Basic Information | |
---|---|
Family ID | F077576 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 42 residues |
Representative Sequence | MRIVLLGLAMVLMAAGAPRGAAGAEIKVLTAGAFKQVLLA |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.34 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 94.02 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.487 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.641 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.624 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.043 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 17.65% Coil/Unstructured: 55.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF03652 | RuvX | 22.22 |
PF09834 | DUF2061 | 0.85 |
PF00872 | Transposase_mut | 0.85 |
PF02630 | SCO1-SenC | 0.85 |
PF14378 | PAP2_3 | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG0816 | YqgF/RuvX protein, pre-16S rRNA maturation RNase/Holliday junction resolvase/anti-termination factor | Translation, ribosomal structure and biogenesis [J] | 22.22 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.49 % |
Unclassified | root | N/A | 20.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000580|AF_2010_repII_A01DRAFT_1044801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 682 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1021852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1202 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10134568 | Not Available | 514 | Open in IMG/M |
3300001989|JGI24739J22299_10113453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
3300002073|JGI24745J21846_1025535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 703 | Open in IMG/M |
3300002074|JGI24748J21848_1047978 | Not Available | 554 | Open in IMG/M |
3300002075|JGI24738J21930_10019599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1409 | Open in IMG/M |
3300002076|JGI24749J21850_1006996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1569 | Open in IMG/M |
3300002155|JGI24033J26618_1011501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1056 | Open in IMG/M |
3300002239|JGI24034J26672_10027114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 921 | Open in IMG/M |
3300004267|Ga0066396_10021114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
3300004463|Ga0063356_106394372 | Not Available | 505 | Open in IMG/M |
3300005093|Ga0062594_102272390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
3300005363|Ga0008090_15684208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
3300005437|Ga0070710_10078341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1923 | Open in IMG/M |
3300005563|Ga0068855_101811113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
3300005587|Ga0066654_10694736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
3300005718|Ga0068866_11459657 | Not Available | 502 | Open in IMG/M |
3300006042|Ga0075368_10127010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1058 | Open in IMG/M |
3300006050|Ga0075028_101093218 | Not Available | 500 | Open in IMG/M |
3300006175|Ga0070712_101456035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
3300006178|Ga0075367_11058089 | Not Available | 518 | Open in IMG/M |
3300006178|Ga0075367_11064035 | Not Available | 517 | Open in IMG/M |
3300006572|Ga0074051_10076529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
3300006800|Ga0066660_10253045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1379 | Open in IMG/M |
3300006844|Ga0075428_102677264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. OK412 | 508 | Open in IMG/M |
3300006847|Ga0075431_101260142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
3300006871|Ga0075434_102598353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. OK412 | 507 | Open in IMG/M |
3300006880|Ga0075429_101677717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
3300009089|Ga0099828_11465231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium nitrativorans → Hyphomicrobium nitrativorans NL23 | 602 | Open in IMG/M |
3300009090|Ga0099827_11120531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
3300009100|Ga0075418_11042535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
3300009137|Ga0066709_101497648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
3300010046|Ga0126384_10242316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1453 | Open in IMG/M |
3300010048|Ga0126373_11565973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
3300010048|Ga0126373_11674144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
3300010048|Ga0126373_12986237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
3300010321|Ga0134067_10215542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
3300010360|Ga0126372_10418606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1229 | Open in IMG/M |
3300010366|Ga0126379_11682425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
3300010366|Ga0126379_11841410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
3300010375|Ga0105239_11395934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 808 | Open in IMG/M |
3300010398|Ga0126383_11812646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
3300010400|Ga0134122_11005834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 817 | Open in IMG/M |
3300010401|Ga0134121_10191526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1765 | Open in IMG/M |
3300012201|Ga0137365_10118573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1990 | Open in IMG/M |
3300012205|Ga0137362_10829979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
3300012206|Ga0137380_11441342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
3300012208|Ga0137376_11374234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
3300012353|Ga0137367_10118114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1948 | Open in IMG/M |
3300012354|Ga0137366_10271871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1252 | Open in IMG/M |
3300012358|Ga0137368_10310674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1062 | Open in IMG/M |
3300012916|Ga0157310_10343142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
3300012923|Ga0137359_10271580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1511 | Open in IMG/M |
3300012927|Ga0137416_10810942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 828 | Open in IMG/M |
3300012927|Ga0137416_10944300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
3300012929|Ga0137404_11061428 | Not Available | 742 | Open in IMG/M |
3300012939|Ga0162650_100028591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
3300012948|Ga0126375_11199357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
3300012948|Ga0126375_11229571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
3300012957|Ga0164303_10053545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1802 | Open in IMG/M |
3300012971|Ga0126369_13688560 | Not Available | 502 | Open in IMG/M |
3300015374|Ga0132255_101949670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
3300016319|Ga0182033_10937970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 768 | Open in IMG/M |
3300016341|Ga0182035_11213314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
3300016422|Ga0182039_10182646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1657 | Open in IMG/M |
3300016422|Ga0182039_10192998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1618 | Open in IMG/M |
3300018433|Ga0066667_10127255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1753 | Open in IMG/M |
3300021372|Ga0213877_10062154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1091 | Open in IMG/M |
3300021560|Ga0126371_10691047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1169 | Open in IMG/M |
3300025914|Ga0207671_10315886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1236 | Open in IMG/M |
3300025941|Ga0207711_11103392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
3300025960|Ga0207651_12077680 | Not Available | 510 | Open in IMG/M |
3300026041|Ga0207639_11074891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
3300026552|Ga0209577_10081901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2653 | Open in IMG/M |
3300026557|Ga0179587_10846670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 603 | Open in IMG/M |
3300027812|Ga0209656_10246235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
3300028536|Ga0137415_10604561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 907 | Open in IMG/M |
3300028717|Ga0307298_10122182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
3300028793|Ga0307299_10012862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2963 | Open in IMG/M |
3300028802|Ga0307503_10806901 | Not Available | 536 | Open in IMG/M |
3300031544|Ga0318534_10790079 | Not Available | 533 | Open in IMG/M |
3300031545|Ga0318541_10687298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
3300031640|Ga0318555_10704639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
3300031679|Ga0318561_10481205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
3300031680|Ga0318574_10657012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
3300031681|Ga0318572_10382751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 836 | Open in IMG/M |
3300031736|Ga0318501_10686787 | Not Available | 564 | Open in IMG/M |
3300031740|Ga0307468_102237723 | Not Available | 530 | Open in IMG/M |
3300031744|Ga0306918_11124845 | Not Available | 608 | Open in IMG/M |
3300031751|Ga0318494_10361315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 841 | Open in IMG/M |
3300031763|Ga0318537_10161550 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300031765|Ga0318554_10793591 | Not Available | 529 | Open in IMG/M |
3300031771|Ga0318546_11296387 | Not Available | 511 | Open in IMG/M |
3300031771|Ga0318546_11351851 | Not Available | 500 | Open in IMG/M |
3300031781|Ga0318547_10415817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
3300031794|Ga0318503_10320634 | Not Available | 504 | Open in IMG/M |
3300031796|Ga0318576_10014023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3036 | Open in IMG/M |
3300031797|Ga0318550_10016481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2972 | Open in IMG/M |
3300031797|Ga0318550_10655365 | Not Available | 503 | Open in IMG/M |
3300031798|Ga0318523_10540191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
3300031832|Ga0318499_10406726 | Not Available | 520 | Open in IMG/M |
3300031845|Ga0318511_10081808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1349 | Open in IMG/M |
3300031890|Ga0306925_10221884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2038 | Open in IMG/M |
3300031894|Ga0318522_10158104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
3300031896|Ga0318551_10892988 | Not Available | 518 | Open in IMG/M |
3300031897|Ga0318520_10178185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1245 | Open in IMG/M |
3300031913|Ga0310891_10366608 | Not Available | 519 | Open in IMG/M |
3300031947|Ga0310909_10071743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2722 | Open in IMG/M |
3300031981|Ga0318531_10480007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
3300032010|Ga0318569_10378758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
3300032025|Ga0318507_10334257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
3300032076|Ga0306924_11206086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 818 | Open in IMG/M |
3300032089|Ga0318525_10572700 | Not Available | 577 | Open in IMG/M |
3300032094|Ga0318540_10657271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
3300033290|Ga0318519_10036135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2375 | Open in IMG/M |
3300033551|Ga0247830_10147723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1714 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.64% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.27% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 4.27% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.56% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Host-Associated | Open in IMG/M |
3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Host-Associated | Open in IMG/M |
3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A01DRAFT_10448013 | 3300000580 | Forest Soil | MRIVLLGLAMVIMAAGAPRGAAGAXIKVLTAGAFKQVLLALLPDF |
AF_2010_repII_A100DRAFT_10218521 | 3300000655 | Forest Soil | MRIVSLGIAMVIMAAGAPRGAAGAEIKVLTAGAFKQ |
AF_2010_repII_A001DRAFT_101345682 | 3300000793 | Forest Soil | MRTVLLGLAMVVMAAGAPRGAAGAEIKVLTAGAFKQV |
JGI24739J22299_101134531 | 3300001989 | Corn Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLLVLVPEFEKQT |
JGI24745J21846_10255352 | 3300002073 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLLVLVPEFEK |
JGI24748J21848_10479782 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVL |
JGI24738J21930_100195993 | 3300002075 | Corn Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFK |
JGI24749J21850_10069963 | 3300002076 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKXLTAGAFKQV |
JGI24033J26618_10115013 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKV |
JGI24034J26672_100271142 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQ |
Ga0066396_100211143 | 3300004267 | Tropical Forest Soil | MRILAMGVAMVMAAGAPRAGAAAEIKVLTAGAFKQVLLTLLPDFER |
Ga0063356_1063943722 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MEDEMRMTVLSAAILLMAAGAPRGAAAAEIKVLTAGAFKQ |
Ga0062594_1022723901 | 3300005093 | Soil | MEEQMRMTLLGVAMVLMAAGEPRGVAAAEIKVLTAGAFKQ |
Ga0008090_156842082 | 3300005363 | Tropical Rainforest Soil | MWQAVEDVMRIVLLGLAMVLMAAGAPRAAAAAEIKVLTAGAFKQ |
Ga0070710_100783411 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAG |
Ga0068855_1018111131 | 3300005563 | Corn Rhizosphere | MFAVMEEQMRMTLLGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLLVLVPEFE |
Ga0066654_106947362 | 3300005587 | Soil | MLTLGLAMVIMGAGAPRAAAAAEIKVLTAGAFKQV |
Ga0068866_114596571 | 3300005718 | Miscanthus Rhizosphere | MFAVMEEQMRMTLLGVAMVLMAAGAPRGVAAAEIKVLTA |
Ga0075368_101270104 | 3300006042 | Populus Endosphere | MFAVMEEQMRMTLLGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLLVLVPEFEKQ |
Ga0075028_1010932182 | 3300006050 | Watersheds | MRIMLLGLAMVLMGGGAPRAAAAAEIKVLTAGAFKQVLLALLPDFE |
Ga0070712_1014560353 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMTVLSAAILLMATGAPRGAAAAEIKVLTAGAFKQVLL |
Ga0075367_110580892 | 3300006178 | Populus Endosphere | MFAVMEEQMRMTLLGVAMVLIAAGAPRGVAAAEIKVLTAGAFKQVLL |
Ga0075367_110640351 | 3300006178 | Populus Endosphere | MRTMLVGIAMVLIGAGAARPAAAAEIKVLTAGAFK |
Ga0074051_100765293 | 3300006572 | Soil | MRTMMVTMAIMLSAAAASPGAAAAEIKVLTAGAFKQ |
Ga0066660_102530451 | 3300006800 | Soil | MRTMLVTMFIMLTAAGASRGANAAEIKVLTAGAFKQVLLA |
Ga0075428_1026772641 | 3300006844 | Populus Rhizosphere | MRMTVLALAMVLLAAGAPRGAAAAEIKVLTAGAFKQVLLALAP |
Ga0075431_1012601421 | 3300006847 | Populus Rhizosphere | MPPIMEDDMKKTLLGLAIVLAAAGAPRGAAAAEIKVLTAGAFKQVL |
Ga0075434_1025983531 | 3300006871 | Populus Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQV |
Ga0075429_1016777171 | 3300006880 | Populus Rhizosphere | MRTMLVGIAMVLIGAGVARPAAAAEIKVLTAGAFK |
Ga0099828_114652311 | 3300009089 | Vadose Zone Soil | MTVLTFAVVLVAAGASRGAACAEIKVLTAGAFKQVLLALLP |
Ga0099827_111205311 | 3300009090 | Vadose Zone Soil | MENGMRMTLFGVAVVLMAAGAPRGAAAAEIKVLTAG |
Ga0075418_110425351 | 3300009100 | Populus Rhizosphere | MRATREDDMRMTVLALAMVLLAAGAPRGAAAAEIKVLTAGAFKQVLLAL |
Ga0066709_1014976483 | 3300009137 | Grasslands Soil | MLVKMLIMLGAAAASPGAAAAEIKVLTAGAFKQVLLALMPDFE |
Ga0126384_102423165 | 3300010046 | Tropical Forest Soil | MWQAVEDAMRIVLLGLAMVLMAAGAPRAAAAAEIKVLTAGAFKQVLLA |
Ga0126373_115659731 | 3300010048 | Tropical Forest Soil | MEDVMRIVLLGLAMVVMAAGGPREAAAAEIKVLTAGAFKQVL |
Ga0126373_116741441 | 3300010048 | Tropical Forest Soil | MEDVMRTVFLGLAMVLMAAGAPRAAAGAEIKVLTAGAFKQVLL |
Ga0126373_129862371 | 3300010048 | Tropical Forest Soil | MEEAMRTMLVGLAMVLIGAGAARPAAAAEIKVLTAGAFKQVL |
Ga0134067_102155422 | 3300010321 | Grasslands Soil | MLVGLAMVLIGAGAARPAAAAEIKVLTAGAFKQVLLAL |
Ga0126372_104186061 | 3300010360 | Tropical Forest Soil | MEEAMRAMLVGLAMVLIGAGAARPAAAAEIKVLTAGAFKQVLLAL |
Ga0126379_116824251 | 3300010366 | Tropical Forest Soil | MWQAVEDVMRTVLLGLAMVLMAAGAPRAAAAAEIKVLTAGAFKQV |
Ga0126379_118414101 | 3300010366 | Tropical Forest Soil | MVKTVEDGMRMTLLGLAVLAFAAGAPRGGAAAEIKVLTAGAFKQVLL |
Ga0105239_113959342 | 3300010375 | Corn Rhizosphere | MEEAMRTMLVGIAMVLIGAGAARPAAAAEIKVLTAG |
Ga0126383_118126462 | 3300010398 | Tropical Forest Soil | MWQAMEEAMQIMLLGLAMVVMGAGASRPAAAAEIKVLTAGAFKQVLLALLP |
Ga0134122_110058341 | 3300010400 | Terrestrial Soil | MKITLLSLAVLLMAAGAPRGAAAAEIKVLTAGAFKQVVVAL |
Ga0134121_101915261 | 3300010401 | Terrestrial Soil | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLLVLVPE |
Ga0137365_101185731 | 3300012201 | Vadose Zone Soil | MEEAMQIMLLGLAMVIMAAGAPRSAAAAEIKVLTAGAFKQ |
Ga0137362_108299791 | 3300012205 | Vadose Zone Soil | VRRTGLAALLAIGVMAAAPVDAAEIKVLTAGAFKQVLLAELPG |
Ga0137380_114413422 | 3300012206 | Vadose Zone Soil | MEEAMRMLTLGLAMVVMGAGAPRAAAAAEIKVLTAGAF |
Ga0137376_113742341 | 3300012208 | Vadose Zone Soil | MLIMLSAAAASPGIAAAEIKVLTAGAFKQVLLPLLPD |
Ga0137367_101181145 | 3300012353 | Vadose Zone Soil | MEDVMRTVLLGFAMVLMAAGTPRAAAGAEIKVLTAGAFKQVLLAL |
Ga0137366_102718713 | 3300012354 | Vadose Zone Soil | MEEAMQIMLLGLAMVIMAAGAPRSAAAAEIKVLTAGAFKQVLLALVPD |
Ga0137368_103106741 | 3300012358 | Vadose Zone Soil | MEDVMRTVLLGFAMVLMAAGTPRAAAGAEIKVLTAG |
Ga0157310_103431422 | 3300012916 | Soil | MEDEMRMTVLSAAILLTAAGAPRGAAAAEIKVLTAGA |
Ga0137359_102715804 | 3300012923 | Vadose Zone Soil | MEDVMRIVLLGLAMVVMAAGAPRGAAGAEIKVLTAGAFKQVLLAL |
Ga0137416_108109422 | 3300012927 | Vadose Zone Soil | MEDVMRIVLLGLAMVLMAAGAPRGAAGAEIKVLTAGAFKQVLLALVPDF |
Ga0137416_109443001 | 3300012927 | Vadose Zone Soil | MEEAMRIMLLGLAMVLMGGGAPRAAAAAEIKVLTAGAFKQVLLA |
Ga0137404_110614281 | 3300012929 | Vadose Zone Soil | MEEAMQIMLLGLAMVIMAAGAPRSAAAAEIKVLTAGAFKQVLLAL |
Ga0162650_1000285911 | 3300012939 | Soil | MEEQMRMTLLGVAMVLMAAGVPRGAAAAEIKVLTAGAFKQVLLALVPDF |
Ga0126375_111993571 | 3300012948 | Tropical Forest Soil | MWQAVEDVMRTVLLGLAMVLMAAGAPRAAAAAEIKVLTAGAFKQVLLALVP |
Ga0126375_112295711 | 3300012948 | Tropical Forest Soil | MRATREDDMRMTVLALAMVLLAAGAPRGAAAAEIKVLTAGAFKQV |
Ga0164303_100535454 | 3300012957 | Soil | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLLVLVPEFE |
Ga0126369_136885602 | 3300012971 | Tropical Forest Soil | MWQAMEDAMRIMLLGLAMVLMAAGAPRAAAAAEIKVLTAGAFKQVLLA |
Ga0132255_1019496702 | 3300015374 | Arabidopsis Rhizosphere | MRATREDDMRMTVLALAMVLLAAGAPRGAAAAEIKVLTAGAFKQVLLA |
Ga0182033_109379701 | 3300016319 | Soil | MRMSVCILAMAAAAAVMPGGAQAAEIKVLTAGAFKQ |
Ga0182035_112133142 | 3300016341 | Soil | MRIVLLGIAMVVMAAGAPRGAAGAEIKVLTAGAFKQVLLALLPDFERA |
Ga0182039_101826461 | 3300016422 | Soil | MRIMLLGLAMVVMGAGVSRPAAAAEIRVLTAGAFKQVLLA |
Ga0182039_101929984 | 3300016422 | Soil | MRMTALTFAIVLMAVGASRGAACAEIKVLTAGAFKQVLLAMLPQF |
Ga0066667_101272551 | 3300018433 | Grasslands Soil | MQIMLLGLAMVIMAAGAPRSAAAAEIKVLTAGAFKQ |
Ga0213877_100621541 | 3300021372 | Bulk Soil | MRTVLLGFAMVLMAAGAPRGAAAAEIKVLSAGAFKQVVLALV |
Ga0126371_106910471 | 3300021560 | Tropical Forest Soil | MRAMLVGLAMVLIGAGAARPAAAAEIKVLTAGAFKQVLLALLP |
Ga0207671_103158863 | 3300025914 | Corn Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVL |
Ga0207711_111033922 | 3300025941 | Switchgrass Rhizosphere | MFAVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLT |
Ga0207651_120776801 | 3300025960 | Switchgrass Rhizosphere | MFAVMEEQMRMTLLGVAMVLMAAGEPRGVAAAEIKVLTAGAFKQVLLVLVPEFEK |
Ga0207639_110748912 | 3300026041 | Corn Rhizosphere | MFAVMEEQMRMTLLGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLLVLVPEFEK |
Ga0209577_100819016 | 3300026552 | Soil | MRTMVLSLAIMLVAAAAPRGAGAAEIKVLTAGAFK |
Ga0179587_108466702 | 3300026557 | Vadose Zone Soil | MRTMLVGLAMVLIGAGAPRPAAAAEIKVLTAGAFKQVLL |
Ga0209656_102462351 | 3300027812 | Bog Forest Soil | LQRTTLTLALVLIAAASSRGAAGAEIKVLSAGAFK |
Ga0137415_106045611 | 3300028536 | Vadose Zone Soil | MRIMLLGLAMVLMGGGAPRAAAAAEIKVLTAGAFKQVLLAL |
Ga0307298_101221821 | 3300028717 | Soil | MTLLGVAMVLMAAGAPRGAAAAEIKVLTAGAFKQV |
Ga0307299_100128625 | 3300028793 | Soil | MFAVMEEQMRMTLLGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLLV |
Ga0307503_108069012 | 3300028802 | Soil | MSLLGLAAVLMAAGAPSGAKAADIKVLTAGAFKQVV |
Ga0318534_107900792 | 3300031544 | Soil | MRRVLLGLAMVVMAAGAPRGAAGAEIKVLTAGAFKQVLL |
Ga0318541_106872981 | 3300031545 | Soil | MRTVLLGLAMVLMAAGVPRAAAGAEIKVLTAGAFK |
Ga0318555_107046392 | 3300031640 | Soil | MRTVLLGLAMVLMAAGVPRAAAGAEIKVLTAGAFKQVL |
Ga0318561_104812051 | 3300031679 | Soil | MRIVLLGLAMVLMAAGAPRGAAGAEIKVLTAGAFKQVLLAL |
Ga0318574_106570121 | 3300031680 | Soil | MRTVLLGLAMVLMAAGVPRAAAGAEIKVLTAGAFKQVLLAL |
Ga0318572_103827513 | 3300031681 | Soil | MRMTALTFAIVLMAVGASRGAACAEIKVLTAGAFKQVLLAMLPQFEPQSG |
Ga0318501_106867871 | 3300031736 | Soil | MRTVLLGFAMVLMAAGAPRAAAGAEIKVLTAGAFKQVL |
Ga0307468_1022377231 | 3300031740 | Hardwood Forest Soil | MRMSLLGLAIMLMAAGAPRGAGAAEIKVLTAGAFKQS |
Ga0306918_111248451 | 3300031744 | Soil | MTSLGLAVVLMAAGVPRAGAAAEIKVLTAGAFKQVVLALVPGFEK |
Ga0318494_103613152 | 3300031751 | Soil | MRVMLLSLATMLLAAGAPRGAASAEIKVLTAGAFKQVLLALLP |
Ga0318537_101615501 | 3300031763 | Soil | MRTVLLGFAMALMAAAAPRAAAGAEIKVLTAGAFK |
Ga0318554_107935912 | 3300031765 | Soil | MRRVLLGLAMVVMAAGAPRGAAGAEIKVLTAGAFKQVLLALL |
Ga0318546_112963871 | 3300031771 | Soil | MRIVLLGLAMVVMAAGAPRGAAGAEIKVLTAGAFKQVLLALL |
Ga0318546_113518511 | 3300031771 | Soil | MRIVLLGLAMVLMAAGAPRGAAGAEIKVLTAGAFKQVLLA |
Ga0318547_104158172 | 3300031781 | Soil | MRIMLLGLAMVVMGAGVSRPAAAAEIKVLTAGAFKQVL |
Ga0318503_103206342 | 3300031794 | Soil | MRMTALTFAIVLMAVGASRGAACAEIKVLTAGAFKQVLLAMLPQFEPQSGH |
Ga0318576_100140237 | 3300031796 | Soil | MRIVLLGLAMVLMAAGAPRGAAGAEIKVLTAGAFK |
Ga0318550_100164811 | 3300031797 | Soil | MRIVLLGLAMVVMAAGAPRGAAGAEIKVLSAGSHD |
Ga0318550_106553651 | 3300031797 | Soil | MRRVLLGLAMVVMAAGAPRGAAGAEIKVLTAGAFKQVLLALLPDFERTS |
Ga0318523_105401912 | 3300031798 | Soil | MRIMLLGLAMVVMGAGVSRPAAAAEIKVLTAGAFK |
Ga0318499_104067261 | 3300031832 | Soil | MRIVLLRLAMVVMAAGAPRGAAGAEIKVLTAGAFKQVLLALLPDFERA |
Ga0318511_100818081 | 3300031845 | Soil | MRIVLLGLAMVVMAAGAPRGAAGAEIKVLSAGAFKQVLLA |
Ga0306925_102218841 | 3300031890 | Soil | MRTVLLGLAMVLMAAGVPRAAAGAEIKVLTAGAFKQVLLALV |
Ga0318522_101581042 | 3300031894 | Soil | MRVMLLSLATMLLAAGAPRGAASAEIKVLTAGAFKQ |
Ga0318551_108929881 | 3300031896 | Soil | MRIVLLGLAMVVMAAGAPRGAAGAEIKVLTAGAFKQ |
Ga0318520_101781853 | 3300031897 | Soil | MRIVLLGLAMVVMAAGGPREAAAAEIKVLTAGAFKQVLLALL |
Ga0310891_103666081 | 3300031913 | Soil | MRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLL |
Ga0310909_100717435 | 3300031947 | Soil | MRTVLLGLAMVLMAAGVPRAAAGAEIKVLTAGAFKQVLLA |
Ga0318531_104800071 | 3300031981 | Soil | MRIVLLGLAMVLMAAGAPRGAAGAEIKVLTAGAFKQVLLALLPDF |
Ga0318569_103787582 | 3300032010 | Soil | MRIVLLGIAMVVMAAGAPRGAAGAEIKVLTAGAFK |
Ga0318507_103342571 | 3300032025 | Soil | MRTVLLGLAMVVMAAGAPRGAAGAEIEVLTAGAFK |
Ga0306924_112060861 | 3300032076 | Soil | MRIVLLGLAMVLMAAGAPRGAAGAEIKVLTAGAFKQV |
Ga0318525_105727001 | 3300032089 | Soil | MRMTALTFAIVLMAVGASRGAACAEIKVLTAGAFKQVLLAMLPQFE |
Ga0318540_106572712 | 3300032094 | Soil | MSLSMRIVALAVAFIMAVAPRHAACAEIKVLTAGAFKQVLLALL |
Ga0318519_100361351 | 3300033290 | Soil | MRIVLLGIAMVVMAAGAPRGAAGAEIKVLTAGAFKQVLLALLPDFERADRVVCDRHLVA |
Ga0247830_101477234 | 3300033551 | Soil | MFVVMEEQMRMTLVGVAMVLMAAGAPRGVAAAEIKVLTAGAFKQVLLALVPE |
⦗Top⦘ |