| Basic Information | |
|---|---|
| Family ID | F077586 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LLLRAMLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKQ |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.74 % |
| % of genes near scaffold ends (potentially truncated) | 94.87 % |
| % of genes from short scaffolds (< 2000 bps) | 86.32 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.291 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.641 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.496 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.427 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13537 | GATase_7 | 90.60 |
| PF13522 | GATase_6 | 2.56 |
| PF10102 | DUF2341 | 0.85 |
| PF00953 | Glycos_transf_4 | 0.85 |
| PF00232 | Glyco_hydro_1 | 0.85 |
| PF01841 | Transglut_core | 0.85 |
| PF04932 | Wzy_C | 0.85 |
| PF02543 | Carbam_trans_N | 0.85 |
| PF16861 | Carbam_trans_C | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.85 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.85 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.29 % |
| Unclassified | root | N/A | 1.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104483323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10111278 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300001593|JGI12635J15846_10422934 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300002562|JGI25382J37095_10138171 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300002912|JGI25386J43895_10051541 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300002914|JGI25617J43924_10055736 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300002914|JGI25617J43924_10174541 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300003223|JGI26343J46809_1009406 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10248175 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300004100|Ga0058904_1329699 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005180|Ga0066685_10420897 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300005343|Ga0070687_101134179 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005468|Ga0070707_101830383 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005552|Ga0066701_10081112 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300005555|Ga0066692_10654717 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005557|Ga0066704_10508682 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005569|Ga0066705_10746886 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005712|Ga0070764_10407774 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300006175|Ga0070712_101169230 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006606|Ga0074062_10410656 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006797|Ga0066659_10825088 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300007255|Ga0099791_10110820 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300007258|Ga0099793_10309309 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300007788|Ga0099795_10124937 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300009012|Ga0066710_100109186 | All Organisms → cellular organisms → Bacteria | 3730 | Open in IMG/M |
| 3300009038|Ga0099829_10914217 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009088|Ga0099830_10753256 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300009089|Ga0099828_10017166 | All Organisms → cellular organisms → Bacteria | 5563 | Open in IMG/M |
| 3300009698|Ga0116216_10423658 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300009792|Ga0126374_10128820 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300010322|Ga0134084_10139656 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300010362|Ga0126377_10121390 | All Organisms → cellular organisms → Bacteria | 2415 | Open in IMG/M |
| 3300010371|Ga0134125_12526299 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010379|Ga0136449_103361505 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300011120|Ga0150983_10695633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300011271|Ga0137393_10618165 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300012189|Ga0137388_10044700 | All Organisms → cellular organisms → Bacteria | 3553 | Open in IMG/M |
| 3300012189|Ga0137388_10284501 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300012189|Ga0137388_11940350 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012199|Ga0137383_10209395 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300012359|Ga0137385_10250972 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300012359|Ga0137385_10983168 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012361|Ga0137360_11548747 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012683|Ga0137398_10044856 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300012685|Ga0137397_10398991 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300012918|Ga0137396_11043690 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012923|Ga0137359_10457912 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300015052|Ga0137411_1049443 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300015053|Ga0137405_1025906 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300015054|Ga0137420_1124898 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300015245|Ga0137409_11024691 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300015358|Ga0134089_10284087 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300017942|Ga0187808_10210732 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300017966|Ga0187776_11541885 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300018058|Ga0187766_10854353 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300018482|Ga0066669_10337214 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300020018|Ga0193721_1097815 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300020579|Ga0210407_10004960 | All Organisms → cellular organisms → Bacteria | 10365 | Open in IMG/M |
| 3300020580|Ga0210403_10291913 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300020581|Ga0210399_10049760 | All Organisms → cellular organisms → Bacteria | 3366 | Open in IMG/M |
| 3300021088|Ga0210404_10219718 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300021170|Ga0210400_11227332 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021401|Ga0210393_10240262 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300021401|Ga0210393_11112638 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021405|Ga0210387_10376447 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300021433|Ga0210391_10117124 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300021478|Ga0210402_10603402 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300021559|Ga0210409_10005417 | All Organisms → cellular organisms → Bacteria | 13418 | Open in IMG/M |
| 3300025906|Ga0207699_11085174 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300025910|Ga0207684_10077506 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
| 3300025915|Ga0207693_10831905 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300025916|Ga0207663_10600041 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300025933|Ga0207706_10322697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300026298|Ga0209236_1198363 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300026328|Ga0209802_1214471 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300026330|Ga0209473_1111579 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300026335|Ga0209804_1130748 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300026359|Ga0257163_1019457 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300026490|Ga0257153_1098224 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300026523|Ga0209808_1179415 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300026548|Ga0209161_10165025 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300026551|Ga0209648_10178925 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300026551|Ga0209648_10679728 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300026552|Ga0209577_10656294 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300026557|Ga0179587_10065767 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
| 3300026557|Ga0179587_11023157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300027174|Ga0207948_1027042 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300027655|Ga0209388_1042652 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300027846|Ga0209180_10094992 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300027846|Ga0209180_10404766 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300027853|Ga0209274_10717726 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027875|Ga0209283_10015273 | All Organisms → cellular organisms → Bacteria | 4624 | Open in IMG/M |
| 3300027879|Ga0209169_10535423 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300027882|Ga0209590_10049535 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300027882|Ga0209590_10607253 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300028906|Ga0308309_11313161 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300030991|Ga0073994_12205224 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031231|Ga0170824_100306124 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031708|Ga0310686_113320928 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031715|Ga0307476_10629526 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300031718|Ga0307474_10625047 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300031820|Ga0307473_11433077 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031823|Ga0307478_11519686 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031823|Ga0307478_11732675 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032035|Ga0310911_10450753 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300032043|Ga0318556_10385128 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300032051|Ga0318532_10149474 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300032180|Ga0307471_100432960 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300032205|Ga0307472_100006932 | All Organisms → cellular organisms → Bacteria | 5379 | Open in IMG/M |
| 3300032205|Ga0307472_101282235 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300032261|Ga0306920_100945297 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300032756|Ga0315742_13277873 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032805|Ga0335078_10528621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1507 | Open in IMG/M |
| 3300033547|Ga0316212_1011711 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300034163|Ga0370515_0187504 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.71% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1044833232 | 3300000364 | Soil | FLLMREVLAWYADRGMRIPRFHLREHFVRAGAVFLKTPEIKP* |
| AF_2010_repII_A001DRAFT_101112781 | 3300000793 | Forest Soil | LLGWYADSRLRIPRFHFREHIIRAGSAFFSTPEIKE* |
| JGI12635J15846_104229341 | 3300001593 | Forest Soil | ALAVSAAMALLLLLLRSFLAWYADYRLRVPRFHLREHFLRAGAAFFSTPEIK* |
| JGI25382J37095_101381711 | 3300002562 | Grasslands Soil | FFLLMRTLLGWYADRRLRIPRFHLREHTVRAGAAFLSAPEIKE* |
| JGI25386J43895_100515411 | 3300002912 | Grasslands Soil | LVLAAAATLFFSMLRFVLAWYADSRLRIPRFHLREHMIRAGVAFFSTPEIKQ* |
| JGI25617J43924_100557362 | 3300002914 | Grasslands Soil | SXXAAIFFLLVRAVLAWYADRLLRIPRFHLREHAIRAGTAFFSAPEIKQ* |
| JGI25617J43924_101745412 | 3300002914 | Grasslands Soil | TLFFLMLRTLLAWYADNRLSIPRFHLRKRAIRGGAAFFSAPGIKQ* |
| JGI25387J43893_10387481 | 3300002915 | Grasslands Soil | FASFSLFFVSLVLRVLLGWYADYRLKIPRFRLREHVLRAGAAFFSAPEIK* |
| JGI26343J46809_10094062 | 3300003223 | Bog Forest Soil | LLLRAMLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKQ* |
| JGIcombinedJ51221_102481751 | 3300003505 | Forest Soil | AGLATLFFLVLRALLAWYADKGLRIPRFHLREHVARAGAAFISTPEIKE* |
| Ga0058904_13296991 | 3300004100 | Forest Soil | VLSAGATIFFLLLRVLLAWYADSRLRMPRFRLRANAVRAGAAFFSSPEIKE* |
| Ga0066685_104208971 | 3300005180 | Soil | ALFFLMLRATLAWYADRRLRIPRFQLRKNALRAGSAFVSTPEIKE* |
| Ga0070687_1011341791 | 3300005343 | Switchgrass Rhizosphere | SFFALVVAAICVLFFLALRFLLAWYADCRLRIHRFHLREHFLRAGAAFFSTPEIK* |
| Ga0070707_1018303831 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRFVLAWYADSRLRIPRFHLREHMIRAGVAFFSTPEIKQ* |
| Ga0066701_100811122 | 3300005552 | Soil | LLRAGLAWYADHRLRIPRFHLREHAIRAGATFFSAPEIKQ* |
| Ga0066692_106547172 | 3300005555 | Soil | AWYADHRLRIPRFHFREHAIRAGATFFSAPEIKQ* |
| Ga0066704_105086821 | 3300005557 | Soil | MLRATLAWYADRRLRIPRFQLRKNALRAGSAFVSTPEIKE* |
| Ga0066705_107468861 | 3300005569 | Soil | VLSAVAAMFFLLLRAGLAWYADHRLRIPRFHLREHAIRAGATFFSAPEIKQ* |
| Ga0070764_104077742 | 3300005712 | Soil | RAVLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIK* |
| Ga0070712_1011692301 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAICVLFFLALRLLLAWYADYRLRIHRFHLREHFLRAGAAFFSTPEIK* |
| Ga0074062_104106561 | 3300006606 | Soil | RAMLARYADSRLRIPRFHLREHAVRAGAAFFSAPEIKQ* |
| Ga0066659_108250881 | 3300006797 | Soil | YLVLSAVAAIFFLLVRAILAWYADRLLRIPRFHLREHAARAGAAFFSAPEIKQ* |
| Ga0099791_101108201 | 3300007255 | Vadose Zone Soil | CAAATMFFLLLRALLAWYADSRLRIPRFRLRANTMRAGAAFLSAPEVKQ* |
| Ga0099793_103093091 | 3300007258 | Vadose Zone Soil | ALLAWYADSRLRIPRFRLRKHAVRAGAAFFSAPEIKQ* |
| Ga0099795_101249373 | 3300007788 | Vadose Zone Soil | AWYADSRLRMPRFRLRANAIRAGAAFFSSPEIKE* |
| Ga0066710_1001091861 | 3300009012 | Grasslands Soil | ATLFFLLLRALLAWYADSRLRFPRFHLRKHAVRAGAAFFSAPEIKQ |
| Ga0099829_109142172 | 3300009038 | Vadose Zone Soil | LFFLLLRAGLAWYADHRLRVPRFHLRDNAVRAGTAFFSAPEIKQ* |
| Ga0099830_107532562 | 3300009088 | Vadose Zone Soil | LRFVLAWYADSRLRIPRFHLREHMIRAGVAFFSTPEIKQ* |
| Ga0099828_100171665 | 3300009089 | Vadose Zone Soil | YLALSAAAAFFFLLLRTLLGWYADHRISIPRFHLRRHAARAGSAFFSTPEIRK* |
| Ga0116216_104236582 | 3300009698 | Peatlands Soil | AVAAFFFLLMRAMLAWYADSRLRIPRFHLREHAVRAGSAFFSTPEIKQ* |
| Ga0126374_101288203 | 3300009792 | Tropical Forest Soil | LLLRQLLGWYADRRLRIPRFHFREHAVRAGTAFFSTPEIKE* |
| Ga0134084_101396561 | 3300010322 | Grasslands Soil | ALGWYADSMLRIPRFHFRENLIRAGAAFFSTPEIKE* |
| Ga0126377_101213903 | 3300010362 | Tropical Forest Soil | LFVREMLAWYADRRLMMPRFHLRAHFLRAGAAFFGAPEIKQ* |
| Ga0134125_125262991 | 3300010371 | Terrestrial Soil | LVVAAICVLFFLALRFLLAWYADCRLRIHRFHLREHFLRAGAAFFSTPEIK* |
| Ga0136449_1033615051 | 3300010379 | Peatlands Soil | MLFFLLLRAVLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKR* |
| Ga0150983_106956332 | 3300011120 | Forest Soil | VLSVAAALFFLLLRAVLALYADSHLRIPRFHLREHALRAGVAFFSTPEIKQ* |
| Ga0137393_106181652 | 3300011271 | Vadose Zone Soil | LVLSAWATLFFLLLRAGFAWYADRRLRVLRFHVRENVVRAGATFFSAPEIKQ* |
| Ga0137388_100447003 | 3300012189 | Vadose Zone Soil | SAGAFSFFLMMRTLLGWYADRRMRIPRFRLREKVARAGAAFLSAPEIKE* |
| Ga0137388_102845012 | 3300012189 | Vadose Zone Soil | LVLSAAATLFFLLLRVVLAWYADRRLRISRFRLREHAIRAGAAFFSPPEIKQ* |
| Ga0137388_119403502 | 3300012189 | Vadose Zone Soil | FYLVLSAMATLFFLLLRVVLAWYADRRLRIRRFHLREQMWRAGATLFSAPEIKQ* |
| Ga0137383_102093952 | 3300012199 | Vadose Zone Soil | LYLVLSAAAALFFLMLRATLAWYADRRLRIPRFQLRKNALRAGSAFVSTPEIKE* |
| Ga0137385_102509721 | 3300012359 | Vadose Zone Soil | AALFFLMLRATLAWYADRRLRIPRFQLRKNALRAGSAFVSTPEIKE* |
| Ga0137385_109831681 | 3300012359 | Vadose Zone Soil | ATAFLFFLLVRQILAWYADSMLRIPRFHFREHMIRASAAFFSTPEIKE* |
| Ga0137360_115487472 | 3300012361 | Vadose Zone Soil | LLVRAVLAWYADRLLRIPRFHLREHAIRAGAAFFSAPEIKQ* |
| Ga0137398_100448561 | 3300012683 | Vadose Zone Soil | RVLLAWYADSRLRIPRFRLRANAVRAGAAFLSSPEIKQ* |
| Ga0137397_103989911 | 3300012685 | Vadose Zone Soil | TLFFLLLRAVLARYADSRLRIPRFHLRRHFLRAGAAFFSAPEIKQ* |
| Ga0137396_110436902 | 3300012918 | Vadose Zone Soil | FLLSRAALAWYADHRLRIPRFHLREHAIRAGATFFSAPEIKQ* |
| Ga0137359_104579122 | 3300012923 | Vadose Zone Soil | AALFFLMLRATLAWYADRRLRIPRFQLRKNALRAGSAFVSPPEIKE* |
| Ga0137411_10494432 | 3300015052 | Vadose Zone Soil | ASAGALVFFLLMRTLLGWYADRRLRIPRFHLRENAVRAGAAFLSAPEIKE* |
| Ga0137405_10259062 | 3300015053 | Vadose Zone Soil | SAGATLFFLLLRAALAWYADRRLRVPRFHLRENAVRAGAAFFSAPEIKQ* |
| Ga0137420_11248981 | 3300015054 | Vadose Zone Soil | YADSRFSRLRIPRFRLREHAIRAGAAFFSPPEIKE* |
| Ga0137409_110246911 | 3300015245 | Vadose Zone Soil | LVLSGSATLFFLLLRAVLARYADSRLRIPRFHLRRHFLRAGAAFFSAPEIKQ* |
| Ga0134089_102840872 | 3300015358 | Grasslands Soil | LLLLRQRLAWYADRRLRIARFHFREHMIRAGTAFFSTPEIKE* |
| Ga0187808_102107321 | 3300017942 | Freshwater Sediment | LVLSATATILFLVARVMLGWYADQRLKIPLFHLREHMIRAGTAFVSTPEIKQ |
| Ga0187776_115418852 | 3300017966 | Tropical Peatland | LLLREVLAWYADSRLRIPRFHLREHMIRAGAAFFSTPEIKQ |
| Ga0187766_108543532 | 3300018058 | Tropical Peatland | FVLAAGAAFFFLLLRELLAWYADRRLRIPRFHLRDHMIRAGAAFFSTPEIKE |
| Ga0066669_103372142 | 3300018482 | Grasslands Soil | LVVAAICVFFFLALRFLLAWYADYRLRIYRFHLREHFLRAGAAFFSTPEIK |
| Ga0193721_10978152 | 3300020018 | Soil | RVLLAWYADRRLRIQRFHLRQNALRAGAAFFSAPEIKE |
| Ga0210407_100049601 | 3300020579 | Soil | FVLVVSASATMVLLLLRVVLGWYADNQLGVARFRFREHVFRAGAAFFTTPEIKQ |
| Ga0210403_102919132 | 3300020580 | Soil | LVMSIAAMLAFLLLRAVLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKQ |
| Ga0210399_100497603 | 3300020581 | Soil | VLSAAATLLFLLMRVLLAWYADSRLRIPRFRLRQNAVRAGAAFFSAPEIKE |
| Ga0210404_102197181 | 3300021088 | Soil | LLTSGMATLFFLLLRVVLAWYADSRLRIPRFHLREHALRAGAAFFSAPEIKQ |
| Ga0210400_112273322 | 3300021170 | Soil | TLFLMLLRAFLGWYADQRLKIPRFHLREHFIRAGAAFLSTPEIER |
| Ga0210393_102402621 | 3300021401 | Soil | ALTLFLMLLRAFLGWYADQRLKIPRFHLREHFIRAGAAFLSTPEIER |
| Ga0210393_111126381 | 3300021401 | Soil | SFLLLRAVLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKQ |
| Ga0210387_103764471 | 3300021405 | Soil | LLLRAVLAWYADSRLRVPRFHLREHALRAGVAFFSTPEIKQ |
| Ga0210391_101171241 | 3300021433 | Soil | VTAMLFFLLLRAVLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKR |
| Ga0210402_106034022 | 3300021478 | Soil | VLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKQ |
| Ga0210409_100054171 | 3300021559 | Soil | LVISAIAALFFLLMRALLAWYADSRLRIPRFHLREHTVRAGSAFFSTPEIKE |
| Ga0207699_110851741 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | FFFVLRFLMAWYADNRLRIPRFHFRRHALRAGASFFYTPEIEE |
| Ga0207684_100775063 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LSVTAMLVFLLLRVVLAWYADNRLQISRFHLRKHTMRAGAAFFSTPEIKQ |
| Ga0207693_108319052 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAICVLFFLALRLLLAWYADYRLRIHRFHLREHFLRAGAAFFSTPEIK |
| Ga0207663_106000411 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LRFLLAWYADYRLRIHRFHLREHFLRAGAAFFSTPEIK |
| Ga0207706_103226971 | 3300025933 | Corn Rhizosphere | LRFLLAWYADCRLRIHRFHLREHFLRAGAAFFSTPEIK |
| Ga0209236_11983632 | 3300026298 | Grasslands Soil | LLLRTLLGWYADHRISIPRFHLRRHAARAGSAFFSTPEIRQ |
| Ga0209802_12144711 | 3300026328 | Soil | TLAWYADRRLRIPRFQLRKNALRAGSAFVSTPEIKE |
| Ga0209473_11115792 | 3300026330 | Soil | YLVLTVSATLFFLLLRALLAWYADSRLRIPRFHLRKHAVRAGAAFFSAPEIKQ |
| Ga0209804_11307482 | 3300026335 | Soil | VFSAVAAMFFLLLRAGLAWYADHRLRIPRFRLREHAIRAGATFFSAPEIKQ |
| Ga0257163_10194571 | 3300026359 | Soil | LRVLLAWYADSRLRIPRFRLRANAVRAGAAFLSSPEIKQ |
| Ga0257153_10982241 | 3300026490 | Soil | FLLLLRVVLAWYADNRLQIPRFHLREHALRAGAAFFSTPEIKQ |
| Ga0209808_11794152 | 3300026523 | Soil | AVAAMFFLLLRAGLAWYADHRLRIPRFHLREHAIRAGATFFSAPEIKQ |
| Ga0209161_101650251 | 3300026548 | Soil | SFFLLRQLLAWYADRRLRIPRFHVRRHLLRAGATFFTSPEIK |
| Ga0209648_101789252 | 3300026551 | Grasslands Soil | LLRAMLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKQ |
| Ga0209648_106797282 | 3300026551 | Grasslands Soil | LRVLLALYADSHLRIPRFHFRANASRAGAAFFSAPEIKQ |
| Ga0209577_106562942 | 3300026552 | Soil | LLLLLRQRLAWYADRRLRIARFHFREHMIRAGTAFFSTPEIKE |
| Ga0179587_100657672 | 3300026557 | Vadose Zone Soil | FLSLRVLLAWYGDSRLRIPRFRLRENSIRAGSAFLSSPEIKE |
| Ga0179587_110231571 | 3300026557 | Vadose Zone Soil | SLFFLLMREVLAWYADRGMRIPRFHLREHFVRAGAVFLKTPEIKP |
| Ga0207948_10270421 | 3300027174 | Forest Soil | LVLRALLAWYADKGLRIPRFHLREHVARAGAAFISTPEIKE |
| Ga0209388_10426521 | 3300027655 | Vadose Zone Soil | SLAAIFFLLVRAVLAWYADRLLRIPRFHLREHAIRAGAAFFSAPEIKQ |
| Ga0209180_100949922 | 3300027846 | Vadose Zone Soil | CAWYADRRLRIPRFHLRENAIRAGAAFFSAPEIKE |
| Ga0209180_104047661 | 3300027846 | Vadose Zone Soil | ALLAWYADSRLRIPRFRLRANTMRAGAAFLSAPEVKQ |
| Ga0209274_107177262 | 3300027853 | Soil | LMLRAGLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKQ |
| Ga0209283_100152734 | 3300027875 | Vadose Zone Soil | ATLFFLLLRILLAWYADSRLRIPRFRLRENASRAGAAFFSAPEIKE |
| Ga0209169_105354231 | 3300027879 | Soil | VLSVASMLFLLLLRAMLAWYADNRLRVPRFHLREHALRAGVAFFSTPEMK |
| Ga0209590_100495351 | 3300027882 | Vadose Zone Soil | RTLLGWYADHRISIPRFHLRRHAARAGSAFFSTPEIRK |
| Ga0209590_106072532 | 3300027882 | Vadose Zone Soil | LVLSAAAALFFLMLRATLAWYADRRLRIPRFQLRKNALRAGSAFVSTPEIKE |
| Ga0308309_113131611 | 3300028906 | Soil | SVAAMLSFLLLRAVLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIK |
| Ga0073994_122052242 | 3300030991 | Soil | FLLLRVLLAWYADSRLRIPRFRLRQNAVRAGAAFFSAPEIKE |
| Ga0170824_1003061241 | 3300031231 | Forest Soil | RVFFFLALRFLLGWYADYRLRIHRFHLREHFLRAGTAFFSTPEIK |
| Ga0310686_1133209282 | 3300031708 | Soil | MLFFLLLRAVLAWYADSRLRIPRLHLREHALRAGVAFFSIPEIK |
| Ga0307476_106295261 | 3300031715 | Hardwood Forest Soil | LVLSMASMLFLLLLRAVLAWYADSSLRIPRFHLREHALRAGVAFFSTPGIKQ |
| Ga0307474_106250471 | 3300031718 | Hardwood Forest Soil | LFLRAALAWYADRLLRVPRFHLREHALRAGAAFFSAPEIKQ |
| Ga0307473_102127761 | 3300031820 | Hardwood Forest Soil | SLLAWYADHQLRVPRFHLRAHFLRASAAFFGAPEIK |
| Ga0307473_114330772 | 3300031820 | Hardwood Forest Soil | CLLILRIILGWNADHRLRIPRFHFFEHARRAGAAFFSTPEIK |
| Ga0307478_115196861 | 3300031823 | Hardwood Forest Soil | AALAWYADRRLKIPRFHLWAKTVRAGAAFFSTPEIKQ |
| Ga0307478_117326751 | 3300031823 | Hardwood Forest Soil | SAASTLVLLLLRMVLGWYADKRLKVPRFRFREHVLRAGAAFFSTPEIKQ |
| Ga0310911_104507532 | 3300032035 | Soil | LFLLVRQLLGWYADSRLRIPRFHFREHAVRAGTAFFSTPEIKE |
| Ga0318556_103851282 | 3300032043 | Soil | QLLGWYADSRLRIPRFHFREHAVRAGTAFFSTPEIKE |
| Ga0318532_101494742 | 3300032051 | Soil | LGWYADSRLRIRRFHLRDRVLRAGSAFLTAPEIKE |
| Ga0307471_1004329601 | 3300032180 | Hardwood Forest Soil | LLAWYADYRLRIHRFHLREHFLRAGAAFFSTPEIK |
| Ga0307472_1000069325 | 3300032205 | Hardwood Forest Soil | MLTRMLLGWYADRRLRIPRFHLREHAARAGAAFLSAPEIKE |
| Ga0307472_1012822352 | 3300032205 | Hardwood Forest Soil | FFVLRSLLAWYADHQLRVPRFHLRAHFLRASAAFFGAPEIK |
| Ga0306920_1009452971 | 3300032261 | Soil | MILRVMLAWYADSRLRIPRFHLREHMIRAGEAFFSTPEIKQ |
| Ga0315742_132778732 | 3300032756 | Forest Soil | LVLSVAAMLSFLLLRAVLAWYADSRLRIPRFHLREHALRAGVAFFSTPEIKQ |
| Ga0335078_105286213 | 3300032805 | Soil | LVLRVVLAWYADSRLRIPRFHLREHVVRAGVAFFFTPEIKE |
| Ga0316212_10117111 | 3300033547 | Roots | AYLGWYADQRLKIPRFHFREHFIRAAATFFSTPEIER |
| Ga0370515_0187504_1_120 | 3300034163 | Untreated Peat Soil | LRAYLGWYADQRLKIPRFHFREHFIRAAATFFSTPEIER |
| ⦗Top⦘ |