| Basic Information | |
|---|---|
| Family ID | F077533 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.56 % |
| % of genes near scaffold ends (potentially truncated) | 95.73 % |
| % of genes from short scaffolds (< 2000 bps) | 93.16 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.761 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.957 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.58% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 4.27 |
| PF00162 | PGK | 1.71 |
| PF02806 | Alpha-amylase_C | 1.71 |
| PF00589 | Phage_integrase | 1.71 |
| PF00753 | Lactamase_B | 0.85 |
| PF06689 | zf-C4_ClpX | 0.85 |
| PF16655 | PhoD_N | 0.85 |
| PF05990 | DUF900 | 0.85 |
| PF00239 | Resolvase | 0.85 |
| PF01594 | AI-2E_transport | 0.85 |
| PF08448 | PAS_4 | 0.85 |
| PF00128 | Alpha-amylase | 0.85 |
| PF02668 | TauD | 0.85 |
| PF11295 | DUF3096 | 0.85 |
| PF07758 | DUF1614 | 0.85 |
| PF00118 | Cpn60_TCP1 | 0.85 |
| PF01593 | Amino_oxidase | 0.85 |
| PF01546 | Peptidase_M20 | 0.85 |
| PF02922 | CBM_48 | 0.85 |
| PF13439 | Glyco_transf_4 | 0.85 |
| PF03401 | TctC | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 4.27 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 2.56 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 2.56 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 2.56 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 1.71 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.85 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.85 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.85 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.85 |
| COG4089 | Uncharacterized membrane protein | Function unknown [S] | 0.85 |
| COG4782 | Esterase/lipase superfamily enzyme | General function prediction only [R] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.76 % |
| Unclassified | root | N/A | 16.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10011974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2394 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1022914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 876 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10191484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 830 | Open in IMG/M |
| 3300004479|Ga0062595_102347431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300005332|Ga0066388_101604952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1145 | Open in IMG/M |
| 3300005332|Ga0066388_104492702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300005363|Ga0008090_14501303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300005560|Ga0066670_10168596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1294 | Open in IMG/M |
| 3300005713|Ga0066905_101184293 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005764|Ga0066903_100796307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1689 | Open in IMG/M |
| 3300005764|Ga0066903_101564300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
| 3300005764|Ga0066903_105066102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300005764|Ga0066903_105120111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300005764|Ga0066903_105476258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300005764|Ga0066903_106673613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300005764|Ga0066903_106900407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300006032|Ga0066696_10324173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300006176|Ga0070765_100481057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1165 | Open in IMG/M |
| 3300006797|Ga0066659_11304758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300010046|Ga0126384_11178932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300010047|Ga0126382_11029406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300010048|Ga0126373_12732280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300010366|Ga0126379_10131054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus | 2298 | Open in IMG/M |
| 3300010366|Ga0126379_10557655 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300010366|Ga0126379_10590070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1195 | Open in IMG/M |
| 3300010366|Ga0126379_11554747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300010366|Ga0126379_11602305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300010376|Ga0126381_102102937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 813 | Open in IMG/M |
| 3300010376|Ga0126381_102519916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300010398|Ga0126383_10978676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300010863|Ga0124850_1036489 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300012957|Ga0164303_10222044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300012961|Ga0164302_11873484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300012971|Ga0126369_11998435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300012971|Ga0126369_12408818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300012971|Ga0126369_12425997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300012971|Ga0126369_13486823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300012989|Ga0164305_10650822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300012989|Ga0164305_12132658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300016294|Ga0182041_10105599 | All Organisms → cellular organisms → Bacteria | 2080 | Open in IMG/M |
| 3300016319|Ga0182033_10075551 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300016319|Ga0182033_10257833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1420 | Open in IMG/M |
| 3300016319|Ga0182033_10857939 | Not Available | 802 | Open in IMG/M |
| 3300016357|Ga0182032_11418702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300016387|Ga0182040_11853454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300016404|Ga0182037_10745789 | Not Available | 841 | Open in IMG/M |
| 3300016404|Ga0182037_11499450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300016422|Ga0182039_10054180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2748 | Open in IMG/M |
| 3300016422|Ga0182039_10968905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300016445|Ga0182038_11018232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300018431|Ga0066655_10485481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300018482|Ga0066669_10587436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 975 | Open in IMG/M |
| 3300020579|Ga0210407_10581499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 873 | Open in IMG/M |
| 3300021168|Ga0210406_10608001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 852 | Open in IMG/M |
| 3300021171|Ga0210405_11398097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300021432|Ga0210384_10308621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1424 | Open in IMG/M |
| 3300021475|Ga0210392_10663419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300021478|Ga0210402_11613728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300021560|Ga0126371_11995965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300025915|Ga0207693_10271396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1329 | Open in IMG/M |
| 3300025928|Ga0207700_11465513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300027846|Ga0209180_10634663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300031474|Ga0170818_100994247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 919 | Open in IMG/M |
| 3300031546|Ga0318538_10753552 | Not Available | 528 | Open in IMG/M |
| 3300031561|Ga0318528_10387446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300031572|Ga0318515_10380919 | Not Available | 756 | Open in IMG/M |
| 3300031573|Ga0310915_11046150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300031573|Ga0310915_11121360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031679|Ga0318561_10539165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300031681|Ga0318572_10508300 | Not Available | 718 | Open in IMG/M |
| 3300031719|Ga0306917_10291688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1258 | Open in IMG/M |
| 3300031719|Ga0306917_10662590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300031736|Ga0318501_10076310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1630 | Open in IMG/M |
| 3300031747|Ga0318502_10582622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300031748|Ga0318492_10080416 | Not Available | 1575 | Open in IMG/M |
| 3300031751|Ga0318494_10506930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300031768|Ga0318509_10475553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300031780|Ga0318508_1020148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1613 | Open in IMG/M |
| 3300031782|Ga0318552_10460628 | Not Available | 649 | Open in IMG/M |
| 3300031796|Ga0318576_10392473 | Not Available | 656 | Open in IMG/M |
| 3300031805|Ga0318497_10362676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300031835|Ga0318517_10117953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1173 | Open in IMG/M |
| 3300031835|Ga0318517_10274014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300031879|Ga0306919_10671096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300031879|Ga0306919_10802477 | Not Available | 723 | Open in IMG/M |
| 3300031880|Ga0318544_10196308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
| 3300031890|Ga0306925_11404235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300031894|Ga0318522_10068892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1277 | Open in IMG/M |
| 3300031897|Ga0318520_10136251 | Not Available | 1412 | Open in IMG/M |
| 3300031897|Ga0318520_10997531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300031912|Ga0306921_11157683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300031912|Ga0306921_11574014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300031941|Ga0310912_10574048 | Not Available | 878 | Open in IMG/M |
| 3300031942|Ga0310916_10065232 | Not Available | 2830 | Open in IMG/M |
| 3300031942|Ga0310916_10803483 | Not Available | 792 | Open in IMG/M |
| 3300031942|Ga0310916_11166474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300031945|Ga0310913_10980158 | Not Available | 593 | Open in IMG/M |
| 3300031946|Ga0310910_10556217 | Not Available | 910 | Open in IMG/M |
| 3300031954|Ga0306926_10655310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1277 | Open in IMG/M |
| 3300031954|Ga0306926_10686635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1243 | Open in IMG/M |
| 3300031959|Ga0318530_10348515 | Not Available | 613 | Open in IMG/M |
| 3300031981|Ga0318531_10138944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1085 | Open in IMG/M |
| 3300032001|Ga0306922_11046278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
| 3300032001|Ga0306922_11273570 | Not Available | 745 | Open in IMG/M |
| 3300032010|Ga0318569_10419229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300032035|Ga0310911_10700769 | Not Available | 586 | Open in IMG/M |
| 3300032039|Ga0318559_10624900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300032041|Ga0318549_10399383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300032059|Ga0318533_10596446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300032068|Ga0318553_10521294 | Not Available | 623 | Open in IMG/M |
| 3300032076|Ga0306924_12470298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300032089|Ga0318525_10135354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1263 | Open in IMG/M |
| 3300032261|Ga0306920_100029258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7830 | Open in IMG/M |
| 3300032261|Ga0306920_100232045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2753 | Open in IMG/M |
| 3300032261|Ga0306920_100473151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1861 | Open in IMG/M |
| 3300032261|Ga0306920_101019460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1204 | Open in IMG/M |
| 3300032261|Ga0306920_104422787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100119741 | 3300000597 | Forest Soil | YKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| AP72_2010_repI_A100DRAFT_10229141 | 3300000837 | Forest Soil | CDEEHARFVAAGDADEAAYKVAGEHLHSEGDRRRLRLRVRRLGNGSPPPKLFYAF* |
| JGIcombinedJ51221_101914841 | 3300003505 | Forest Soil | ADEAAYKVTGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE* |
| Ga0062595_1023474311 | 3300004479 | Soil | EEEHARFVAAGDAEEAAYKVAGEQLHSEGDRRKLRLRVRRLGNGSPPPKLFYAS* |
| Ga0066388_1016049524 | 3300005332 | Tropical Forest Soil | DEAAYKVTGEHLHSEGERRKVRVRVRRLGNGSPPPKVFYAA* |
| Ga0066388_1044927022 | 3300005332 | Tropical Forest Soil | VNEFTSHCDEAAYKVTEEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0008090_145013032 | 3300005363 | Tropical Rainforest Soil | EQQDARFVAAEDADEAAYKVTKEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0066670_101685961 | 3300005560 | Soil | DEAAYKVTGEHLRSEGERRRVRLRVRRLGNGSAPPKLFYAA* |
| Ga0066905_1011842932 | 3300005713 | Tropical Forest Soil | RQQSRVVAARDEEEAAYKVAGERLTRDGDRRKARLRVLRLGTGSPPPTVFYAA* |
| Ga0066903_1007963074 | 3300005764 | Tropical Forest Soil | TGEHLHSEGERSKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0066903_1015643001 | 3300005764 | Tropical Forest Soil | AGEHLHIEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0066903_1050661021 | 3300005764 | Tropical Forest Soil | VTGEHLHSEGERSKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0066903_1051201113 | 3300005764 | Tropical Forest Soil | TGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0066903_1054762583 | 3300005764 | Tropical Forest Soil | YKVTGEHLQSEGERRKVRLRVRRLGNGSPSPKLFYAA* |
| Ga0066903_1066736132 | 3300005764 | Tropical Forest Soil | AAGNADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0066903_1069004071 | 3300005764 | Tropical Forest Soil | VAARDADEAAYRVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0066696_103241732 | 3300006032 | Soil | LAQRSSRTYARFVAAGDADEAAYKVAGEYLQSEGDRRKLRLRARRLGNGSPAPKLFYAS* |
| Ga0070765_1004810571 | 3300006176 | Soil | VTGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE* |
| Ga0066659_113047582 | 3300006797 | Soil | DADEAAYKVTGEHLRSEGERRKVRLRVRRLGNGGPPPKLFYAA* |
| Ga0126384_111789321 | 3300010046 | Tropical Forest Soil | VAAGDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0126382_110294061 | 3300010047 | Tropical Forest Soil | NADEAAYKVAGGHLQSEGERRKVRLRVRRLGNGSPSPKLFYAA* |
| Ga0126373_127322801 | 3300010048 | Tropical Forest Soil | TREHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0126379_101310544 | 3300010366 | Tropical Forest Soil | VAARDADEAAYRVTGEHLHSEGERRKVRLRVRKLGNGSPPPKLFYAA* |
| Ga0126379_105576552 | 3300010366 | Tropical Forest Soil | QEARVVAARDADEAAYRVIGKHLRSEGERRKMRLRVHRLGNGSPPPKLFYAA* |
| Ga0126379_105900701 | 3300010366 | Tropical Forest Soil | VAATDADEAAYKVTREHLHSEGERRKVRLRVRRLGNGSPPPRLFYAA* |
| Ga0126379_115547471 | 3300010366 | Tropical Forest Soil | YKVTGGHLHSEGERRKVWLRVRRLGNGTPPPKLFYAA* |
| Ga0126379_116023051 | 3300010366 | Tropical Forest Soil | AYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0126381_1021029371 | 3300010376 | Tropical Forest Soil | ADEAAYTVTGKHLRSEGERRKVRLRVRRLGIGSEPPKLFYAG* |
| Ga0126381_1025199161 | 3300010376 | Tropical Forest Soil | RFVAARDADEAAYKVTGEHLRSEGERRKVRLRVRRLGNGSPPPRLFYAA* |
| Ga0126383_109786763 | 3300010398 | Tropical Forest Soil | IAARDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0124850_10364891 | 3300010863 | Tropical Forest Soil | QGSNLHSEGERRKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0164303_102220441 | 3300012957 | Soil | IVAARDANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYTG* |
| Ga0164302_118734841 | 3300012961 | Soil | ANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYTG* |
| Ga0126369_119984351 | 3300012971 | Tropical Forest Soil | VRFVAAGDADEAAYKVTGEHLHSEGERSKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0126369_124088181 | 3300012971 | Tropical Forest Soil | EAAYKVTGEHLHSEGERGKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0126369_124259971 | 3300012971 | Tropical Forest Soil | DVRFVAARDADEAAYKVTGEHLHSEGERGKVRLRVRRLGNGSPPPKLFYAA* |
| Ga0126369_134868232 | 3300012971 | Tropical Forest Soil | AGDADEAAYRVTGEHLHSEGEHRKVRLRVRRLGNGSPPPKLFYAV* |
| Ga0164305_106508221 | 3300012989 | Soil | VAARDANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYAG* |
| Ga0164305_121326581 | 3300012989 | Soil | VAARDANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYTG* |
| Ga0182041_101055991 | 3300016294 | Soil | QQHARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRLGNGSPPPKLFYAA |
| Ga0182033_100755511 | 3300016319 | Soil | DEAAYKVTGEHLRSEGERRKVRLRVRRLGTGSPPPKLFYAA |
| Ga0182033_102578331 | 3300016319 | Soil | RFVAARDADEAAYKVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC |
| Ga0182033_108579391 | 3300016319 | Soil | DARFVAAGDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0182032_114187021 | 3300016357 | Soil | EAAYRVAGQHLYSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0182040_118534541 | 3300016387 | Soil | RNAEEAAYTVTGIHLRSEGERRKIRLRVRRLGNGSPPPMLFYAG |
| Ga0182037_107457892 | 3300016404 | Soil | AYRVIGKHLRSQGERRKMRLRVHRLGNGSPPPKLFYAG |
| Ga0182037_114994501 | 3300016404 | Soil | YNITGKHLRSEGEPRKVQLRVRRLGNGSPPPKLFYAA |
| Ga0182039_100541809 | 3300016422 | Soil | EMPTKPHTKVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC |
| Ga0182039_109689051 | 3300016422 | Soil | MGVVAARDADEAAYRVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0182038_110182322 | 3300016445 | Soil | VAARDADEAAYKVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC |
| Ga0066655_104854811 | 3300018431 | Grasslands Soil | WEQQDARFVAAGDAGEAAYKVARAHLHSEGDRRRIRLRVRRLGNGSPPPKLFYAS |
| Ga0066669_105874361 | 3300018482 | Grasslands Soil | RDEDDAAYKVTGEYLRKEGERKKVRLRVARLGNGSPPPTLFYAS |
| Ga0210407_105814992 | 3300020579 | Soil | ARFVAARNADEAAYKVTGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE |
| Ga0210406_106080012 | 3300021168 | Soil | KVTGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE |
| Ga0210405_113980971 | 3300021171 | Soil | RQQDARFVAARNANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYTG |
| Ga0210384_103086212 | 3300021432 | Soil | RNADEAAYKATGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE |
| Ga0210392_106634191 | 3300021475 | Soil | AARDADEAAYKVTGEQLRSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0210402_116137281 | 3300021478 | Soil | AARNADEAAYKATGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE |
| Ga0126371_119959651 | 3300021560 | Tropical Forest Soil | DADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0207693_102713961 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYAG |
| Ga0207700_114655131 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RDANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYAG |
| Ga0209180_106346631 | 3300027846 | Vadose Zone Soil | DEDEAAYKVTGERLRKEGERRKIRLRVVRLGNGSPPPTLFYAA |
| Ga0170818_1009942471 | 3300031474 | Forest Soil | AYKVTGEQLRSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318538_107535522 | 3300031546 | Soil | KVTGEHLHSEGGRRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318528_103874462 | 3300031561 | Soil | RDADEAAYKVTGEHLHSEGERGKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318515_103809191 | 3300031572 | Soil | YKVTGEHLHSEGEQRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0310915_110461501 | 3300031573 | Soil | EAAYRVAGQHLYSEGERRKVRLRVRRLGNGIPPPKLFYAV |
| Ga0310915_111213601 | 3300031573 | Soil | FVAARDADEAAYKVTGEHLRSEGERKKLRLRVKRLGNGSPPPKLFYAA |
| Ga0318561_105391651 | 3300031679 | Soil | ADEAAYKVTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318572_105083001 | 3300031681 | Soil | DEDEAAYKVTGEHLSKQGERRKVRVRVVRLGNGSPPPTLYYAT |
| Ga0306917_102916881 | 3300031719 | Soil | EQQHARFVAARDADEAAYKVTGEHLRSEGERRKVRLRVKRLGNGSPPPKLFYAA |
| Ga0306917_106625901 | 3300031719 | Soil | YKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318501_100763104 | 3300031736 | Soil | KVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC |
| Ga0318502_105826221 | 3300031747 | Soil | VAARDADEAAYRVTGKHLRSEGERRKMRLRVHRLGNGSPPPKLFYAG |
| Ga0318492_100804161 | 3300031748 | Soil | DEAAYKVTGEHLHSEGEQRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318494_105069301 | 3300031751 | Soil | QDARFVAARDADEAAYKVTGEHLHSEGEQRKVRLRVRRLGNGSPSPKLFYAA |
| Ga0318509_104755531 | 3300031768 | Soil | FVAARDADEAAYKVTGEHLHSEGEQRKVRLRVRRLGNGSPSPKLFYAA |
| Ga0318508_10201481 | 3300031780 | Soil | HEAAYKVTGEHLHSEGEQRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318552_104606281 | 3300031782 | Soil | YKVTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318576_103924731 | 3300031796 | Soil | ADEAAYKVTGEHLHSEGGRRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318497_103626762 | 3300031805 | Soil | ARFVAARDADEAAYKVTGEHLHSEGERRQVRLRVRRLGNGSPPPKLFYAA |
| Ga0318517_101179533 | 3300031835 | Soil | EAAYKVTGEHLHSEGERRQVRLRVRRLGNGSPAPKLFYAA |
| Ga0318517_102740143 | 3300031835 | Soil | VTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0306919_106710962 | 3300031879 | Soil | FVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRLGNGSPPPKLFYAA |
| Ga0306919_108024773 | 3300031879 | Soil | AARDADEVAYKVTREHLHSEGEPRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318544_101963083 | 3300031880 | Soil | YKVTGERLHSEGERGKVRLRVRRLGNGSPPPKLFYAA |
| Ga0306925_114042353 | 3300031890 | Soil | ELQRARFVAARDADEAAYKVTGEHLRSEGERKKLRLRVKRLGNGSPPPKLFYAA |
| Ga0318522_100688921 | 3300031894 | Soil | VAARDADEAAYKVTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318520_101362511 | 3300031897 | Soil | AYKVTGEHLRSEGEFRKVRLRVRRLGNGSPPAKLFYTA |
| Ga0318520_109975312 | 3300031897 | Soil | DEAAYKVTGEYLHSDGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0306921_111576832 | 3300031912 | Soil | VNEFTSHCDEAAYKVTEEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0306921_115740141 | 3300031912 | Soil | ADEAAYKVAGEHLHIEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0310912_105740482 | 3300031941 | Soil | DEAAYRVIGKHLRSQGERRKMRLRVHRLGNGSPPPKLFYAG |
| Ga0310916_100652324 | 3300031942 | Soil | HARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRLGNGSPPPKLFYAA |
| Ga0310916_108034831 | 3300031942 | Soil | DEAAYKVTGEHLSKQGERRKVRVRVVRLGNGSPPPTLYYAT |
| Ga0310916_111664741 | 3300031942 | Soil | EQQHARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRLGNGGPPPKLFYAA |
| Ga0310913_109801581 | 3300031945 | Soil | FSAARDADEAAYKVTGEHLRSEGERKKLRLRVKRLGNGSPPPKLFYAA |
| Ga0310910_105562171 | 3300031946 | Soil | DADEAAYKVTGEHLHSEGERRKIRLRIRRLGNGSPPPKLFYAC |
| Ga0306926_106553102 | 3300031954 | Soil | LPPWPLGAADARFVAASDAAEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0306926_106866351 | 3300031954 | Soil | KVTGEHLHREGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318530_103485151 | 3300031959 | Soil | FVAARDADEAAYKVTGEHLHSEGGRRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318531_101389441 | 3300031981 | Soil | YKVTGEYLHSDGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0306922_110462783 | 3300032001 | Soil | YARFVAAKDADEAAYKVTGEHLRSEGNRRNVRLRVRRLGNGSPPPKLFYAA |
| Ga0306922_112735701 | 3300032001 | Soil | NEAAYRVIGKHLRSQGERRKMRLRVHRLGNGSPLPKLFYAG |
| Ga0318569_104192291 | 3300032010 | Soil | ARDADEAAYKVTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0310911_107007691 | 3300032035 | Soil | EQQDARFVAAGDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318559_106249001 | 3300032039 | Soil | YKVTEEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0318549_103993831 | 3300032041 | Soil | VTGEHLHSEGEQRKVRLRVRRLGNGSPSPKLFYAA |
| Ga0318533_105964462 | 3300032059 | Soil | QDARFVAARDADEAAYKVTGEHLHGEGERRQVRLRVRRLGNGSPPPKLFYAA |
| Ga0318553_105212941 | 3300032068 | Soil | ARDADEVAYKVTREHLHSEGEPRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0306924_124702981 | 3300032076 | Soil | YKVTGEHLQSEGERRKVRLRVRRLGNGSPSPKLFYAA |
| Ga0318525_101353541 | 3300032089 | Soil | YKVTGEHLHSEGERRQVRLRVRRLGNGSPPPKLFYAA |
| Ga0306920_10002925816 | 3300032261 | Soil | DARFVAARDADEAAYKVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC |
| Ga0306920_1002320451 | 3300032261 | Soil | WEQQDVRFVAARDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA |
| Ga0306920_1004731511 | 3300032261 | Soil | WRVVAARDEDEAAYKVTGEHLSKQGERRKVRVRVVRLGNGSPPPTLYYAT |
| Ga0306920_1010194603 | 3300032261 | Soil | QHARFVAARDADEAAYKVTGEHLRSEGERRKVRLRVKRLGNGSPPPKLFYAA |
| Ga0306920_1044227872 | 3300032261 | Soil | FVAAVNADEAAYKVTGEHLQSEGERRKVRLRVRRLGNGSPSPKLFYAA |
| ⦗Top⦘ |