/M
3300010398|Ga0126383_11036102All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300010880|Ga0126350_10606677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1411Open in IMG/M
3300010880|Ga0126350_11942049Not Available1148Open in IMG/M
3300012198|Ga0137364_11176745Not Available575Open in IMG/M
3300012200|Ga0137382_10826166Not Available667Open in IMG/M
3300012349|Ga0137387_10799606Not Available682Open in IMG/M
3300012356|Ga0137371_10578594Not Available864Open in IMG/M
3300012357|Ga0137384_10550927Not Available944Open in IMG/M
3300012496|Ga0157353_1028367All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300012513|Ga0157326_1061546All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300012986|Ga0164304_10389536Not Available986Open in IMG/M
3300013105|Ga0157369_11101363Not Available812Open in IMG/M
3300013296|Ga0157374_11713452All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300015374|Ga0132255_104999551Not Available561Open in IMG/M
3300017924|Ga0187820_1093583Not Available858Open in IMG/M
3300017926|Ga0187807_1049487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1303Open in IMG/M
3300017928|Ga0187806_1086033Not Available991Open in IMG/M
3300017946|Ga0187879_10140120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1372Open in IMG/M
3300017955|Ga0187817_10856246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300017966|Ga0187776_10582934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii777Open in IMG/M
3300017993|Ga0187823_10052298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1126Open in IMG/M
3300017993|Ga0187823_10141715Not Available752Open in IMG/M
3300017995|Ga0187816_10268399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia746Open in IMG/M
3300018034|Ga0187863_10648411Not Available595Open in IMG/M
3300018085|Ga0187772_10205692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1324Open in IMG/M
3300018086|Ga0187769_10430827Not Available993Open in IMG/M
3300020062|Ga0193724_1124393Not Available508Open in IMG/M
3300020580|Ga0210403_10108033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2258Open in IMG/M
3300020582|Ga0210395_10676588Not Available772Open in IMG/M
3300021374|Ga0213881_10285068Not Available736Open in IMG/M
3300021384|Ga0213876_10355061Not Available780Open in IMG/M
3300021403|Ga0210397_10658307Not Available803Open in IMG/M
3300021432|Ga0210384_10429944Not Available1189Open in IMG/M
3300021474|Ga0210390_11507157Not Available532Open in IMG/M
3300021479|Ga0210410_11027661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NRRL B-3648713Open in IMG/M
3300024227|Ga0228598_1114770All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300025634|Ga0208589_1060947Not Available935Open in IMG/M
3300025919|Ga0207657_10077432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2802Open in IMG/M
3300025928|Ga0207700_11072951Not Available720Open in IMG/M
3300025928|Ga0207700_11697338Not Available557Open in IMG/M
3300025929|Ga0207664_10627895All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300027080|Ga0208237_1001560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2802Open in IMG/M
3300027568|Ga0208042_1111629Not Available690Open in IMG/M
3300027604|Ga0208324_1072070Not Available985Open in IMG/M
3300027737|Ga0209038_10031632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NRRL B-36481572Open in IMG/M
3300027853|Ga0209274_10630445Not Available554Open in IMG/M
3300027854|Ga0209517_10413133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia755Open in IMG/M
3300027898|Ga0209067_10399436All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300027911|Ga0209698_10377096Not Available1111Open in IMG/M
3300028713|Ga0307303_10131790Not Available591Open in IMG/M
3300028742|Ga0302220_10174840Not Available809Open in IMG/M
3300028780|Ga0302225_10143821All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300028780|Ga0302225_10200479Not Available959Open in IMG/M
3300028789|Ga0302232_10071824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Motilibacterales → Motilibacteraceae → Motilibacter → Motilibacter peucedani1799Open in IMG/M
3300028789|Ga0302232_10286225Not Available814Open in IMG/M
3300028789|Ga0302232_10291514Not Available806Open in IMG/M
3300028806|Ga0302221_10525930Not Available516Open in IMG/M
3300028807|Ga0307305_10040102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2151Open in IMG/M
3300028824|Ga0307310_10144315Not Available1094Open in IMG/M
3300028906|Ga0308309_10180059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1726Open in IMG/M
3300029943|Ga0311340_10096784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3265Open in IMG/M
3300029951|Ga0311371_10263520All Organisms → cellular organisms → Bacteria2472Open in IMG/M
3300029997|Ga0302302_1190340Not Available779Open in IMG/M
3300030007|Ga0311338_10617775Not Available1111Open in IMG/M
3300030007|Ga0311338_10723134Not Available1003Open in IMG/M
3300030013|Ga0302178_10051833All Organisms → cellular organisms → Bacteria2253Open in IMG/M
3300030013|Ga0302178_10103287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1463Open in IMG/M
3300030053|Ga0302177_10054160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2422Open in IMG/M
3300030520|Ga0311372_10533341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1707Open in IMG/M
3300030617|Ga0311356_10307421Not Available1587Open in IMG/M
3300031028|Ga0302180_10006143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8638Open in IMG/M
3300031236|Ga0302324_103329773Not Available525Open in IMG/M
3300031544|Ga0318534_10390371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia800Open in IMG/M
3300031549|Ga0318571_10321678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300031668|Ga0318542_10359096Not Available750Open in IMG/M
3300031679|Ga0318561_10507366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300031680|Ga0318574_10447822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_235755Open in IMG/M
3300031681|Ga0318572_10170578Not Available1263Open in IMG/M
3300031682|Ga0318560_10732318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300031715|Ga0307476_10318363Not Available1143Open in IMG/M
3300031718|Ga0307474_11462645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NRRL B-3648538Open in IMG/M
3300031748|Ga0318492_10597990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300031778|Ga0318498_10074546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_2351526Open in IMG/M
3300031779|Ga0318566_10223987Not Available933Open in IMG/M
3300031795|Ga0318557_10057183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1656Open in IMG/M
3300031799|Ga0318565_10454797Not Available619Open in IMG/M
3300031821|Ga0318567_10572510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300031879|Ga0306919_10459339Not Available980Open in IMG/M
3300031896|Ga0318551_10549148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia665Open in IMG/M
3300031962|Ga0307479_10756503Not Available949Open in IMG/M
3300032043|Ga0318556_10400446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300032076|Ga0306924_11290299Not Available785Open in IMG/M
3300032180|Ga0307471_100921593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300032805|Ga0335078_12398977Not Available548Open in IMG/M
3300032828|Ga0335080_10742451Not Available1019Open in IMG/M
3300032895|Ga0335074_11059858Not Available705Open in IMG/M
3300032954|Ga0335083_10814840Not Available748Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.95%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa16.24%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.27%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.42%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.71%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.71%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.71%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.71%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.71%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.85%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.85%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.85%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.85%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_084530002170459024Grass SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYAS
JGI12635J15846_1039018723300001593Forest SoilVISHAVPASGARTGRAGAFGGFRTRWALLLAVAGGLAVFAAFPPLDVWPLAA
Ga0062389_10228501613300004092Bog Forest SoilVSASGARAGRAEAFGGFRLRWALLLAIAGGLATYAAFPPVDAWPLAVAGP
Ga0070735_1070634713300005534Surface SoilVISAQAAAASGARTGRVGDFGGFRTRWALLISVAGGLALYASFPPTDAWPL
Ga0070762_1060594723300005602SoilVISAQAAADSGARTSQAGAFGGFRTRWALLLSVAGGLAVFASSPPLDVWPL
Ga0070763_1009137733300005610SoilVISAQAAADSGADSGARTGQAGAFGGFRTRWALLLSAAGGLAVFAASPPLDVWPLAF
Ga0070766_1019018433300005921SoilVISAQAAVASRAQTGAFGGFRTRWALLLSAAGGLA
Ga0070766_1115347023300005921SoilVSEPSERGNTVISAQAVPASGARTGRATDSGGFGPWWALFLSVAGGLALYAAFPPVGAW
Ga0070712_10035576923300006175Corn, Switchgrass And Miscanthus RhizosphereVISARAASSTDARTGRAGSFTGFKTRWALLISVAGGLALFA
Ga0079221_1098633913300006804Agricultural SoilVISAQATSDADARTGGAGTFAGFRTRWALLISVAGGLALYASF
Ga0079220_1014467313300006806Agricultural SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLA
Ga0105245_1134296923300009098Miscanthus RhizosphereVISAQAAAASGARTGRAGDSGGFRTRWALLISVAGGLALYASFPPIGI
Ga0066709_10085850923300009137Grasslands SoilVISAQAAAASGARTGRAGDFGGFRTGWALLISVAGGLALYAAFPPVDAWPLAVLGPALLWLALT
Ga0116216_1095414723300009698Peatlands SoilVISAQAVPASGARTGRATDSRGFGIGWALLISVAGGLALYAAFPPVGAWPLAV
Ga0116216_1098954713300009698Peatlands SoilVISAQAVPASGARTGRAGDPGGFSAPWALLLSVAGG
Ga0126374_1057061513300009792Tropical Forest SoilVISAQAAAASGARTGRAGEAGGFGIGWALLISVAGGLA
Ga0134125_1087112713300010371Terrestrial SoilVISAQAAAASGARTGRAGDSGGFRTRWALLISVAGGLALYAS
Ga0134128_1160441313300010373Terrestrial SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYASFPPTDAW
Ga0126381_10447380523300010376Tropical Forest SoilVISAQAVPASGARTGRNGAFAGFRTRWALLLSAAGGLALFA
Ga0126381_10468165313300010376Tropical Forest SoilVISAQAAPASGARTGRAGDFAGFRTRWALLISIAGGLALYA
Ga0126383_1103610213300010398Tropical Forest SoilVISAEAASASPAAGARAGRAGDFGGFSIRWALLLSVAGGLALFASFPPADAWPLAVLGP
Ga0126350_1060667713300010880Boreal Forest SoilVISAQAAPAADAATSGPDGFGGFATRWALLISVAGGLVT
Ga0126350_1194204923300010880Boreal Forest SoilVISAQAVTAAGARTGRAAAFGGFRTRWALLISVAGGLA
Ga0137364_1117674513300012198Vadose Zone SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISAAGGLALYASFPPIGIWPLAVLGPA
Ga0137382_1082616623300012200Vadose Zone SoilVISAQAAAASGARTGRAGEFGGFRTRWALLISVAGGLALYASF
Ga0137387_1079960613300012349Vadose Zone SoilMISAEAVSASGARTGRGADSGGFRTRWALPLSVAGGLAT
Ga0137371_1057859413300012356Vadose Zone SoilVISAQAAAASGARTSRAGDFGGFRTRWALLLSVAG
Ga0137384_1055092723300012357Vadose Zone SoilVISAQAAAASGARTGRAGDFGGFRARWALLISVAGGLALYASFPP
Ga0157353_102836713300012496Unplanted SoilVISAQAAAASGARTGRAGDSGGFRTRWALLISAAG
Ga0157326_106154613300012513Arabidopsis RhizosphereVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYASFPPAG
Ga0164304_1038953623300012986SoilVISAQAAAASGARTGRAGDSRGFRTRWALLISVAGGLALYASFPPAGI
Ga0157369_1110136313300013105Corn RhizosphereVISAQAAAASGARTGRAGDSGGFRTRWALLISVAGGLALYASF
Ga0157374_1171345213300013296Miscanthus RhizosphereVISAQAAASGARTGRARDSGGFRTRWALLISVAGG
Ga0132255_10499955123300015374Arabidopsis RhizosphereVISAEAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYASFPPAGIW
Ga0187820_109358323300017924Freshwater SedimentVISAQAGSVSGTTARRAAGFAGFAWPWALLLSVAGGLAVFASFPPLDAWPLAAVG
Ga0187807_104948733300017926Freshwater SedimentVISQAVPASGARTGRAGAFGGFRTRWALLLCLAGGLAVFASFPPLG
Ga0187806_108603323300017928Freshwater SedimentVISAETVPASGARTGRAGTFGGVRTRWALLLWVAGGLAVFAS
Ga0187879_1014012013300017946PeatlandVISAQATPAAGAKTRGPAAFGGFPTRWALLLSLAGGLALFAAFPPVDAW
Ga0187817_1085624623300017955Freshwater SedimentVISAQAVPAPGATTSRAGAFGGFGTRWALLMSVVGGVAVFASFPPLDAWPLAALG
Ga0187776_1058293413300017966Tropical PeatlandVPASGARTGRAGAFGGFRTRWALLLSAAGGLAVYASFPPLDLWPLAVAG
Ga0187823_1005229823300017993Freshwater SedimentVISAQAVGASGARTGRTGAFGGFRTRWALLLSVAGGLAVFASFPPLDVWPLAFA
Ga0187823_1014171523300017993Freshwater SedimentVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYASF
Ga0187816_1026839923300017995Freshwater SedimentVISAQAAAASGARTGQVGAFGGFRTRWALLLSAAGGLAVFASSP
Ga0187863_1064841123300018034PeatlandVISAQAASAADARTGCAGTFGAFETRWALLISVAGVLALFASFPPVDAW
Ga0187772_1020569213300018085Tropical PeatlandMSQVSAQAVPASGATASRAGAFAGFGTWWALLTSVA
Ga0187769_1043082723300018086Tropical PeatlandVISAQAVGASGAGTRRAGAFGGFRLRWALPLSVAGGLAVFASFPPLD
Ga0193724_112439323300020062SoilVTGARPPGYPLRVISAQAAAASGARTGRAGDSGGFRTRWALLISVAGGLALYASFPPVGIWP
Ga0210403_1010803313300020580SoilVISAQAAAASGARTGRAGVFGGFRTRWALLISVAGGLAMYASFPPVDAWPL
Ga0210395_1067658823300020582SoilVISAQAAAAAGARTGQAEAFGGFRTRWALLLSLAGGLAVFASSPPLDVWPLAFL
Ga0213881_1028506813300021374Exposed RockVISARTVPASGARTGRAGDFAGFRVRWALPIAVAGGLALFASFPPVD
Ga0213876_1035506123300021384Plant RootsVISAQAVPASGARTGRVGDLRGVRLHWALLLSVAGGLALF
Ga0210397_1065830713300021403SoilVISAQAAVASGAQTGAFRGFRTRWALLLSAAGGVAAFASF
Ga0210384_1042994423300021432SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYASFP
Ga0210390_1150715723300021474SoilVISAQAAPAAGAKTRGPAAFGGFATRWALLLSVAGGLALFAAFPP
Ga0210410_1102766113300021479SoilVISAQAAADSGADSGARTGQAGAFGGFRTRWALLLSAAG
Ga0228598_111477023300024227RhizosphereVISAQAVPASGARTGGAGDFGGFGTRWALLISVAGGLALYASFPPVG
Ga0208589_106094723300025634Arctic Peat SoilVISAQAAADSGADSGARTSQVGAFGGFRTRWALLLSLAGGLAVFASSPPLD
Ga0207657_1007743233300025919Corn RhizosphereVTGAPPPGYPLRVISAQAAAASGARTGRAGDSGGFRTRWALLISVAGGLALYASFPPAGIWPLA
Ga0207700_1107295123300025928Corn, Switchgrass And Miscanthus RhizosphereVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYASFPPTDAWPL
Ga0207700_1169733813300025928Corn, Switchgrass And Miscanthus RhizosphereVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYASFPPTDAWPLAVL
Ga0207664_1062789513300025929Agricultural SoilVISAQAAAASGARTSRAGDFGGFRTRWALLISVAGGLALYASFPPVDA
Ga0208237_100156033300027080Forest SoilVISAQAAADSGADSGARTSQVGAFGGFRTRWALLLS
Ga0208042_111162913300027568Peatlands SoilVISAQATPASGARTGRAGDSGGFGTWWALLLSVAGGLALYASFPPVGAWP
Ga0208324_107207023300027604Peatlands SoilVISARAVPAAGARTGRAADAGVFGTWWALLISVAGGLALYAAFPPVGAWPLAVLGPGLLV
Ga0209038_1003163213300027737Bog Forest SoilVISAQAAADSGADSGARTGQVGAFGGFRTRWALLLSAAGGLAVFASSPPLDV
Ga0209274_1063044513300027853SoilVISAQAAPATGAKTRGPGAFGGFATRWALLLSVAGGLALFAAFPPVDAWPLAVA
Ga0209517_1041313323300027854Peatlands SoilVISARAVPAAGARTGRAADAGVFGTWWALLISVAGGLALYAAFPPVGAWPLAVLGPG
Ga0209067_1039943623300027898WatershedsVISARAVPAAGARTGRAADSGVFGTWWALLISVAGGLALYASFPPIDAWPLAVLG
Ga0209698_1037709613300027911WatershedsVISAQAIPASGARTGRAGDFGGFGIGWALLISVAGGLALYAAFPPVGAWPLAVLGPG
Ga0307303_1013179013300028713SoilVTGARPPGYPLRVISAQAAAASGARTGRAGDSGGFRTRWALLISVAGGLALYASFPPVGIWPLAVLGP
Ga0302220_1017484023300028742PalsaVISAQAAPAADAETRGQAAFGGFATRWALLLSVAGGL
Ga0302225_1014382133300028780PalsaVISAQAAPAAGAKTRGPGAYGGFATRWALLASVAGGL
Ga0302225_1020047913300028780PalsaVISAQAAPAAGAKTRGPGAFGGFATRWALLLSVAGGLALFAAFPPVDAWPLAVAGPGIL
Ga0302232_1007182433300028789PalsaVISAQAVTAAGAGTDRAAGSGGFRTRWALLISVAGGLALFA
Ga0302232_1028622523300028789PalsaVISAQAAPAAGAKTRGPGAFGGFATRWALLLSLAGGLALYAAFPPVDAWPLAVAG
Ga0302232_1029151423300028789PalsaVISAQAAPVGAKTRGPGAFGGFATRWALLLSLAGGLALFAAFPPVDAWPLAVAGPTLL
Ga0302221_1052593023300028806PalsaVISAQAAPAADAETRGQAAFGGFATRWALLLSVAGGLALFAAFPPVDAWPLAVAGPGILV
Ga0307305_1004010213300028807SoilVTGARPPGYPLRVISAQAAAASGARTGRAGDSGGFRTRWALLISVAGGLALYASFPPVGIWPLAVLGPA
Ga0307310_1014431523300028824SoilVTGAHPPGYPLKVISAQASAASAASGARSGRAGDSGGFRTRWALLISVAGGLALYASFPPVGIWPLAVLGPA
Ga0308309_1018005913300028906SoilVISAQAVPASGARTGRTGEFGGFGTRWALLISIASGLALYA
Ga0311340_1009678413300029943PalsaVISAQAAPAAGAKTRGPGAYGGFATRWALLASVAGGLAL
Ga0311371_1026352043300029951PalsaVISAQAAPAGAKTRGPATFGGFATRWALLLSVAGG
Ga0302302_119034023300029997PalsaVISAQAAPAAGAKTRGPGAYGGFATRWALLASVAGGLALFAAFPPVN
Ga0311338_1061777523300030007PalsaVISAQAAPAADAETRGQAAFGGFATRWALLLSVAGGLALFAAFPPVDAWPLAVA
Ga0311338_1072313413300030007PalsaVISAQAAPAAGAKTRGPGAFGGFATRWALLLSLAGGLALFA
Ga0302178_1005183313300030013PalsaVISAQAVTAAGAGTGRAAAFGGFRTRWALLISVAGGLTLFAA
Ga0302178_1010328713300030013PalsaVISHAVPASGARTGRAGAFGGFRTRWALLASAAGGLAVFAAFPPLDVWPLAA
Ga0302177_1005416013300030053PalsaVISAQAAPAAGAKTRGPGAYGGFATRWALLASVAGGLALFAAFPPVNA
Ga0311372_1053334113300030520PalsaVISAQAAPAGAKTRGPATFGGFATRWALLLSVAGGLALFAAFPPVDAWPLAVAGPGIL
Ga0311356_1030742123300030617PalsaVISAQAVTAAGAGTDRAAGSGGFRTRWALLISVAGGLALFAAFPP
Ga0302180_10006143143300031028PalsaVISAQAAPAADAKTRGQAAFGGFATRWALLLSVAGGLALFAAFPPVDAWPLAVA
Ga0302324_10332977313300031236PalsaVISAQAAPVGAKTRGPGAFGGFATRWALLLSLAGGLALFAAFPPV
Ga0318534_1039037113300031544SoilVISQAVTASGARTGRAGASGGFRMRWALLLGVAGGLAVFASFPPVDAWPLAL
Ga0318571_1032167823300031549SoilVSQVSAQAVPASGATKSRAGAFPGFGLRWALLISVAGGAAVYASFPPLDAWPLAAL
Ga0318542_1035909623300031668SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYA
Ga0318561_1050736623300031679SoilVSQVSAQAVPASGATKSRAGAFPGFGLRWALLISVAGGAAVYASF
Ga0318574_1044782223300031680SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALY
Ga0318572_1017057823300031681SoilVSQVSAQAVPASGATKSRAGAFPGFGLRWALLISVAGGAAVYASFPPLDAWPLAALG
Ga0318560_1073231813300031682SoilVISAQAVPASGARTGRAGAFGGFRMRWALLLSVAGGLAVFA
Ga0307476_1031836323300031715Hardwood Forest SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALLASFPPVDAWPLAVLGPA
Ga0307474_1146264513300031718Hardwood Forest SoilVISAQAAAASGARTGQVGAFGGFRTRWALLLSAAG
Ga0318492_1059799023300031748SoilVISAQAGLARLISGGARTGRAGAFGGFRTRWALLLSVAGGLAVFASFPPLDVWPLA
Ga0318498_1007454613300031778SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGGLALYASFPPVD
Ga0318566_1022398723300031779SoilVSQVSAQAVPASGATKSRAGAFPGFGLRWALLISVAGGAAVYASFPPLDA
Ga0318557_1005718333300031795SoilVISAQAVPASGARTGRNGAFGGFRTRWALLLSAAGGLAVYAAFPPLDLWPLAV
Ga0318565_1045479723300031799SoilVISAQAAAASGARTGRAGDFAGFRTRWALLISVAGGLALYASFPPTDAWPLAVLGPA
Ga0318567_1057251013300031821SoilVIAAQAVGASGARTGRAGAFGGVRTRWALLLSGAGGLAVFASFPPLG
Ga0306919_1045933923300031879SoilVSQVSAQAVPASGATKSRAGAFPGFGLRWALLISVAGGAAVY
Ga0318551_1054914823300031896SoilVISAEAVPASGARTGRAGAFGGFRTRWALLLSVAGGLAM
Ga0307479_1075650313300031962Hardwood Forest SoilVISAQAAAAAGARTGPAGTFGGFRTRWALLLSLAGGLAVFA
Ga0318556_1040044613300032043SoilVISAEAVPASGARTGRAGAFGGFRTRWALLLSVAGGLAMFASNPPLDAWPLAV
Ga0306924_1129029923300032076SoilVISAEAVPASGARTGRAGAFGGFRTRWALLLSLAGGLAMFASNPPLDAWPLAVLGP
Ga0307471_10092159323300032180Hardwood Forest SoilVISAQAAAASGARTSRAGDFGGFRTRWALLISVAGGLALYA
Ga0335078_1239897713300032805SoilVISARAAAASGARTGRAGDFAGFRTHWALLISVAGGLALYASFPPIDAWPLAVLGP
Ga0335080_1074245113300032828SoilVISAQAAAASGARTGRAGDFGGFRTRWALLISVAGG
Ga0335074_1105985823300032895SoilVISAQAAQQEGVGARAGFGGLGTWWALLLSVAGGAATFASFPPVDAWPLAAAGPALLVVALAG
Ga0335083_1081484013300032954SoilVISAQAASDADARTGGVRSFAGFKTRWALLISVAGGLALYASFPPVDAWPLAVAGPGLLVVALAGRS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.