Basic Information | |
---|---|
Family ID | F077528 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 36 residues |
Representative Sequence | MDEKSSWMRVLITIAIDWRFVTALVILVLALLLR |
Number of Associated Samples | 68 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 63.79 % |
% of genes near scaffold ends (potentially truncated) | 29.06 % |
% of genes from short scaffolds (< 2000 bps) | 70.09 % |
Associated GOLD sequencing projects | 67 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.812 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog (22.222 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.752 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.607 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.39% β-sheet: 0.00% Coil/Unstructured: 51.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF05726 | Pirin_C | 12.17 |
PF02954 | HTH_8 | 7.83 |
PF02739 | 5_3_exonuc_N | 2.61 |
PF14294 | DUF4372 | 1.74 |
PF13280 | WYL | 1.74 |
PF08275 | Toprim_N | 1.74 |
PF00749 | tRNA-synt_1c | 1.74 |
PF01807 | zf-CHC2 | 1.74 |
PF00476 | DNA_pol_A | 1.74 |
PF08206 | OB_RNB | 0.87 |
PF01208 | URO-D | 0.87 |
PF13271 | DUF4062 | 0.87 |
PF13304 | AAA_21 | 0.87 |
PF04015 | DUF362 | 0.87 |
PF12773 | DZR | 0.87 |
PF02906 | Fe_hyd_lg_C | 0.87 |
PF01850 | PIN | 0.87 |
PF00015 | MCPsignal | 0.87 |
PF00133 | tRNA-synt_1 | 0.87 |
PF14415 | DUF4424 | 0.87 |
PF06723 | MreB_Mbl | 0.87 |
PF12760 | Zn_Tnp_IS1595 | 0.87 |
PF00069 | Pkinase | 0.87 |
PF07690 | MFS_1 | 0.87 |
PF03699 | UPF0182 | 0.87 |
PF01433 | Peptidase_M1 | 0.87 |
PF02576 | RimP_N | 0.87 |
PF00474 | SSF | 0.87 |
PF13492 | GAF_3 | 0.87 |
PF04379 | DUF525 | 0.87 |
PF00072 | Response_reg | 0.87 |
PF07729 | FCD | 0.87 |
PF05193 | Peptidase_M16_C | 0.87 |
PF04471 | Mrr_cat | 0.87 |
PF00687 | Ribosomal_L1 | 0.87 |
PF01979 | Amidohydro_1 | 0.87 |
PF08281 | Sigma70_r4_2 | 0.87 |
PF04055 | Radical_SAM | 0.87 |
PF07228 | SpoIIE | 0.87 |
PF00012 | HSP70 | 0.87 |
PF00365 | PFK | 0.87 |
PF00155 | Aminotran_1_2 | 0.87 |
PF15919 | HicB_lk_antitox | 0.87 |
PF05685 | Uma2 | 0.87 |
PF05170 | AsmA | 0.87 |
PF00145 | DNA_methylase | 0.87 |
PF13701 | DDE_Tnp_1_4 | 0.87 |
PF03544 | TonB_C | 0.87 |
PF13735 | tRNA_NucTran2_2 | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 12.17 |
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 3.48 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.48 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 2.61 |
COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.74 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.74 |
COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.74 |
COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.87 |
COG1158 | Transcription termination factor Rho | Transcription [K] | 0.87 |
COG1278 | Cold shock protein, CspA family | Transcription [K] | 0.87 |
COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.87 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.87 |
COG0779 | Ribosome maturation factor RimP | Translation, ribosomal structure and biogenesis [J] | 0.87 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.87 |
COG2967 | Uncharacterized conserved protein ApaG affecting Mg2+/Co2+ transport | Inorganic ion transport and metabolism [P] | 0.87 |
COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
COG4624 | Iron only hydrogenase large subunit, C-terminal domain | Energy production and conversion [C] | 0.87 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.87 |
COG4776 | Exoribonuclease II | Transcription [K] | 0.87 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.87 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.87 |
COG0557 | Exoribonuclease R | Transcription [K] | 0.87 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.87 |
COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.87 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.87 |
COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.87 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
COG0081 | Ribosomal protein L1 | Translation, ribosomal structure and biogenesis [J] | 0.87 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.81 % |
Unclassified | root | N/A | 34.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005529|Ga0070741_10654986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 931 | Open in IMG/M |
3300005529|Ga0070741_11207379 | Not Available | 637 | Open in IMG/M |
3300005534|Ga0070735_10053024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 2675 | Open in IMG/M |
3300005541|Ga0070733_10184206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1363 | Open in IMG/M |
3300005591|Ga0070761_10015088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4301 | Open in IMG/M |
3300005591|Ga0070761_10033567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2869 | Open in IMG/M |
3300005591|Ga0070761_10042673 | Not Available | 2547 | Open in IMG/M |
3300005591|Ga0070761_10134787 | Not Available | 1440 | Open in IMG/M |
3300005602|Ga0070762_11321164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Paracidobacterium → Paracidobacterium acidisoli | 501 | Open in IMG/M |
3300005712|Ga0070764_10408314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300006028|Ga0070717_10649812 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300006028|Ga0070717_10810764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
3300006028|Ga0070717_12104048 | Not Available | 508 | Open in IMG/M |
3300006176|Ga0070765_100612194 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300009624|Ga0116105_1012665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1723 | Open in IMG/M |
3300009624|Ga0116105_1121087 | Not Available | 672 | Open in IMG/M |
3300009624|Ga0116105_1162600 | Not Available | 598 | Open in IMG/M |
3300009665|Ga0116135_1001188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 13544 | Open in IMG/M |
3300009665|Ga0116135_1095792 | Not Available | 1070 | Open in IMG/M |
3300009759|Ga0116101_1030959 | Not Available | 1093 | Open in IMG/M |
3300009759|Ga0116101_1091440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 699 | Open in IMG/M |
3300010339|Ga0074046_10096311 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
3300010341|Ga0074045_10155482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
3300010361|Ga0126378_11509055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
3300010396|Ga0134126_10021562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 8176 | Open in IMG/M |
3300010865|Ga0126346_1392691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 857 | Open in IMG/M |
3300010937|Ga0137776_1317810 | Not Available | 3663 | Open in IMG/M |
3300014160|Ga0181517_10000389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 60384 | Open in IMG/M |
3300014160|Ga0181517_10000524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 50271 | Open in IMG/M |
3300014160|Ga0181517_10000524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 50271 | Open in IMG/M |
3300014160|Ga0181517_10237863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
3300014160|Ga0181517_10256279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 934 | Open in IMG/M |
3300014160|Ga0181517_10609522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300014161|Ga0181529_10067316 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
3300014161|Ga0181529_10093191 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
3300014161|Ga0181529_10404536 | Not Available | 737 | Open in IMG/M |
3300014161|Ga0181529_10608957 | Not Available | 569 | Open in IMG/M |
3300014167|Ga0181528_10133524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1344 | Open in IMG/M |
3300014167|Ga0181528_10173708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1165 | Open in IMG/M |
3300014169|Ga0181531_10350628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 905 | Open in IMG/M |
3300014169|Ga0181531_10353894 | Not Available | 901 | Open in IMG/M |
3300014201|Ga0181537_10602298 | Not Available | 749 | Open in IMG/M |
3300014489|Ga0182018_10033156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3264 | Open in IMG/M |
3300014490|Ga0182010_10427301 | Not Available | 725 | Open in IMG/M |
3300014492|Ga0182013_10058478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Sporolactobacillaceae → Scopulibacillus → Scopulibacillus darangshiensis | 2857 | Open in IMG/M |
3300014492|Ga0182013_10144521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 1511 | Open in IMG/M |
3300014492|Ga0182013_10455194 | Not Available | 675 | Open in IMG/M |
3300014493|Ga0182016_10000293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 62346 | Open in IMG/M |
3300014493|Ga0182016_10050424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 3251 | Open in IMG/M |
3300014493|Ga0182016_10078169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2421 | Open in IMG/M |
3300014493|Ga0182016_10355230 | Not Available | 879 | Open in IMG/M |
3300014493|Ga0182016_10363714 | Not Available | 866 | Open in IMG/M |
3300014495|Ga0182015_10007311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10804 | Open in IMG/M |
3300014498|Ga0182019_10699393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 718 | Open in IMG/M |
3300014499|Ga0182012_10226000 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300014654|Ga0181525_10106465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1549 | Open in IMG/M |
3300014655|Ga0181516_10049323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2129 | Open in IMG/M |
3300014655|Ga0181516_10157108 | Not Available | 1153 | Open in IMG/M |
3300014657|Ga0181522_10148303 | Not Available | 1371 | Open in IMG/M |
3300014658|Ga0181519_10002862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14367 | Open in IMG/M |
3300014658|Ga0181519_10145490 | Not Available | 1513 | Open in IMG/M |
3300014658|Ga0181519_10207825 | Not Available | 1231 | Open in IMG/M |
3300014838|Ga0182030_10107687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 3797 | Open in IMG/M |
3300014838|Ga0182030_10333525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1638 | Open in IMG/M |
3300014838|Ga0182030_11181592 | Not Available | 655 | Open in IMG/M |
3300016698|Ga0181503_1204007 | Not Available | 552 | Open in IMG/M |
3300016701|Ga0181509_1331467 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300016728|Ga0181500_1046165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300016750|Ga0181505_10329535 | Not Available | 630 | Open in IMG/M |
3300016750|Ga0181505_10956075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 991 | Open in IMG/M |
3300017942|Ga0187808_10151545 | Not Available | 1021 | Open in IMG/M |
3300017988|Ga0181520_10000928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 62338 | Open in IMG/M |
3300017988|Ga0181520_10074630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3035 | Open in IMG/M |
3300017988|Ga0181520_10440777 | Not Available | 935 | Open in IMG/M |
3300017988|Ga0181520_10652728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 724 | Open in IMG/M |
3300018040|Ga0187862_10683112 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300018044|Ga0187890_10218240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1078 | Open in IMG/M |
3300021170|Ga0210400_10642654 | Not Available | 874 | Open in IMG/M |
3300022877|Ga0224527_1071325 | Not Available | 609 | Open in IMG/M |
3300024295|Ga0224556_1013674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2095 | Open in IMG/M |
3300027812|Ga0209656_10504948 | Not Available | 528 | Open in IMG/M |
3300027853|Ga0209274_10255931 | Not Available | 896 | Open in IMG/M |
3300028779|Ga0302266_10049876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1871 | Open in IMG/M |
3300028806|Ga0302221_10137462 | Not Available | 1077 | Open in IMG/M |
3300028866|Ga0302278_10262440 | Not Available | 820 | Open in IMG/M |
3300029911|Ga0311361_10142662 | All Organisms → cellular organisms → Bacteria | 3177 | Open in IMG/M |
3300029911|Ga0311361_11053850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 672 | Open in IMG/M |
3300029913|Ga0311362_10493298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
3300029914|Ga0311359_10550003 | Not Available | 864 | Open in IMG/M |
3300029914|Ga0311359_11010090 | Not Available | 560 | Open in IMG/M |
3300029919|Ga0302141_1150142 | Not Available | 631 | Open in IMG/M |
3300029920|Ga0302142_1079406 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300029922|Ga0311363_10039792 | All Organisms → cellular organisms → Bacteria | 7586 | Open in IMG/M |
3300029922|Ga0311363_10165467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 2790 | Open in IMG/M |
3300029922|Ga0311363_11225452 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300029955|Ga0311342_10101339 | All Organisms → cellular organisms → Bacteria | 3055 | Open in IMG/M |
3300029999|Ga0311339_10217217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2141 | Open in IMG/M |
3300030020|Ga0311344_10077301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 3912 | Open in IMG/M |
3300030020|Ga0311344_11084466 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300030044|Ga0302281_10016236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4423 | Open in IMG/M |
3300030049|Ga0302191_10005370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7524 | Open in IMG/M |
3300030049|Ga0302191_10219803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300031718|Ga0307474_11255159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300032074|Ga0308173_10508306 | Not Available | 1080 | Open in IMG/M |
3300032805|Ga0335078_12147044 | Not Available | 591 | Open in IMG/M |
3300032895|Ga0335074_10348902 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
3300032895|Ga0335074_10483199 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300032895|Ga0335074_11631781 | Not Available | 502 | Open in IMG/M |
3300032896|Ga0335075_10420128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1410 | Open in IMG/M |
3300032896|Ga0335075_10970003 | Not Available | 768 | Open in IMG/M |
3300032898|Ga0335072_10000001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1212572 | Open in IMG/M |
3300032898|Ga0335072_10000001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1212572 | Open in IMG/M |
3300032898|Ga0335072_10128057 | All Organisms → cellular organisms → Bacteria | 3170 | Open in IMG/M |
3300032898|Ga0335072_10441780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1375 | Open in IMG/M |
3300032898|Ga0335072_10631238 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300034065|Ga0334827_109897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 899 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 22.22% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 11.97% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.26% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 10.26% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.84% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.98% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.98% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.56% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.71% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.71% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.71% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016701 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300022877 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T0 | Environmental | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070741_106549862 | 3300005529 | Surface Soil | MGGEDMDEKSSWMRVAITIAIDWRFIIAIVVLVLALLLR* |
Ga0070741_112073791 | 3300005529 | Surface Soil | MDEKSSWMRVVISIAIDWRFVMAVAFLVLALLLK* |
Ga0070735_100530242 | 3300005534 | Surface Soil | MDEKSSWMRVLITVAVDWRLVIALVALALLLLLR* |
Ga0070733_101842062 | 3300005541 | Surface Soil | MDEKSSWMRVAVTIAIDWRFITALVILVLALLLR* |
Ga0070761_100150884 | 3300005591 | Soil | MDEKSSWMRVAITIAIDWRLITALIVLVLALLLR* |
Ga0070761_100335674 | 3300005591 | Soil | MDEKSSWMRFAITIAIDWRFVLAVVFLVLALLLK* |
Ga0070761_100426733 | 3300005591 | Soil | MKETSSWMRFAVTIAIDWRFVLAVVILVLALLVK* |
Ga0070761_101347872 | 3300005591 | Soil | MDEKLSWMRVVITTAIDWRFVTALVILVLALLLK* |
Ga0070762_113211642 | 3300005602 | Soil | MDEKSSWMRVLITIAVDWRFVVALVVLVLVLLLK* |
Ga0070764_104083141 | 3300005712 | Soil | LDGKSSWMRVAITIAIDWRFVIALVILVLALLVK* |
Ga0070717_106498121 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERPSWMRVAITIAVDWRFVTALVVLVLALLLLK* |
Ga0070717_108107642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEKSSWMRFAVTIAIDWRFVLAVVLLVLALLMK* |
Ga0070717_121040482 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEKSSWMRVAIRIAIDWRFITALVILVLALLLR* |
Ga0070765_1006121942 | 3300006176 | Soil | MDERSSWMRVAITIAIDWRFLVALAILVLALLLR* |
Ga0116105_10126653 | 3300009624 | Peatland | PLDGKTSRMRVLITIAVDWRFVMAVVVLVLMLLLSK* |
Ga0116105_11210872 | 3300009624 | Peatland | MGEKSPRMRVAITIAIDWRFVMALVILVLALLMR* |
Ga0116105_11626001 | 3300009624 | Peatland | MDEKSSWMRFAITIAVDWRFVLAIVFLVLALLLK* |
Ga0116135_100118813 | 3300009665 | Peatland | MDEKSSRMRVLITRAIDWRFVIALVILVLMLLAK* |
Ga0116135_10957922 | 3300009665 | Peatland | MGGEDMDEKSSWMRFAITIAIDWRFVLAIVFLVLALLLK* |
Ga0116101_10309591 | 3300009759 | Peatland | MAEKSSWMHVLITVAIDWRFVIALAILVLALLMR* |
Ga0116101_10914401 | 3300009759 | Peatland | MDDKSSWMRVLITIAVDWRFVMAVVVLTLLLLLR* |
Ga0074046_100963113 | 3300010339 | Bog Forest Soil | EGMDEKSSWMRFAITIAIDRRFVLAVVFLVLALLLK* |
Ga0074045_101554824 | 3300010341 | Bog Forest Soil | MDEKSSWMRFAITIAIDWRFVLAVVFLVLALLLR* |
Ga0126378_115090552 | 3300010361 | Tropical Forest Soil | MGEKSSWLRLAITIAIDWRFVTAIVILTLALLLLR* |
Ga0134126_100215622 | 3300010396 | Terrestrial Soil | MDEKSSWMRVAITIAVDWRFIIAVVVLVLLLLLR* |
Ga0126346_13926912 | 3300010865 | Boreal Forest Soil | MDEKSSWMRVAITIAVDWRFVTALVLLALALLLR* |
Ga0137776_13178105 | 3300010937 | Sediment | MGEKSSWMRVAITIAVDWRFVTAVVILVLALLLR* |
Ga0181517_1000038938 | 3300014160 | Bog | MGEKSSWMRIAITIAIDWRFVMAVVLLVLALLVLR* |
Ga0181517_1000052414 | 3300014160 | Bog | MDGKTSWMRVVITIAIAWRFVMALVLLVLALLLLR* |
Ga0181517_1000052416 | 3300014160 | Bog | MDGKTSWMRVVITIAIEWRFVMALVLLVLALLLLR* |
Ga0181517_102378631 | 3300014160 | Bog | MVEKSSSMHVVITVAIDWRFVIALAILVLALLMK* |
Ga0181517_102562792 | 3300014160 | Bog | MDEKSSWMQFAVTIAIDWRFVLAVVFLVLALLLR* |
Ga0181517_106095221 | 3300014160 | Bog | MDEKSSWMRVIITIAVDWRFVMALVVLALLLLLSK* |
Ga0181529_100673162 | 3300014161 | Bog | MDEKSSWMRVAITIAIDWRFVVAVVLLVLALLTK* |
Ga0181529_100931912 | 3300014161 | Bog | MDERSSWMRFAVTVAIDWRFVLAIAFLVLTILLR* |
Ga0181529_104045362 | 3300014161 | Bog | VRTMDKKLSWMRVAISIAIDWRFVLALVLLVLALLLLR* |
Ga0181529_106089571 | 3300014161 | Bog | MDEKSSWMRVVIKIGIDWRFVMALVLLVLALLTK* |
Ga0181528_101335242 | 3300014167 | Bog | MDEKSSWMRVLITVAVDWRFVLALVILALLLLLK* |
Ga0181528_101737082 | 3300014167 | Bog | VRPVDEKSSWMRVIITIAVDWRFVMAVVLLMLLLLIK* |
Ga0181531_103506283 | 3300014169 | Bog | MGDKSPWMKVAITIAVDWRFVMALAILALALLLR* |
Ga0181531_103538942 | 3300014169 | Bog | LDEKSSWTRVAISIAVDWRFVLALVILVLALLMR* |
Ga0181537_106022981 | 3300014201 | Bog | MGDKSPWMKVAITIAVDWRFVMALVILALALLMR* |
Ga0182018_100331563 | 3300014489 | Palsa | GRLDERSSWMRVAITIAIDWRFVVALVILVLALLMR* |
Ga0182010_104273011 | 3300014490 | Fen | LDEKSSWTRVAITIAIDWRFVVALVVLVLALLLK* |
Ga0182013_100584784 | 3300014492 | Bog | MDERSSWMRFAITIAIDWRFVLAVVFLVLALLLR* |
Ga0182013_101445212 | 3300014492 | Bog | MDEKSSWMRLAITIAIDWRFVLAVVFLVLALLMK* |
Ga0182013_104551941 | 3300014492 | Bog | MDEKSSWMRAAITIAIDWGFITALVILVLALLLK* |
Ga0182016_1000029338 | 3300014493 | Bog | MDERSSWMRFAVTIAIDWRFVLAIVFLVLALLLKQ* |
Ga0182016_100504242 | 3300014493 | Bog | MDEKSSWMRVLITIAIDWRFVTALVILVLALLLR* |
Ga0182016_100781692 | 3300014493 | Bog | MGQKSPWMRVAVTIAIDWRFVMALVILVLALLTK* |
Ga0182016_103552301 | 3300014493 | Bog | MDEKSSWVRFALTIAIDWRFVLAVAILVLALLLR* |
Ga0182016_103637142 | 3300014493 | Bog | MDEKSSWMRMVITIAIDWRFVMAVVFLVLALLMK* |
Ga0182015_100073118 | 3300014495 | Palsa | MDEKSSWMRVLITIAVDWRFVVAVVILLLVLLLR* |
Ga0182019_106993932 | 3300014498 | Fen | MEEKSSWMRVVITIAIEWRFVMAVVLLVLMLLLLR* |
Ga0182012_102260002 | 3300014499 | Bog | MDEKSSWMRVVITIAIEWRFVMAVVLLVLALLLLG* |
Ga0181525_101064652 | 3300014654 | Bog | KEVRTMDERSSWMRVIITIAIDWRFVTALAILVLALLLK* |
Ga0181516_100493233 | 3300014655 | Bog | MDAKSSWMRVVITIVIEWRFVMAVVLLVLALLLLR* |
Ga0181516_101571082 | 3300014655 | Bog | MGEKSSWIRLAVIVAIDWRFVTVISILVLALLQR* |
Ga0181522_101483032 | 3300014657 | Bog | MDEKSSWMRFAITIAIDWRFVLAVVFFVLALLLK* |
Ga0181519_100028624 | 3300014658 | Bog | MDEKSSWVRFALTVAIDWRFVLAVVILVLALLMR* |
Ga0181519_101454901 | 3300014658 | Bog | EVRLMDEKSSWMRVLITDAVDWRFVLALVILALLLLLK* |
Ga0181519_102078251 | 3300014658 | Bog | RRRGRMGVKAPWIRVAITIAVDWRFVLVLVLLVLALLTK* |
Ga0182030_101076871 | 3300014838 | Bog | MDERSSWMRLLITVAIDWRFVIALVLLVLALLVK* |
Ga0182030_103335252 | 3300014838 | Bog | MDDKSSWMRVLITIAVDWRFVMAVVILTLLLLLR* |
Ga0182030_111815921 | 3300014838 | Bog | MAEKSSWMHVLVTVAIDWRFVIALAILVLALLMR* |
Ga0181503_12040071 | 3300016698 | Peatland | MKDSPSWMRVAITIAIEWRLVAALVFLALALLLLR |
Ga0181509_13314672 | 3300016701 | Peatland | MDKKLSWMRVAISIAIDWRFVLALVLLVLALLLLR |
Ga0181500_10461652 | 3300016728 | Peatland | GRMGEKSSWMRIAITIAIDWRFVMAVVLLVLALLLLR |
Ga0181505_103295351 | 3300016750 | Peatland | MDAKSSWMRVVITIVIEWRFVMAVVLLVLALLLLR |
Ga0181505_109560752 | 3300016750 | Peatland | MDAKSSWMRVVITIAIEWRFVMVVVLLVLTLLLLR |
Ga0187808_101515452 | 3300017942 | Freshwater Sediment | VVTGSEDMDEKSSWMRFAITIAIDWRFVLAVVFLVLALLMR |
Ga0181520_1000092811 | 3300017988 | Bog | MGEKSSWMRIAITIAIDWRFVMAVVLLVLALLVLR |
Ga0181520_100746302 | 3300017988 | Bog | MDERSSWMRVVITVAIEWRLVMAVVLLVLALLSLR |
Ga0181520_104407772 | 3300017988 | Bog | MDEKSSWMRFAVTIAIDWRFVLAIVFLVLALLLKQ |
Ga0181520_106527282 | 3300017988 | Bog | MDEKSSWMRVIITIAVDWRFVMALVVLALLLLLSK |
Ga0187862_106831121 | 3300018040 | Peatland | RLDEKSSWTRVAISIAIDWRFVVALVILVLALLLAR |
Ga0187890_102182402 | 3300018044 | Peatland | MDEKSSWMRVIITIAVDWRFVVAIVILLLTLLLIK |
Ga0210400_106426542 | 3300021170 | Soil | TDEKSSWMRVVITIAIDWRFVTALVILVLTLLLKQ |
Ga0224527_10713251 | 3300022877 | Soil | RMDERSSWMRLLITVAIDWRFVIALVLLVLALLVK |
Ga0224556_10136741 | 3300024295 | Soil | AKEVRALDEKSSWTRLAISIAIDWRFVLALVILALALLLR |
Ga0209656_105049481 | 3300027812 | Bog Forest Soil | GGEGMDEKSSWMRFAITIAIDRRFVLAVVFLVLALLLK |
Ga0209274_102559312 | 3300027853 | Soil | SKGGEDMDEKSSWMRVAITIAIDWRLITALIVLVLALLLR |
Ga0302266_100498762 | 3300028779 | Bog | MGGEDMDEKSSWMRMVITIAIDWRFVMAVVFLVLALLMK |
Ga0302221_101374622 | 3300028806 | Palsa | RAFDEKSSWTRLAISIAIDWRFVLALVILALALLLR |
Ga0302278_102624402 | 3300028866 | Bog | MKGKLPWLQVAIMVAIDWRFIIALAVFVLALLLRR |
Ga0311361_101426621 | 3300029911 | Bog | MTNPTSWVRLAITIAIDWRFVLVVVFLALALLLYG |
Ga0311361_110538501 | 3300029911 | Bog | RLDEKSSWMRVAITIAIDWRFVTALVLLVLALLLR |
Ga0311362_104932981 | 3300029913 | Bog | AKEVRTMKEKSSWMRLAITVAIDWRLVLAVVLLVLALLMR |
Ga0311359_105500031 | 3300029914 | Bog | EDMDEKSSWMRMVITIAIDWRFVMAVVFLVLALLMK |
Ga0311359_110100901 | 3300029914 | Bog | MEEKSSRMRVVITVAIEWRFVMAVVLLVLALLLLG |
Ga0302141_11501421 | 3300029919 | Bog | GRMDEKSSWMRVAITIAIDWRFITALVILVLALLLR |
Ga0302142_10794061 | 3300029920 | Bog | NEVRALGDKSSWMRVAITIAVDWRFVIALVILALALLMK |
Ga0311363_100397923 | 3300029922 | Fen | MKDQTSWVRLAITIAIDWRFVLVVVFLALALLLYG |
Ga0311363_101654672 | 3300029922 | Fen | MSDKPSWMRVAIIVAIDWRLVTAVVFLVLALLLLR |
Ga0311363_112254521 | 3300029922 | Fen | GRMKDQTSWVRLAITIAIDWRFVFVVVFLALALLLYR |
Ga0311342_101013391 | 3300029955 | Bog | VRARDEKSSWMRVLITIAIDWRFVTALVILVLALLLR |
Ga0311339_102172171 | 3300029999 | Palsa | RLDEKSSWMRVAITIAIDWRFVIALVVLVLALLLK |
Ga0311344_100773014 | 3300030020 | Bog | GGEDMDEKSSWMRMVITIAIDWRFVMAVVFLVLALLMK |
Ga0311344_110844662 | 3300030020 | Bog | GMDEKSSWVRFALTIAIDWRFVMAVVILVLVLLMK |
Ga0302281_100162361 | 3300030044 | Fen | ALGDKSSWMRVAITIAVDWRFVIALVILALALLMK |
Ga0302191_100053705 | 3300030049 | Bog | KGGEGEMGQKSPWMRVAVTIAIDWRFVMALVILVLALLTK |
Ga0302191_102198031 | 3300030049 | Bog | WEVRRLDEKSSWMRVAVTIAIDWRFVVALVILVLALLVK |
Ga0307474_112551591 | 3300031718 | Hardwood Forest Soil | MAERPSWMRVAITIAIDWRFVTALVVLVLALLLLK |
Ga0308173_105083062 | 3300032074 | Soil | RRLDERSSWMRVAITIAVDWRFVMALVILALALLLK |
Ga0335078_121470442 | 3300032805 | Soil | RPLGEKSSWMRVIITVAVDWRFVMALVILALLLLIR |
Ga0335074_100571144 | 3300032895 | Soil | MDEKSSWTRLAITLAIDWRFVMAVVILVVLVLLMK |
Ga0335074_103489022 | 3300032895 | Soil | MAQKSSWLQVLITIVIDWRFVTAVVALLLLLLLLK |
Ga0335074_104831992 | 3300032895 | Soil | MAQKSSWLQVLITIVIDWRFVTAVVALLLLLILLK |
Ga0335074_116317812 | 3300032895 | Soil | EVRTEMKETSSWMRVAIAIAVDWRFVTALVLLVPVLLLR |
Ga0335075_104201282 | 3300032896 | Soil | MQEVSTMDARSSWLRVLITIAVDWRFVLTLVVLLLLLLMK |
Ga0335075_109700032 | 3300032896 | Soil | RGGEDMDEKSSWMRVAITIAVDWRFVLALVVLVLALLLR |
Ga0335072_10000001871 | 3300032898 | Soil | MAQKSSWLQVIITIAVDWRFVMAFVALLLLLLLLK |
Ga0335072_10000001872 | 3300032898 | Soil | MAQKSSWLQVLITIVIDWRFVTAFVALLLLLLLLK |
Ga0335072_101280572 | 3300032898 | Soil | MQEVSTMDGRSSWLRVLITIAVDWRFVLTLVVLLLLLLMK |
Ga0335072_104417802 | 3300032898 | Soil | WKEVRPVDEKSSWMRVLIAIAIDWRFVLALAFLALLLLMR |
Ga0335072_106312382 | 3300032898 | Soil | MDEKSSWMRVLITIVVDWRFVIAVVIRVLMLLLSK |
Ga0334827_109897_483_590 | 3300034065 | Soil | MDERSSWMRFAVTIAIDWRFVLAIVFLVLALLLKQ |
⦗Top⦘ |