| Basic Information | |
|---|---|
| Family ID | F077582 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MWTSAGQGEGSPIAFYERYGFEQTGEIVFDDEVLLRLELR |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.34 % |
| % of genes near scaffold ends (potentially truncated) | 73.50 % |
| % of genes from short scaffolds (< 2000 bps) | 88.03 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.453 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.367 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.915 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.299 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.82% β-sheet: 25.00% Coil/Unstructured: 66.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| d.108.1.0: automated matches | d2vi7a_ | 2vi7 | 0.73325 |
| d.108.1.0: automated matches | d6e1xa_ | 6e1x | 0.73188 |
| d.108.1.1: N-acetyl transferase, NAT | d1mk4a1 | 1mk4 | 0.72957 |
| d.108.1.1: N-acetyl transferase, NAT | d1u6ma1 | 1u6m | 0.72931 |
| d.108.1.1: N-acetyl transferase, NAT | d1cjwa_ | 1cjw | 0.72865 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01939 | NucS | 11.97 |
| PF10604 | Polyketide_cyc2 | 4.27 |
| PF07883 | Cupin_2 | 3.42 |
| PF00583 | Acetyltransf_1 | 3.42 |
| PF06224 | HTH_42 | 2.56 |
| PF12680 | SnoaL_2 | 2.56 |
| PF01243 | Putative_PNPOx | 2.56 |
| PF01872 | RibD_C | 2.56 |
| PF08818 | DUF1801 | 1.71 |
| PF00768 | Peptidase_S11 | 1.71 |
| PF05988 | DUF899 | 1.71 |
| PF02080 | TrkA_C | 1.71 |
| PF03062 | MBOAT | 1.71 |
| PF08281 | Sigma70_r4_2 | 1.71 |
| PF00102 | Y_phosphatase | 0.85 |
| PF01494 | FAD_binding_3 | 0.85 |
| PF05147 | LANC_like | 0.85 |
| PF03992 | ABM | 0.85 |
| PF01408 | GFO_IDH_MocA | 0.85 |
| PF01808 | AICARFT_IMPCHas | 0.85 |
| PF00296 | Bac_luciferase | 0.85 |
| PF01012 | ETF | 0.85 |
| PF08529 | NusA_N | 0.85 |
| PF00016 | RuBisCO_large | 0.85 |
| PF00753 | Lactamase_B | 0.85 |
| PF12697 | Abhydrolase_6 | 0.85 |
| PF02254 | TrkA_N | 0.85 |
| PF03073 | TspO_MBR | 0.85 |
| PF06445 | GyrI-like | 0.85 |
| PF13302 | Acetyltransf_3 | 0.85 |
| PF04107 | GCS2 | 0.85 |
| PF13565 | HTH_32 | 0.85 |
| PF01738 | DLH | 0.85 |
| PF01636 | APH | 0.85 |
| PF00903 | Glyoxalase | 0.85 |
| PF03167 | UDG | 0.85 |
| PF09371 | Tex_N | 0.85 |
| PF00491 | Arginase | 0.85 |
| PF04075 | F420H2_quin_red | 0.85 |
| PF12802 | MarR_2 | 0.85 |
| PF03551 | PadR | 0.85 |
| PF14437 | MafB19-deam | 0.85 |
| PF00072 | Response_reg | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 11.97 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.56 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.56 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 2.56 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.71 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.71 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.71 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.71 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.71 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.71 |
| COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.85 |
| COG5599 | Protein tyrosine phosphatase | Signal transduction mechanisms [T] | 0.85 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG3476 | Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog) | Signal transduction mechanisms [T] | 0.85 |
| COG2453 | Protein-tyrosine phosphatase | Signal transduction mechanisms [T] | 0.85 |
| COG1850 | Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein | Carbohydrate transport and metabolism [G] | 0.85 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.85 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.85 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.85 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.85 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.85 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.85 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.85 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.85 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.85 |
| COG0138 | AICAR transformylase/IMP cyclohydrolase PurH | Nucleotide transport and metabolism [F] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.45 % |
| Unclassified | root | N/A | 8.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11889240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. W007 | 539 | Open in IMG/M |
| 3300000891|JGI10214J12806_12066684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300000956|JGI10216J12902_106869261 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300000956|JGI10216J12902_117515969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 642 | Open in IMG/M |
| 3300004114|Ga0062593_100341531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1303 | Open in IMG/M |
| 3300004114|Ga0062593_101001110 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300004114|Ga0062593_101166916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
| 3300004479|Ga0062595_101097353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300004480|Ga0062592_101704259 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005169|Ga0066810_10015522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1200 | Open in IMG/M |
| 3300005335|Ga0070666_10420216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 963 | Open in IMG/M |
| 3300005338|Ga0068868_100112333 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300005356|Ga0070674_102136410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300005454|Ga0066687_10272481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 951 | Open in IMG/M |
| 3300005530|Ga0070679_101993681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300005547|Ga0070693_100114253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1665 | Open in IMG/M |
| 3300005553|Ga0066695_10797428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300005559|Ga0066700_10509238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
| 3300005718|Ga0068866_11263475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300005886|Ga0075286_1011902 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300005937|Ga0081455_10437704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 897 | Open in IMG/M |
| 3300006175|Ga0070712_101244947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 648 | Open in IMG/M |
| 3300006178|Ga0075367_10040001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2737 | Open in IMG/M |
| 3300006574|Ga0074056_11850940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1500 | Open in IMG/M |
| 3300006580|Ga0074049_12696920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300006581|Ga0074048_12117099 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300006845|Ga0075421_100447600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1544 | Open in IMG/M |
| 3300006845|Ga0075421_100777094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300006871|Ga0075434_101288058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
| 3300007076|Ga0075435_100958528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300009012|Ga0066710_103229667 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300009094|Ga0111539_11379272 | Not Available | 818 | Open in IMG/M |
| 3300010045|Ga0126311_10883893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300010045|Ga0126311_11106291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300010325|Ga0134064_10152117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300010336|Ga0134071_10141588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1165 | Open in IMG/M |
| 3300010371|Ga0134125_10060790 | All Organisms → cellular organisms → Bacteria | 4203 | Open in IMG/M |
| 3300010400|Ga0134122_10150015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1895 | Open in IMG/M |
| 3300010403|Ga0134123_10659419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1016 | Open in IMG/M |
| 3300010403|Ga0134123_10817675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300012043|Ga0136631_10012400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2997 | Open in IMG/M |
| 3300012092|Ga0136621_1094183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
| 3300012201|Ga0137365_10743151 | Not Available | 717 | Open in IMG/M |
| 3300012201|Ga0137365_11013980 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300012208|Ga0137376_11447296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300012355|Ga0137369_10054770 | All Organisms → cellular organisms → Bacteria | 3467 | Open in IMG/M |
| 3300012356|Ga0137371_11100980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300012358|Ga0137368_10670707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 654 | Open in IMG/M |
| 3300012668|Ga0157216_10511749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300012679|Ga0136616_10035586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2432 | Open in IMG/M |
| 3300012684|Ga0136614_11168001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300012897|Ga0157285_10025251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1298 | Open in IMG/M |
| 3300012902|Ga0157291_10122492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300012908|Ga0157286_10158238 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012955|Ga0164298_10518749 | Not Available | 800 | Open in IMG/M |
| 3300012957|Ga0164303_10668672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300012957|Ga0164303_10747646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300012958|Ga0164299_10980650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300012985|Ga0164308_11314342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300012988|Ga0164306_10209992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1372 | Open in IMG/M |
| 3300013102|Ga0157371_10933809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300013307|Ga0157372_10767650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1121 | Open in IMG/M |
| 3300014322|Ga0075355_1153178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
| 3300014326|Ga0157380_11632741 | Not Available | 701 | Open in IMG/M |
| 3300014326|Ga0157380_13484003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300015373|Ga0132257_104093336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300016445|Ga0182038_11584943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora corrugata | 589 | Open in IMG/M |
| 3300017965|Ga0190266_10225953 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300018027|Ga0184605_10381402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300018054|Ga0184621_10183083 | Not Available | 752 | Open in IMG/M |
| 3300018066|Ga0184617_1049699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1062 | Open in IMG/M |
| 3300018079|Ga0184627_10214935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300018429|Ga0190272_11523725 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300018431|Ga0066655_10575220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300018481|Ga0190271_10329088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1601 | Open in IMG/M |
| 3300019890|Ga0193728_1036421 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
| 3300025885|Ga0207653_10280841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300025905|Ga0207685_10099285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1242 | Open in IMG/M |
| 3300025912|Ga0207707_10253490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1528 | Open in IMG/M |
| 3300025913|Ga0207695_10607027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300025915|Ga0207693_10488626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
| 3300025916|Ga0207663_10090167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2032 | Open in IMG/M |
| 3300025926|Ga0207659_10342305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1239 | Open in IMG/M |
| 3300025933|Ga0207706_10359557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1265 | Open in IMG/M |
| 3300025934|Ga0207686_10386436 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300025935|Ga0207709_10237505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1324 | Open in IMG/M |
| 3300025949|Ga0207667_10028175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6102 | Open in IMG/M |
| 3300025972|Ga0207668_12156315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 501 | Open in IMG/M |
| 3300026023|Ga0207677_12171253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300026319|Ga0209647_1128582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1138 | Open in IMG/M |
| 3300027638|Ga0208612_1000062 | All Organisms → cellular organisms → Bacteria | 77155 | Open in IMG/M |
| 3300027840|Ga0209683_10025105 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300027917|Ga0209536_101800616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 738 | Open in IMG/M |
| 3300028563|Ga0265319_1068198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1143 | Open in IMG/M |
| 3300028711|Ga0307293_10008353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2834 | Open in IMG/M |
| 3300028720|Ga0307317_10129533 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300028722|Ga0307319_10090110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
| 3300028722|Ga0307319_10107669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300028771|Ga0307320_10041741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1684 | Open in IMG/M |
| 3300028784|Ga0307282_10247741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300028790|Ga0307283_10047574 | Not Available | 1013 | Open in IMG/M |
| 3300028793|Ga0307299_10314118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 588 | Open in IMG/M |
| 3300028802|Ga0307503_10545453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300028807|Ga0307305_10238457 | Not Available | 832 | Open in IMG/M |
| 3300030006|Ga0299907_10525528 | Not Available | 932 | Open in IMG/M |
| 3300031093|Ga0308197_10118133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300031720|Ga0307469_11465754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300031781|Ga0318547_10395715 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300031846|Ga0318512_10739545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora corrugata | 505 | Open in IMG/M |
| 3300031938|Ga0308175_102982830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300031939|Ga0308174_11167655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
| 3300032074|Ga0308173_10749180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 896 | Open in IMG/M |
| 3300032770|Ga0335085_10121949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3324 | Open in IMG/M |
| 3300033758|Ga0314868_033699 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300034090|Ga0326723_0207189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300034151|Ga0364935_0309615 | Not Available | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.27% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.85% |
| Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.85% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027638 | Polar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_118892402 | 3300000890 | Soil | MWTSVGEGEGSPVTFYERYGFKRTGDFHGNEIMLRLEIS* |
| JGI10214J12806_120666842 | 3300000891 | Soil | RRPEVTIMRTSCGQGEGSPLGFYERYGFEQTGNIVFDDEILLQYRLR* |
| JGI10216J12902_1068692612 | 3300000956 | Soil | EAMWTSAGQGEGSPIPFYERYGFERTGDIVFDDEVLLRLSLTRGET* |
| JGI10216J12902_1175159693 | 3300000956 | Soil | SAGQGEGSPIPFYERYGFEQTGEFEEDEVKLRLTII* |
| Ga0062593_1003415311 | 3300004114 | Soil | EVIWTSAGQGEGSPIPFYERYGFEQTGELEENEVKLRLTII* |
| Ga0062593_1010011102 | 3300004114 | Soil | YFRNRGVGTMWTSAGQGEGSPVTFYERYGFERTGDFHGNETLLRLEIS* |
| Ga0062593_1011669162 | 3300004114 | Soil | SKGLETMWTSAGEGDGSPIPFYERYGFVRQGRTSWGEVMLRLVL* |
| Ga0062595_1010973532 | 3300004479 | Soil | VLSTSAGPGPGSPIPFYERYGFRQTGEIVFDNEVLLQLPLRP* |
| Ga0062592_1017042591 | 3300004480 | Soil | YFRNRGVGTMWTSAGQGAGSPVTFYERYGFERTGDFHGNETLLRLEIS* |
| Ga0066810_100155221 | 3300005169 | Soil | PGVEALWTSAGQGEGSPIAFYERYGFEQTGEIVFDDEVLLRLELR* |
| Ga0070666_104202161 | 3300005335 | Switchgrass Rhizosphere | GVEVIWTSAGQGEGSPIPFYERYGFEQTGELEENEVKLRLTII* |
| Ga0068868_1001123332 | 3300005338 | Miscanthus Rhizosphere | VWTSCGQGDGSPLGFYERYGFRQTGDRVFDDEILLRLGIA* |
| Ga0070674_1021364103 | 3300005356 | Miscanthus Rhizosphere | LMWTSCGEGDGSPLGFYERYGFEQTGDRVFDNEILLRLEIT* |
| Ga0066687_102724811 | 3300005454 | Soil | VEVIWTSAGQGEGSPIPFYERYGFEQTGELEENEVKLRLTII* |
| Ga0070679_1019936812 | 3300005530 | Corn Rhizosphere | GRPGVEILWTSCGEGDGGPLGFYERYGFRQAGERVFDDEILLRLEIA* |
| Ga0070693_1001142534 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RRRPEVKIMRTSCGQGKGSPLGFYEHYGFQQTGEIVFDNEILLQYELR* |
| Ga0066695_107974281 | 3300005553 | Soil | RKRPEVEVMRTSAGQGKGSPIGFYERYGFERTGEIVFDNEVLLQLELR* |
| Ga0066700_105092382 | 3300005559 | Soil | VDVLSTSAGEGEGGPIPFYERYGFVRTGEIVFENEVLLQLRLRGR* |
| Ga0068866_112634751 | 3300005718 | Miscanthus Rhizosphere | GQGTGSPIPFYERYGFVQTGEIVFDGEVLLELKLRVRHP* |
| Ga0068860_1005923111 | 3300005843 | Switchgrass Rhizosphere | ERGNAEMWTTAGEGDGGPIPFYERYGFVRTGDMVFDDEVLLRLDLT* |
| Ga0075286_10119021 | 3300005886 | Rice Paddy Soil | LRGRGGEGDGGPLGFDERTVTQVGARVFDNEILLRVEIT* |
| Ga0081455_104377041 | 3300005937 | Tabebuia Heterophylla Rhizosphere | SAGEGEGGPVTFYERYGFERTGELHGDEILLRVEIS* |
| Ga0070712_1012449473 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VEVIWTSAGQGEGSPIPFYERYGFEQTGEIEDGEVKLRLTIV* |
| Ga0075367_100400011 | 3300006178 | Populus Endosphere | VSTSAGAGDGSPIPFYERYGFVQTGDIVFDDERLLRLEL* |
| Ga0074056_118509404 | 3300006574 | Soil | VIWTSAGEGEGCPIPFYERYGFEQTGELDEDEIKLRLTII* |
| Ga0074049_126969202 | 3300006580 | Soil | ILWVSAGQGEGSPQPFYERYGFVATDRIVEDEVVLRLDLQQEAS* |
| Ga0074048_121170992 | 3300006581 | Soil | VAASPSAGQGEGSPVTFYERCGFKRTGDFHGNEILLRLEIS* |
| Ga0075421_1004476001 | 3300006845 | Populus Rhizosphere | GSPITFYERYGFERTGEVHSDEVHSEVVLRLKLS* |
| Ga0075421_1007770941 | 3300006845 | Populus Rhizosphere | QGEGSPLGFYERYGFEQTGDIVFDDEILLQYKLR* |
| Ga0075434_1012880582 | 3300006871 | Populus Rhizosphere | RRRPEVTIMRTSCGQGEGSPLGFYERYGFEQTGDIVFDDEILLQYKLR* |
| Ga0075435_1009585281 | 3300007076 | Populus Rhizosphere | NREVRTMWTSAEQGEGSPVAFYERYGFKRAGDLHGDEILLRLEIS* |
| Ga0066710_1032296673 | 3300009012 | Grasslands Soil | GQCKRSRLGFYKNYGFEQTDEIVFDNAILLQYKLR |
| Ga0111539_113792721 | 3300009094 | Populus Rhizosphere | MWTSAGQGEGSPVTFYERYGFERTGDFHGDEILLRLQIS* |
| Ga0126311_108838931 | 3300010045 | Serpentine Soil | SAGQGDGSPITFYERYGFERTGEVRYDEVMLRLKLR* |
| Ga0126311_111062911 | 3300010045 | Serpentine Soil | MWTSAGQGEGSPVTFYERYGFKRTGDFHDNEILLRLEIS* |
| Ga0134064_101521172 | 3300010325 | Grasslands Soil | MWTSVGQGEGSPVTFYERYGFKRTGDFHGNEILLRLEIS* |
| Ga0134071_101415883 | 3300010336 | Grasslands Soil | FRNRGVGTMWTSVGQGEGSPVTFYERYGFKRTGDFHGNEILLRLEIS* |
| Ga0134125_100607903 | 3300010371 | Terrestrial Soil | MWTSVRQGDGSAVTFYEQYGFERTGDFHGDEILLRLQIS* |
| Ga0134122_101500151 | 3300010400 | Terrestrial Soil | EGDGGPIPFYERYGFVRTGDMVFDDEVLLRLDLT* |
| Ga0134123_106594191 | 3300010403 | Terrestrial Soil | TAGEGDGGPIPFYERYGFVRTGDMVFDDEVLLRLDLT* |
| Ga0134123_108176751 | 3300010403 | Terrestrial Soil | DILWVSAGQGEGSPQPFYERYGFVATDRIVEDEVVLRLDLQQEAS* |
| Ga0136631_100124001 | 3300012043 | Polar Desert Sand | SAGQGDGSPITFYERYGFEQTGEIVFDNEVLLRLRLS* |
| Ga0136621_10941833 | 3300012092 | Polar Desert Sand | MWTSAGQGEGSPIAFYERYGFEQTGEIVFDDEVLLRLELR* |
| Ga0137365_107431511 | 3300012201 | Vadose Zone Soil | RTSCGQGEGSPLGFYERYGFEQTGEIVFDNEILLHYKLR* |
| Ga0137365_110139802 | 3300012201 | Vadose Zone Soil | GRGRGSPLGFYERYGFEQTGEIVFDNEMLLQYKLR* |
| Ga0137376_114472961 | 3300012208 | Vadose Zone Soil | VLSTSAGQGDGSPITFYERYGFERTGEVVFDEVFLRLKLR* |
| Ga0137369_100547701 | 3300012355 | Vadose Zone Soil | QGKGSPIGFYERYGFERTGDIVFDNEVLLQLKLR* |
| Ga0137371_111009802 | 3300012356 | Vadose Zone Soil | MRTSCGQGDGSPLGFYERYGFEQTGEIVFDSEILLQYKLR* |
| Ga0137368_106707072 | 3300012358 | Vadose Zone Soil | GQGKGSPIGFYERYGFERTGDIVFDNEVLLQLKLR* |
| Ga0157216_105117492 | 3300012668 | Glacier Forefield Soil | GVEVLNTSAGQGDGSPITFYERYGFERTGEVFYDEVLLRLRLR* |
| Ga0136616_100355861 | 3300012679 | Polar Desert Sand | GQGDGSPITFYERYGFEQTGEIVFDNEVLLRLRLS* |
| Ga0136614_111680012 | 3300012684 | Polar Desert Sand | VLWTSAGQGDGSPITFYERYGFEQTGEIVFDNEVLLRLRLS* |
| Ga0157285_100252512 | 3300012897 | Soil | CAGQGEASPIPFYERYGFEQTGDLWGGEVKLRLRIGS* |
| Ga0157291_101224923 | 3300012902 | Soil | AGQGDGSPIPFYERYGFVRTGVVFEDEVLLRLELA* |
| Ga0157286_101582382 | 3300012908 | Soil | PGVEVIWTCAGHGEGSPIPFYERYGFEQTGDLWGGEVKLRLRIGS* |
| Ga0164298_105187492 | 3300012955 | Soil | PEVKIMRTSCGQGEGSPLGFYQHYGFEQTGEIVFDNEILLQYKLR* |
| Ga0164303_106686721 | 3300012957 | Soil | PGVEVIWTSAGQGEGSPIPFYERYGFEQTGELEENEVKLRLTIM* |
| Ga0164303_107476463 | 3300012957 | Soil | MWTSAGEGEGSPIPFYERYGFVRTGDIIFDNEVLLRLDLT* |
| Ga0164299_109806501 | 3300012958 | Soil | EMWTTAGEGAGSPIPFYERYGFVRTGDIVFDDEVLLRLDLA* |
| Ga0164308_113143422 | 3300012985 | Soil | AGRGKGNPIPFYERYGFVQTGEIVFDNEVLLRLDLG* |
| Ga0164306_102099924 | 3300012988 | Soil | GQGDGSPIPFYERYGFEQTGDIQDGEVKLRLTIS* |
| Ga0157371_109338093 | 3300013102 | Corn Rhizosphere | GRPGVEVIWTSAGQGEGSPIPFYERYGFEQTGELEENEVKLRLTII* |
| Ga0157372_107676502 | 3300013307 | Corn Rhizosphere | WTSCGQGDGGPLGFYERYGFRRTGDRVFDDEILLRLGIA* |
| Ga0075355_11531781 | 3300014322 | Natural And Restored Wetlands | SAGQGEGSPVAFYERYGFTRTEDLHGDEIMLRLNIT* |
| Ga0157380_116327412 | 3300014326 | Switchgrass Rhizosphere | VVSTSAGRGEGSPIPFYERYGFRETGEIVFDGEVLLELRL* |
| Ga0157380_134840033 | 3300014326 | Switchgrass Rhizosphere | TSAGQGDGSPLGFYERYGLTQAGEVVFDDEVLLHLTFD* |
| Ga0132257_1040933362 | 3300015373 | Arabidopsis Rhizosphere | MSTSAGQGEGSPIAFYERYGFVLTGQLHGNEVMLRLEIS* |
| Ga0182038_115849432 | 3300016445 | Soil | MWTSAAEGDGSPISFYERYGFERTGDRHGNEVLLRLESS |
| Ga0190266_102259532 | 3300017965 | Soil | ALITSVGEGDGSPIEFYERYGFERTGEVSDGEVFLQLRLP |
| Ga0184605_103814022 | 3300018027 | Groundwater Sediment | VGTMWTSVGQGEGSPVTFYERYGFKRTGDFHGNEILLRLEIS |
| Ga0184621_101830833 | 3300018054 | Groundwater Sediment | CGQGDGSPLGFYERYGFQQTGEIVFDNEILLQYKLR |
| Ga0184617_10496993 | 3300018066 | Groundwater Sediment | VLSTSAAQGDASPITFYERYGFEQTGEIVFDNEILLQLKLR |
| Ga0184627_102149353 | 3300018079 | Groundwater Sediment | STSAGQGDGSPITFYERYGFEQTGEIVFDNEVLLQLKLR |
| Ga0190272_115237252 | 3300018429 | Soil | GVEVLNTSAGQGDGSPVTFYERYGFERTGEVRFDEVMLRLKLR |
| Ga0066655_105752203 | 3300018431 | Grasslands Soil | EVKIMRTSCGQGKGSPLGFYEHYGFEQTGEIVFDKEILLQYKLRERST |
| Ga0190271_103290881 | 3300018481 | Soil | TSAGQGEGSPLGFYERYGFERTGEIRFDEVMLRLKLR |
| Ga0193728_10364215 | 3300019890 | Soil | VLSTSAGQGGEGSPIPFYERYGFERTGDIVFDDDVLLELRLASSG |
| Ga0207653_102808411 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTSCGQGQGSPLGFYEHYGFQQTGEIVFDNEILLQYELR |
| Ga0207685_100992853 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TSVRQGDGSPVTFYEQYGFERTGDFHGDEILLRLQIS |
| Ga0207707_102534904 | 3300025912 | Corn Rhizosphere | CGQGKGSPLGFYEHYGFQQTGEIVFDNEILLQYELR |
| Ga0207695_106070272 | 3300025913 | Corn Rhizosphere | VWTSCGQGDGSPLGFYERYGFRQTGDRVFDDEILLRLGIA |
| Ga0207693_104886263 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RRPGVEVMWTSCGEGNGSPLGFYERYGFQQTGDRVFDDEILLRLEIAD |
| Ga0207663_100901671 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RRPEVKIMRTSCGQGKGSPLGFYEHYGFQQTGEIVFDNEILLQYELR |
| Ga0207659_103423054 | 3300025926 | Miscanthus Rhizosphere | EVIWTSAGQGEGSPIPFYERYGFEQTGELEENEVKLRLTII |
| Ga0207706_103595574 | 3300025933 | Corn Rhizosphere | WTSAGQGDGSPIPFYERYGFVRTGVVFEDEVLLRLELA |
| Ga0207686_103864362 | 3300025934 | Miscanthus Rhizosphere | VELFHAGQGDGSPIVFYERYGFERTGEVSDDEVVLRLRLA |
| Ga0207709_102375054 | 3300025935 | Miscanthus Rhizosphere | SAGQGEGSPIPFYERYGFEQTGELEENEVKLRLTII |
| Ga0207667_100281757 | 3300025949 | Corn Rhizosphere | VIWTSAGQGEGSPIPFYERYGFEQTGELEENEVKLRLTII |
| Ga0207668_121563152 | 3300025972 | Switchgrass Rhizosphere | PGVEVVSTSAGRGEGSPIPFYERYGFRETGEIVFDGEVLLELRL |
| Ga0207677_121712532 | 3300026023 | Miscanthus Rhizosphere | VLSTSAGTGEGSPIPFYERYGFRQTGEIVFDGEVLLELRL |
| Ga0209647_11285823 | 3300026319 | Grasslands Soil | VEVLSTSAGEGEGGPIPFYERYGFVRTGEIVFEDEVLLQFKLRGR |
| Ga0208612_10000626 | 3300027638 | Polar Desert | MWTSAGQGEGSPIAFYERYGFEQTGEIVFDDEVLLRLELR |
| Ga0209683_100251051 | 3300027840 | Wetland Sediment | VLSTSAGQGDGSPIAFYERYGFEQTGAQWYDEVLLRFKLR |
| Ga0209536_1018006161 | 3300027917 | Marine Sediment | CGQGEGSPEGFYRRMGFERTGKIVSHEVVMRLALE |
| Ga0265319_10681983 | 3300028563 | Rhizosphere | TSAGQGDGSPVAFYERYGFERTGQLHGDEILLRLEISPP |
| Ga0307293_100083531 | 3300028711 | Soil | PEVEIMRTSCGQGDGSPLGFYERYGFEQTGEIVFDNEILLQLKLR |
| Ga0307317_101295331 | 3300028720 | Soil | WTSAGQGEGSPLGFYERYGFTQAGEIVFDDEVLLHLTFGYGDPAG |
| Ga0307319_100901103 | 3300028722 | Soil | VEVMRTSCGQGDGSPLGFYERYGFQQTGQIVFNNEILLQLKLR |
| Ga0307319_101076691 | 3300028722 | Soil | VLNTSAGQGDGSPITFYERYGFERTGEVRFDEVLLRLKLR |
| Ga0307320_100417413 | 3300028771 | Soil | EVMRTSAGQGKGSPIGFYERYGFERTGDIVFDSEVLLQLKLR |
| Ga0307282_102477412 | 3300028784 | Soil | MRTSCGQGKGSPLGFYEHYGFEQTGEIVFDNEILLQYKLR |
| Ga0307283_100475741 | 3300028790 | Soil | TSAGQGEGSPIAFYERYGFERTGELHGSEVMLRLEIS |
| Ga0307299_103141182 | 3300028793 | Soil | EVLNTSAGQGDGSPLPFYEHYGFERTGEVRFDEVVLRLKLR |
| Ga0307503_105454532 | 3300028802 | Soil | MSTSAGQGEGSPITFYERYGFTRTGELHGNEIMLRLEID |
| Ga0307305_102384572 | 3300028807 | Soil | IMRTSCGQGDGSPLGFYERYGFEQSGEIVFNNEILLQFKLR |
| Ga0299907_105255281 | 3300030006 | Soil | VAVLSTSAGQGDGSPVTFYERYGFERTGDIVFDDEVLLRLKVR |
| Ga0308197_101181331 | 3300031093 | Soil | GVEVLNTSAGQGDGSPITFYERYGFERTGEVQFDEVMLRLKLR |
| Ga0307469_114657542 | 3300031720 | Hardwood Forest Soil | GTMWTSVGQGEGSPVTFYERYGFEQTGDLHGNEILLRLDIS |
| Ga0318547_103957153 | 3300031781 | Soil | AAEGDGSPISFYERYGFERTGDRHGNEVLLRLEIS |
| Ga0318512_107395451 | 3300031846 | Soil | EVETMWTSAAEGDGSPISFYERYGFERTGDRHGNEVLLRLEIS |
| Ga0308175_1029828301 | 3300031938 | Soil | IWTSAGQGEGSPIPFYERYGFEQTGDLEQGEVKLRLAIA |
| Ga0308174_111676551 | 3300031939 | Soil | RGVALMSTSAGQGDGSPIAFYERYGFVQTGDIVFDGEVLLELPLR |
| Ga0308173_107491802 | 3300032074 | Soil | MSTSAGQGQGSPIAFYERYGFVQTGDIVFDGEVLLELPLR |
| Ga0335085_101219496 | 3300032770 | Soil | GVGTMWTSAVEGSGSPVTFYERYGFKRTGDLHGEEILLRLEIS |
| Ga0314868_033699_19_153 | 3300033758 | Peatland | MWTSAMEGEGSPVAFYERYGFRRTGERHGDEVMLRLAIADIATA |
| Ga0326723_0207189_18_143 | 3300034090 | Peat Soil | VLWTSAGRGEGSPIPFYERYGFEQTGEIVFDGEVLLRLELP |
| Ga0364935_0309615_389_520 | 3300034151 | Sediment | GVEVLNTSASQGDGSPITFYEHYGFERTGEIRFDEVMLRLKLR |
| ⦗Top⦘ |