| Basic Information | |
|---|---|
| Family ID | F077512 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 44 residues |
| Representative Sequence | FLHEHLSGTQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.71 % |
| % of genes near scaffold ends (potentially truncated) | 95.73 % |
| % of genes from short scaffolds (< 2000 bps) | 94.87 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.556 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.205 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.462 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.137 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF04020 | Phage_holin_4_2 | 76.07 |
| PF08327 | AHSA1 | 5.98 |
| PF01124 | MAPEG | 3.42 |
| PF13505 | OMP_b-brl | 1.71 |
| PF00892 | EamA | 1.71 |
| PF00239 | Resolvase | 0.85 |
| PF00561 | Abhydrolase_1 | 0.85 |
| PF07715 | Plug | 0.85 |
| PF13489 | Methyltransf_23 | 0.85 |
| PF00246 | Peptidase_M14 | 0.85 |
| PF12840 | HTH_20 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 76.07 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.85 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.56 % |
| All Organisms | root | All Organisms | 44.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101826173 | Not Available | 509 | Open in IMG/M |
| 3300004082|Ga0062384_100236329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
| 3300004091|Ga0062387_101000430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300004121|Ga0058882_1508943 | Not Available | 510 | Open in IMG/M |
| 3300004152|Ga0062386_101826274 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005542|Ga0070732_10862322 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005575|Ga0066702_10697017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 605 | Open in IMG/M |
| 3300005993|Ga0080027_10289620 | Not Available | 650 | Open in IMG/M |
| 3300006176|Ga0070765_101825687 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006354|Ga0075021_11112380 | Not Available | 517 | Open in IMG/M |
| 3300006426|Ga0075037_1097355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300007265|Ga0099794_10249213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 916 | Open in IMG/M |
| 3300009633|Ga0116129_1178611 | Not Available | 603 | Open in IMG/M |
| 3300009709|Ga0116227_10072777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2918 | Open in IMG/M |
| 3300009709|Ga0116227_10226997 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300010339|Ga0074046_10259761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1076 | Open in IMG/M |
| 3300010858|Ga0126345_1120135 | Not Available | 525 | Open in IMG/M |
| 3300010864|Ga0126357_1334740 | Not Available | 534 | Open in IMG/M |
| 3300011120|Ga0150983_10120192 | Not Available | 595 | Open in IMG/M |
| 3300011120|Ga0150983_16562594 | Not Available | 532 | Open in IMG/M |
| 3300011270|Ga0137391_11209679 | Not Available | 603 | Open in IMG/M |
| 3300011271|Ga0137393_11490454 | Not Available | 566 | Open in IMG/M |
| 3300012189|Ga0137388_10951353 | Not Available | 793 | Open in IMG/M |
| 3300012205|Ga0137362_10226536 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300012361|Ga0137360_10335713 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300012683|Ga0137398_10809864 | Not Available | 655 | Open in IMG/M |
| 3300012917|Ga0137395_10992316 | Not Available | 602 | Open in IMG/M |
| 3300014165|Ga0181523_10639272 | Not Available | 583 | Open in IMG/M |
| 3300014501|Ga0182024_11580157 | Not Available | 745 | Open in IMG/M |
| 3300015197|Ga0167638_1026052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1350 | Open in IMG/M |
| 3300015206|Ga0167644_1061864 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300018030|Ga0187869_10515920 | Not Available | 567 | Open in IMG/M |
| 3300018090|Ga0187770_10462319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1001 | Open in IMG/M |
| 3300019275|Ga0187798_1260849 | Not Available | 583 | Open in IMG/M |
| 3300019886|Ga0193727_1008090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae | 4157 | Open in IMG/M |
| 3300020021|Ga0193726_1216218 | Not Available | 797 | Open in IMG/M |
| 3300020062|Ga0193724_1111924 | Not Available | 545 | Open in IMG/M |
| 3300020580|Ga0210403_10201084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1635 | Open in IMG/M |
| 3300020582|Ga0210395_11387381 | Not Available | 513 | Open in IMG/M |
| 3300021168|Ga0210406_10104495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2405 | Open in IMG/M |
| 3300021168|Ga0210406_10199869 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300021168|Ga0210406_10391202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1115 | Open in IMG/M |
| 3300021401|Ga0210393_10026432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4527 | Open in IMG/M |
| 3300021405|Ga0210387_10918253 | Not Available | 770 | Open in IMG/M |
| 3300021405|Ga0210387_11288422 | Not Available | 632 | Open in IMG/M |
| 3300021407|Ga0210383_10863181 | Not Available | 773 | Open in IMG/M |
| 3300021420|Ga0210394_10657027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 920 | Open in IMG/M |
| 3300021433|Ga0210391_10027039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4614 | Open in IMG/M |
| 3300021477|Ga0210398_11458999 | Not Available | 533 | Open in IMG/M |
| 3300021479|Ga0210410_10446635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1157 | Open in IMG/M |
| 3300021479|Ga0210410_11400197 | Not Available | 592 | Open in IMG/M |
| 3300021559|Ga0210409_10935290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 741 | Open in IMG/M |
| 3300022510|Ga0242652_1050236 | Not Available | 526 | Open in IMG/M |
| 3300022522|Ga0242659_1100447 | Not Available | 572 | Open in IMG/M |
| 3300022533|Ga0242662_10270166 | Not Available | 558 | Open in IMG/M |
| 3300022713|Ga0242677_1070830 | Not Available | 547 | Open in IMG/M |
| 3300022724|Ga0242665_10380044 | Not Available | 512 | Open in IMG/M |
| 3300022726|Ga0242654_10159581 | Not Available | 759 | Open in IMG/M |
| 3300022726|Ga0242654_10331999 | Not Available | 567 | Open in IMG/M |
| 3300024283|Ga0247670_1079303 | Not Available | 600 | Open in IMG/M |
| 3300026214|Ga0209838_1038993 | Not Available | 688 | Open in IMG/M |
| 3300027496|Ga0208987_1025769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1022 | Open in IMG/M |
| 3300027505|Ga0209218_1080221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300027603|Ga0209331_1129760 | Not Available | 606 | Open in IMG/M |
| 3300027767|Ga0209655_10152902 | Not Available | 764 | Open in IMG/M |
| 3300027829|Ga0209773_10181236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 880 | Open in IMG/M |
| 3300027853|Ga0209274_10665521 | Not Available | 538 | Open in IMG/M |
| 3300027860|Ga0209611_10238104 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300027867|Ga0209167_10131264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1303 | Open in IMG/M |
| 3300027889|Ga0209380_10203717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1162 | Open in IMG/M |
| 3300028023|Ga0265357_1000956 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300028536|Ga0137415_10952152 | Not Available | 669 | Open in IMG/M |
| 3300028775|Ga0302231_10226880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300028808|Ga0302228_10287784 | Not Available | 737 | Open in IMG/M |
| 3300028906|Ga0308309_11014255 | Not Available | 719 | Open in IMG/M |
| 3300028909|Ga0302200_10561508 | Not Available | 515 | Open in IMG/M |
| 3300029951|Ga0311371_10910533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1062 | Open in IMG/M |
| 3300029999|Ga0311339_11203235 | Not Available | 694 | Open in IMG/M |
| 3300029999|Ga0311339_11332878 | Not Available | 649 | Open in IMG/M |
| 3300030056|Ga0302181_10085293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1588 | Open in IMG/M |
| 3300030058|Ga0302179_10163610 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300030339|Ga0311360_10738638 | Not Available | 783 | Open in IMG/M |
| 3300030524|Ga0311357_10459945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1191 | Open in IMG/M |
| 3300030545|Ga0210271_10643611 | Not Available | 559 | Open in IMG/M |
| 3300030618|Ga0311354_11635085 | Not Available | 565 | Open in IMG/M |
| 3300030623|Ga0265392_1189874 | Not Available | 560 | Open in IMG/M |
| 3300030738|Ga0265462_11416659 | Not Available | 640 | Open in IMG/M |
| 3300030743|Ga0265461_11201948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 782 | Open in IMG/M |
| 3300030855|Ga0075374_11373463 | Not Available | 549 | Open in IMG/M |
| 3300030879|Ga0265765_1002224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1864 | Open in IMG/M |
| 3300030991|Ga0073994_10680054 | Not Available | 621 | Open in IMG/M |
| 3300031015|Ga0138298_1265632 | Not Available | 516 | Open in IMG/M |
| 3300031022|Ga0138301_1126223 | Not Available | 517 | Open in IMG/M |
| 3300031023|Ga0073998_11596622 | Not Available | 605 | Open in IMG/M |
| 3300031023|Ga0073998_11596803 | Not Available | 556 | Open in IMG/M |
| 3300031027|Ga0302308_10195655 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300031057|Ga0170834_100504218 | Not Available | 522 | Open in IMG/M |
| 3300031057|Ga0170834_104432281 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300031122|Ga0170822_14131790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1950 | Open in IMG/M |
| 3300031258|Ga0302318_10083090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1392 | Open in IMG/M |
| 3300031446|Ga0170820_10143662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 903 | Open in IMG/M |
| 3300031446|Ga0170820_13953446 | Not Available | 622 | Open in IMG/M |
| 3300031446|Ga0170820_15506801 | Not Available | 521 | Open in IMG/M |
| 3300031469|Ga0170819_11123173 | Not Available | 514 | Open in IMG/M |
| 3300031469|Ga0170819_16563143 | Not Available | 576 | Open in IMG/M |
| 3300031474|Ga0170818_108271081 | Not Available | 674 | Open in IMG/M |
| 3300031524|Ga0302320_12131219 | Not Available | 520 | Open in IMG/M |
| 3300031708|Ga0310686_104171037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 992 | Open in IMG/M |
| 3300031708|Ga0310686_111002140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1301 | Open in IMG/M |
| 3300031708|Ga0310686_115886216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1492 | Open in IMG/M |
| 3300031715|Ga0307476_10275863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1231 | Open in IMG/M |
| 3300031715|Ga0307476_11011536 | Not Available | 612 | Open in IMG/M |
| 3300031823|Ga0307478_10068426 | All Organisms → cellular organisms → Bacteria | 2679 | Open in IMG/M |
| 3300031823|Ga0307478_10655155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 879 | Open in IMG/M |
| 3300031962|Ga0307479_10384946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1387 | Open in IMG/M |
| 3300032515|Ga0348332_10196404 | Not Available | 561 | Open in IMG/M |
| 3300034091|Ga0326724_0377863 | Not Available | 759 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.21% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.98% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.42% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.56% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.85% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.85% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.85% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010864 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030623 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1018261731 | 3300002245 | Forest Soil | HLSHSQRVGMVVIIAGVSILTIPGGSFTDPKTLAEPKTQ* |
| Ga0062384_1002363291 | 3300004082 | Bog Forest Soil | WLVLHEHLSGLQLAGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ* |
| Ga0062387_1010004302 | 3300004091 | Bog Forest Soil | AIAAFLGWVFLHENLSGVQQVGMVIIIVGVCILTLPGGSLTDPKTLAEPKTQ* |
| Ga0058882_15089432 | 3300004121 | Forest Soil | WQFLDEHLSNMQLLGMVTIILAVGILTLPGGTLTDPKTLDEPKSQ* |
| Ga0062386_1018262741 | 3300004152 | Bog Forest Soil | PAIAAFLGWQFLDEHLSNLQLIGMVIIIAAVCLLTLPGGSLTDPRTLAEPKSQ* |
| Ga0070732_108623221 | 3300005542 | Surface Soil | WVLHEHLSGLQLVGMAITIVGVCILTVPGGSLTDPKTLAEPKTQ* |
| Ga0066702_106970171 | 3300005575 | Soil | IAGVVGWWFLNERLSHGQRIGMVVILTGVSLLTLPGGSFTDPRTLGEPKTQ* |
| Ga0080027_102896202 | 3300005993 | Prmafrost Soil | ERLSHSQLVGMVIIIAGVSILTLPGGSFTDPKALGEPKTQ* |
| Ga0070765_1018256872 | 3300006176 | Soil | AAFLGWLVLHEHLTGLQLIGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ* |
| Ga0075021_111123801 | 3300006354 | Watersheds | HLSNIQLVGMVVIIAAVCILTLPGGTLTDPKTLDEPKAQ* |
| Ga0075037_10973552 | 3300006426 | Permafrost Soil | LVLHERLSGLQLIGMAVIIIGVCILTLPGGSLTDPKTLAEPKTQ* |
| Ga0099794_102492133 | 3300007265 | Vadose Zone Soil | GWWFLHERLSHSQRVGMVVIIAGVSILTIPGGSFTDPKTLGEPKTQ* |
| Ga0116129_11786111 | 3300009633 | Peatland | ASFLGWQFLHEHLSGTQLAGMVIIIVGVSMLTLPGGSLTDPKTLAEPKTQ* |
| Ga0116227_100727776 | 3300009709 | Host-Associated | WQFLHERLSVVQLAGMAIIIVGVCILTLPGGSFNDPKTLAEPKTQ* |
| Ga0116227_102269971 | 3300009709 | Host-Associated | AFLGWQFLHEHLSAAQLAGMIIIIVGVGMLTLPGGSLTDTKTLAEPKS* |
| Ga0074046_102597613 | 3300010339 | Bog Forest Soil | FLDEHLSNVQLVGMVIIIAAVCILTLPGGSLTDPKTLGEPKAQ* |
| Ga0126345_11201351 | 3300010858 | Boreal Forest Soil | GWWFLHERLSHTQRVGMAVIIAGVSILTIPGVSLTDPKTLGEPKTQ* |
| Ga0126357_13347402 | 3300010864 | Boreal Forest Soil | IAAWLGWLFLHEHLSGLQLFGMAIIIIGVCILTLPGGSLTDPKTLAEPKTQ* |
| Ga0150983_101201921 | 3300011120 | Forest Soil | MQLLGMVTIILAVGILTLPGGTLTDPKTLDEPKSQ* |
| Ga0150983_165625941 | 3300011120 | Forest Soil | QFLHEHLSGVQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ* |
| Ga0137391_112096791 | 3300011270 | Vadose Zone Soil | ASFLGWQFLHEHLSGVQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ* |
| Ga0137393_114904541 | 3300011271 | Vadose Zone Soil | SQRVGMVVIIAGVSILTIPGGSFTDPKTLGEPKTQ* |
| Ga0137388_109513533 | 3300012189 | Vadose Zone Soil | FGWWFLHERLSHSQRVGMVVIIAGVSILTIPGGSFTDPKTLGEPKTQ* |
| Ga0137362_102265364 | 3300012205 | Vadose Zone Soil | SGTQLVGMVVIIVGVSILTRPGGSLTDPKTLAEPKTQ* |
| Ga0137360_103357133 | 3300012361 | Vadose Zone Soil | LSGTQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ* |
| Ga0137398_108098642 | 3300012683 | Vadose Zone Soil | GWWFLHERLSYSQRVGMVVIIAGVSILTIPGGSFTDPKTLGEPKTQ* |
| Ga0137395_109923162 | 3300012917 | Vadose Zone Soil | GWWFLHERLSHTQRVGRVVIIAGVSILTIPGGSFTDPKTLGEPKTQ* |
| Ga0181523_106392721 | 3300014165 | Bog | VQLVGMVIIIAAVCILTLPGGSLTDPKTLGEPKAQ* |
| Ga0182024_115801571 | 3300014501 | Permafrost | LSAVQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ* |
| Ga0167638_10260521 | 3300015197 | Glacier Forefield Soil | QLVGMIVIIIGVSILTLPGGSLTDPKTLAEPKTQ* |
| Ga0167644_10618641 | 3300015206 | Glacier Forefield Soil | LTGVQLIGMAITLVGVCILTVPGGSLTDPKTLAEPKTQ* |
| Ga0187869_105159201 | 3300018030 | Peatland | NEHLSSLQLVGMVIIIVAVCILTLPGGALTDPKTLGEPKTQ |
| Ga0187770_104623193 | 3300018090 | Tropical Peatland | FLDEHLSNVQLAGMLIIIAAVGILTLPGGTLTDPRTLAEPKSQ |
| Ga0187798_12608491 | 3300019275 | Peatland | WQFLGEHLSNVQLVGMVIIIVGVSILTVPGGSFIDPKTLAEPKAQ |
| Ga0193727_10080904 | 3300019886 | Soil | VLHEHLSGVQLIGMAIAIIGVSILTVPGGSLTDPKTLAEPKTQ |
| Ga0193726_12162181 | 3300020021 | Soil | LLGWLVLHEHLSGVQLIGMAIAIIGVSILTVPGGSLTDPKTLAEPKTQ |
| Ga0193724_11119242 | 3300020062 | Soil | EHLSGTQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0210403_102010841 | 3300020580 | Soil | VFLHENLSGVQQVGMVVIIVGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0210395_113873812 | 3300020582 | Soil | LSQLQLVGMLIIVIGVSILTVTGGSFKDPKTFAEPRQQ |
| Ga0210406_101044951 | 3300021168 | Soil | FLHEHLSGAQLIGMVVIIIGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0210406_101998691 | 3300021168 | Soil | LQDHLSGTQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0210406_103912021 | 3300021168 | Soil | LSGLQLVGMAIIIIGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0210393_100264327 | 3300021401 | Soil | VLHELLSDLQLVGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0210387_109182532 | 3300021405 | Soil | GWQFLDEHLSNVQLAGMLIIIAAVGILTLPGGTLTDPRTLAEPKSQ |
| Ga0210387_112884222 | 3300021405 | Soil | ALQLVGMAVIIVGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0210383_108631811 | 3300021407 | Soil | IAAFLGWQFLDEHLSNVQLAGMLIIIAAVGILTLPGGTLTDPRTLGEPKSQ |
| Ga0210394_106570273 | 3300021420 | Soil | LGWAFLHENLSGVQIIGMVVIIVGVCILTLPGGSLTDPKTLA |
| Ga0210391_100270397 | 3300021433 | Soil | GWLVLHEHLSGLQLAGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0210398_114589992 | 3300021477 | Soil | SGLQLIGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0210410_104466353 | 3300021479 | Soil | SGLQLTGMAIIIIGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0210410_114001971 | 3300021479 | Soil | NLQLVGMVIIIAAVGILTLPGGSLTDPRTLAEPKTQ |
| Ga0210409_109352903 | 3300021559 | Soil | LQLVGMVIIIAAVCILTLPGGSLTDPRTLAEPKTQ |
| Ga0242652_10502361 | 3300022510 | Soil | GVQIIGMVVIIVGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0242659_11004471 | 3300022522 | Soil | AIAAFLGWVFLHENLSGVQQVGMVVIIVGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0242662_102701662 | 3300022533 | Soil | LSHSQRIGMVVIIAGVSILTIPGGSFTDPKTLGEPKTQ |
| Ga0242677_10708301 | 3300022713 | Soil | HLSGLQLVGMAIIIIGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0242665_103800441 | 3300022724 | Soil | AIAAFLGWLFLHENLSGVQLVGMVVIIVGVCLLTLPDGSLTDPKTLAEPKTQ |
| Ga0242654_101595811 | 3300022726 | Soil | AIASYIGWQFLHEHLSGAQLVGMVVIIAGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0242654_103319991 | 3300022726 | Soil | AALLGWLVLHEHLSGVQLIGMAIAIIGVSILTVPGGSLTDPKTLAEPKTQQ |
| Ga0247670_10793031 | 3300024283 | Soil | AIAALVGWWFLHERLSHTQRVGMVIIIAGVSILTLPGGSVTDPKTLGEPKTQ |
| Ga0209838_10389932 | 3300026214 | Soil | SFLGWEFLHEHLSGAQLIGMVIIIIGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0208987_10257693 | 3300027496 | Forest Soil | HERLSHTQRVGMAVIIAGVSILTIPGGSLTDPKTLGEPKTQ |
| Ga0209218_10802212 | 3300027505 | Forest Soil | VLHEHLSGLQLAGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0209331_11297602 | 3300027603 | Forest Soil | FLHEHLSGLQLTGMVVIIIGVSILTLPGGSLTDPKTLAEPKAQ |
| Ga0209655_101529023 | 3300027767 | Bog Forest Soil | WVFLHENLSGVQQVGMVIIIVGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0209773_101812363 | 3300027829 | Bog Forest Soil | FLHEHLSGTQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0209274_106655211 | 3300027853 | Soil | QFLDEHLSNLQLIGMVIIIAAVGILTLPGGSLTDPRTLGEPKTQ |
| Ga0209611_102381043 | 3300027860 | Host-Associated | WQFLHEHLSAAQLAGMIIIIVGVGMLTLPGGSLTDPKTLAEPKS |
| Ga0209167_101312644 | 3300027867 | Surface Soil | LSAAQLVGMVVIIVGVSMLTLPGGSLTDPKTLAEPKTQ |
| Ga0209380_102037171 | 3300027889 | Soil | VFASFLGWQFLHEHLSAAQLVGMVVIIVGVSMLTLPGGSLTDPKTLAEPKTQ |
| Ga0265357_10009565 | 3300028023 | Rhizosphere | AALLGWLVLHEHLSGLQLVGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0137415_109521523 | 3300028536 | Vadose Zone Soil | GVQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0302231_102268801 | 3300028775 | Palsa | LSNMQIFGMVTIILAVGILTLPGGMLTDPKTLEEPKTQ |
| Ga0302228_102877841 | 3300028808 | Palsa | AIAAFLGWQFLHEHLSGAQLAGMVIIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0308309_110142551 | 3300028906 | Soil | SNLQLVGMVIIIAAVCILTLPGGSLTDPRTLAEPKTQ |
| Ga0302200_105615081 | 3300028909 | Bog | AFLGWQFLGEHLSNVQLVGMVIIIVGVSILTVPGGSFIDPKTLAEPKAQ |
| Ga0311371_109105331 | 3300029951 | Palsa | FLDEHLSNMQLLGMVTIILAVGILTLPGGMLTDPKTLDEPKTQ |
| Ga0311339_112032353 | 3300029999 | Palsa | QFLDEHLSNVQIAGMVIIISAVGILTLPGGTLTDPRTLGEPKAQ |
| Ga0311339_113328781 | 3300029999 | Palsa | DERLSNTQLFGMVTIILAVGILTLPGGMLTDPKTLEEPKSQ |
| Ga0302181_100852934 | 3300030056 | Palsa | DERLSRSQLIGMVIIIVGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0302179_101636101 | 3300030058 | Palsa | EHLSGLQLAGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0311360_107386383 | 3300030339 | Bog | YLGWQFLHEHLSAIQLVGMIVIIVGVGVLTLPGGSLTDPKTLAEPKTQ |
| Ga0311357_104599451 | 3300030524 | Palsa | SFLGWQFLHEHLSATQLAGMVIIIIGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0210271_106436111 | 3300030545 | Soil | CLFFNYAAQLIGMVVIIIGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0311354_116350852 | 3300030618 | Palsa | LLGWLVLHEHLSGLQLAGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0265392_11898741 | 3300030623 | Soil | ASFLGWQFLHENLSGAQLFGMVIIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0265462_114166592 | 3300030738 | Soil | PAIAAFLGWKFLHEHLSGTQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0265461_112019483 | 3300030743 | Soil | PFFLFFEHLSAVQLVGMVIIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0075374_113734632 | 3300030855 | Soil | GWQFLHEHLSGAQLVGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0265765_10022244 | 3300030879 | Soil | WLVLHERLSGLQLAGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0073994_106800542 | 3300030991 | Soil | GWWFLHEQLSHTQRVGMVVIIAGVSILTIPGGSFTDPKTLGEPKTQ |
| Ga0138298_12656322 | 3300031015 | Soil | LSGTQLAGMVIIIVGVSMLTLPGGSLTDPKTLAEPKTQ |
| Ga0138301_11262232 | 3300031022 | Soil | CSLTQRIGMVVIIAGVSILTIPGGSFTDPKTLGEPKTQ |
| Ga0073998_115966221 | 3300031023 | Soil | AIAAILGWLVLHEHLSGLQLVGMAIIIIGVGILTLPGGSLTDPKTLAEPKTQ |
| Ga0073998_115968031 | 3300031023 | Soil | LHLSGLQLTGMAVIIIGVCILTLPGGSLTDPKTLAEPKTQ |
| Ga0302308_101956554 | 3300031027 | Palsa | WLVLHEHLSGLQLAGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0170834_1005042182 | 3300031057 | Forest Soil | LFFLLQLIGMAIAIIGVSILTVPGGSLTDPKTLAEPKTQ |
| Ga0170834_1044322811 | 3300031057 | Forest Soil | HLSGTQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0170822_141317901 | 3300031122 | Forest Soil | LFLISQLAGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0302318_100830901 | 3300031258 | Bog | LGWQFLHESLSRVQLVGMVIIIVGVALLTVPGGSLIDPKTL |
| Ga0170820_101436621 | 3300031446 | Forest Soil | AIAAFLGWCFLHERLSHSQRIGMVVIIAGVSILTIPGGSFTDPKTLGEPKTQ |
| Ga0170820_139534462 | 3300031446 | Forest Soil | GWWFLHERLSHTQRVGMVVIIAGVSILTLPGGSVTDPKTLGEPKTQ |
| Ga0170820_155068011 | 3300031446 | Forest Soil | LHERLSHSQRIGMVVIIAGVSILTIPGGSFTDPKTLGEPKTQ |
| Ga0170819_111231731 | 3300031469 | Forest Soil | GWQFLHEHLSGAQLIGMIVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0170819_165631431 | 3300031469 | Forest Soil | QFLHEHLSAAQLSGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0170818_1082710811 | 3300031474 | Forest Soil | IAALLGWLVLHEHLSGVQLVGMAIAIIGVSILTVPGGSLTDPKTLAEPKTQ |
| Ga0302320_121312192 | 3300031524 | Bog | SGLQLVGMVIIIVGVSILTLPGGSFTDPKTLAEPKTQ |
| Ga0310686_1041710371 | 3300031708 | Soil | SFLGWQFLNEHLSGAQLAGMVVIIVGVSMLTLPGGSLTDPKTLAEPKTQ |
| Ga0310686_1110021404 | 3300031708 | Soil | GWQFLDEHLSNLQLIGMVIIIAAVGILTLPGGSLTDPRTLGEPKTQ |
| Ga0310686_1158862161 | 3300031708 | Soil | LSPLQLAGMVIIIIGVSMVTLSGGSVTDPKTLAEPKAQ |
| Ga0307476_102758633 | 3300031715 | Hardwood Forest Soil | FLGWWFLHERLSHTQRVGMAVIIAGVSILTIPGGSLTDPKTLGEPKTQ |
| Ga0307476_110115361 | 3300031715 | Hardwood Forest Soil | AAYLGWQFLDEHLSNMQLLGMVTIILAVGILTLPGGTLTDPKTLDEPKTQ |
| Ga0307478_100684266 | 3300031823 | Hardwood Forest Soil | LVLHEHLSGLQLAGMAIIIVGVCILTVPGGSLTDPKTLAEPKTQ |
| Ga0307478_106551551 | 3300031823 | Hardwood Forest Soil | LGWQFLHEHLSATQLVGMVVIIVGVSMLTLPGGSLTDPKTLAEPKTQ |
| Ga0307479_103849461 | 3300031962 | Hardwood Forest Soil | AIASFLGWQFLHEHLSGTQLVGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0348332_101964041 | 3300032515 | Plant Litter | WQFLHEHLSGTQLIGMVVIIVGVSILTLPGGSLTDPKTLAEPKTQ |
| Ga0326724_0377863_616_759 | 3300034091 | Peat Soil | LGWQFLHEHLSGVQLAGMVVIIAGVGILTIPGGSLTDPKTLAEPKTQ |
| ⦗Top⦘ |