| Basic Information | |
|---|---|
| Family ID | F077432 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 45 residues |
| Representative Sequence | YTVTGGAGAFANATGSGTISTQIDLCANTATGTYTGTISKPNSN |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.71 % |
| % of genes near scaffold ends (potentially truncated) | 97.44 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.504 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (17.949 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.120 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (76.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.56% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01156 | IU_nuc_hydro | 11.97 |
| PF00072 | Response_reg | 10.26 |
| PF00246 | Peptidase_M14 | 3.42 |
| PF07494 | Reg_prop | 3.42 |
| PF05402 | PqqD | 1.71 |
| PF00501 | AMP-binding | 1.71 |
| PF07484 | Collar | 1.71 |
| PF13418 | Kelch_4 | 1.71 |
| PF00884 | Sulfatase | 1.71 |
| PF08327 | AHSA1 | 0.85 |
| PF13415 | Kelch_3 | 0.85 |
| PF00589 | Phage_integrase | 0.85 |
| PF00082 | Peptidase_S8 | 0.85 |
| PF00933 | Glyco_hydro_3 | 0.85 |
| PF00254 | FKBP_C | 0.85 |
| PF13238 | AAA_18 | 0.85 |
| PF13540 | RCC1_2 | 0.85 |
| PF07732 | Cu-oxidase_3 | 0.85 |
| PF12833 | HTH_18 | 0.85 |
| PF01165 | Ribosomal_S21 | 0.85 |
| PF13620 | CarboxypepD_reg | 0.85 |
| PF01326 | PPDK_N | 0.85 |
| PF00903 | Glyoxalase | 0.85 |
| PF00440 | TetR_N | 0.85 |
| PF14706 | Tnp_DNA_bind | 0.85 |
| PF03551 | PadR | 0.85 |
| PF03795 | YCII | 0.85 |
| PF04471 | Mrr_cat | 0.85 |
| PF04862 | DUF642 | 0.85 |
| PF01737 | Ycf9 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 11.97 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 3.42 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.85 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.85 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.85 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.85 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.85 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.50 % |
| Unclassified | root | N/A | 26.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_115225711 | Not Available | 518 | Open in IMG/M |
| 3300003324|soilH2_10114092 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
| 3300005093|Ga0062594_103235973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 511 | Open in IMG/M |
| 3300005290|Ga0065712_10720628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 538 | Open in IMG/M |
| 3300005293|Ga0065715_10338616 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300005294|Ga0065705_10596546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 709 | Open in IMG/M |
| 3300005330|Ga0070690_100581785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
| 3300005331|Ga0070670_101004888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 759 | Open in IMG/M |
| 3300005332|Ga0066388_104316556 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005334|Ga0068869_102099784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 508 | Open in IMG/M |
| 3300005335|Ga0070666_10691629 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005338|Ga0068868_100819694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia timonae | 841 | Open in IMG/M |
| 3300005338|Ga0068868_101040387 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300005340|Ga0070689_100590410 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005354|Ga0070675_102086639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia timonae | 522 | Open in IMG/M |
| 3300005364|Ga0070673_100021154 | All Organisms → cellular organisms → Bacteria | 4709 | Open in IMG/M |
| 3300005364|Ga0070673_100106938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2314 | Open in IMG/M |
| 3300005364|Ga0070673_101653016 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005434|Ga0070709_10607661 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005435|Ga0070714_100333670 | Not Available | 1421 | Open in IMG/M |
| 3300005441|Ga0070700_100567049 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005518|Ga0070699_100306513 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300005536|Ga0070697_101713351 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005539|Ga0068853_101099115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 767 | Open in IMG/M |
| 3300005539|Ga0068853_101985631 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005546|Ga0070696_101732226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300005617|Ga0068859_100044885 | All Organisms → cellular organisms → Bacteria | 4441 | Open in IMG/M |
| 3300005617|Ga0068859_100406435 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300005617|Ga0068859_100677529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1122 | Open in IMG/M |
| 3300005617|Ga0068859_101211168 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005718|Ga0068866_11305365 | Not Available | 527 | Open in IMG/M |
| 3300005719|Ga0068861_100834234 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300005840|Ga0068870_10206874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1193 | Open in IMG/M |
| 3300005841|Ga0068863_101075554 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300005842|Ga0068858_100399395 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300005842|Ga0068858_102174130 | Not Available | 549 | Open in IMG/M |
| 3300005843|Ga0068860_100344569 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300005843|Ga0068860_101846086 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005844|Ga0068862_100304317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 1467 | Open in IMG/M |
| 3300005844|Ga0068862_102081162 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006237|Ga0097621_100298745 | Not Available | 1422 | Open in IMG/M |
| 3300006358|Ga0068871_101446260 | Not Available | 649 | Open in IMG/M |
| 3300006844|Ga0075428_100212239 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
| 3300006854|Ga0075425_100064486 | All Organisms → cellular organisms → Bacteria | 4115 | Open in IMG/M |
| 3300006854|Ga0075425_101936775 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300006871|Ga0075434_100428638 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300009098|Ga0105245_10599944 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300009101|Ga0105247_10120319 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300009101|Ga0105247_10278004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1154 | Open in IMG/M |
| 3300009101|Ga0105247_10399337 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300009101|Ga0105247_10853349 | Not Available | 699 | Open in IMG/M |
| 3300009148|Ga0105243_10470379 | Not Available | 1184 | Open in IMG/M |
| 3300009156|Ga0111538_12065521 | Not Available | 716 | Open in IMG/M |
| 3300009174|Ga0105241_11511769 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009174|Ga0105241_12399862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 526 | Open in IMG/M |
| 3300009177|Ga0105248_10351795 | Not Available | 1659 | Open in IMG/M |
| 3300009177|Ga0105248_12001144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300009545|Ga0105237_10243835 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300009553|Ga0105249_11075759 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300010360|Ga0126372_12716447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 547 | Open in IMG/M |
| 3300010371|Ga0134125_12142661 | Not Available | 608 | Open in IMG/M |
| 3300010397|Ga0134124_11775336 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300010399|Ga0134127_10256912 | Not Available | 1659 | Open in IMG/M |
| 3300010399|Ga0134127_12818443 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010400|Ga0134122_10010804 | All Organisms → cellular organisms → Bacteria | 6794 | Open in IMG/M |
| 3300010400|Ga0134122_11002000 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300010400|Ga0134122_11426834 | Not Available | 708 | Open in IMG/M |
| 3300010400|Ga0134122_12278515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300010400|Ga0134122_13281355 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300010401|Ga0134121_11757521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 645 | Open in IMG/M |
| 3300010403|Ga0134123_10045990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium | 3261 | Open in IMG/M |
| 3300010403|Ga0134123_11997706 | Not Available | 638 | Open in IMG/M |
| 3300011119|Ga0105246_11536421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 627 | Open in IMG/M |
| 3300011333|Ga0127502_10849931 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300012212|Ga0150985_105085344 | Not Available | 588 | Open in IMG/M |
| 3300012896|Ga0157303_10262006 | Not Available | 533 | Open in IMG/M |
| 3300012961|Ga0164302_10875309 | Not Available | 687 | Open in IMG/M |
| 3300012988|Ga0164306_11096517 | Not Available | 661 | Open in IMG/M |
| 3300013100|Ga0157373_11070909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 604 | Open in IMG/M |
| 3300013102|Ga0157371_10770003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 724 | Open in IMG/M |
| 3300013297|Ga0157378_12539003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 564 | Open in IMG/M |
| 3300013306|Ga0163162_13016481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 541 | Open in IMG/M |
| 3300014326|Ga0157380_13337007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300014487|Ga0182000_10237102 | Not Available | 723 | Open in IMG/M |
| 3300014745|Ga0157377_10368222 | Not Available | 969 | Open in IMG/M |
| 3300015371|Ga0132258_11462993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 1726 | Open in IMG/M |
| 3300018920|Ga0190273_12119044 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300023168|Ga0247748_1007793 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300025898|Ga0207692_10281917 | Not Available | 1006 | Open in IMG/M |
| 3300025900|Ga0207710_10064461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1669 | Open in IMG/M |
| 3300025900|Ga0207710_10449292 | Not Available | 665 | Open in IMG/M |
| 3300025903|Ga0207680_10120338 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300025911|Ga0207654_10578733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 800 | Open in IMG/M |
| 3300025928|Ga0207700_11740213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 549 | Open in IMG/M |
| 3300025934|Ga0207686_10378808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300025935|Ga0207709_10686928 | Not Available | 818 | Open in IMG/M |
| 3300025936|Ga0207670_10528859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 961 | Open in IMG/M |
| 3300025936|Ga0207670_10998664 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300025940|Ga0207691_10258725 | Not Available | 1500 | Open in IMG/M |
| 3300025940|Ga0207691_10787257 | Not Available | 800 | Open in IMG/M |
| 3300025960|Ga0207651_10684516 | Not Available | 902 | Open in IMG/M |
| 3300025981|Ga0207640_11699351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300026035|Ga0207703_11401675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 672 | Open in IMG/M |
| 3300026075|Ga0207708_10860109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300026088|Ga0207641_11396081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 701 | Open in IMG/M |
| 3300026089|Ga0207648_12075303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 529 | Open in IMG/M |
| 3300026095|Ga0207676_11050337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300026118|Ga0207675_100205863 | All Organisms → cellular organisms → Bacteria | 1891 | Open in IMG/M |
| 3300026118|Ga0207675_100474053 | Not Available | 1243 | Open in IMG/M |
| 3300026118|Ga0207675_102752640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 500 | Open in IMG/M |
| 3300027530|Ga0209216_1072514 | Not Available | 592 | Open in IMG/M |
| 3300028380|Ga0268265_11048495 | Not Available | 807 | Open in IMG/M |
| 3300028380|Ga0268265_11197601 | Not Available | 757 | Open in IMG/M |
| 3300028381|Ga0268264_10297170 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300030847|Ga0075405_11988788 | Not Available | 612 | Open in IMG/M |
| 3300031740|Ga0307468_100011818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3464 | Open in IMG/M |
| 3300032157|Ga0315912_10736444 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 17.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 10.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 7.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027530 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1152257111 | 3300000956 | Soil | GAGAFANATGSGTITTQIDLCAGTATGTYAGTISKPNTN* |
| soilH2_101140921 | 3300003324 | Sugarcane Root And Bulk Soil | STGTYIVTGGTGAFANATGSGTIATEIDECAGTARGTYTGTISRPSSG* |
| Ga0062594_1032359731 | 3300005093 | Soil | SKDKCLFTSTGVYTVTGGTGAFANATGSGTIDTLTDLCAGTSTGTYSGTISRPNSN* |
| Ga0065712_107206282 | 3300005290 | Miscanthus Rhizosphere | GGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISRPNSN* |
| Ga0065715_103386162 | 3300005293 | Miscanthus Rhizosphere | KCVVTSTGTYIVTGGAGAFANATGNGTIVTQFDLCASTATGTYTGTISKPNSN* |
| Ga0065705_105965462 | 3300005294 | Switchgrass Rhizosphere | VPGGTGAFANATGGGTTFTQIDLCGDTTSGGYTGTISRPNSN* |
| Ga0070690_1005817852 | 3300005330 | Switchgrass Rhizosphere | IGTYTVTGGAGAFANATGGGIFEAQADVCAGTGSGTYTGTISRPNSN* |
| Ga0070670_1010048883 | 3300005331 | Switchgrass Rhizosphere | YTVTGGAGAFANATGSGTISTQIDLCANTATGTYTGTISKPNSN* |
| Ga0066388_1043165561 | 3300005332 | Tropical Forest Soil | GTYIVTGGTGAFANATGSGIYEAVRDVCTSSGTHMYTGTISKPNSN* |
| Ga0068869_1020997841 | 3300005334 | Miscanthus Rhizosphere | TSIGTYTVTGGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISKPNLN* |
| Ga0070666_106916291 | 3300005335 | Switchgrass Rhizosphere | TGGTGAFANATGSGITTTEIDQCAGTATGTYTGTISRPNSG* |
| Ga0068868_1008196941 | 3300005338 | Miscanthus Rhizosphere | TSIGTYTVTGGAGAFANATGGGIFEAQADVCAGTGSGTYTGTISRPHSN* |
| Ga0068868_1010403871 | 3300005338 | Miscanthus Rhizosphere | TSIGTYTVTGGAGAFANATGSGIFEAQADVCANTSSGTYTGTISRPNSN* |
| Ga0070689_1005904101 | 3300005340 | Switchgrass Rhizosphere | TGGTGAFANATGSGTITTEIDQCEGTATGMYEGTISRPNSG* |
| Ga0070675_1020866391 | 3300005354 | Miscanthus Rhizosphere | GTYTVTGGAGAFANATGSGTITTQIDKCAGTATGTYTGTISRPNSD* |
| Ga0070673_1000211544 | 3300005364 | Switchgrass Rhizosphere | KDKCLATSTGTYTVTGGAGAFANATGSGTISTQIDLCAGTATGTYTGTISKPH* |
| Ga0070673_1001069384 | 3300005364 | Switchgrass Rhizosphere | MGTYTVTSGAGAFDNATGSGPIDTEIDLGANTARGTYTGTISKPH* |
| Ga0070673_1016530161 | 3300005364 | Switchgrass Rhizosphere | TGGTGAFANATGGGTFEAQSDVCAGTGSGTYTGTISRPNSN* |
| Ga0070709_106076612 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TVTGGAGAFANATGSGTISTQFDLCAGTASGTYTGTISQPNSN* |
| Ga0070714_1003336701 | 3300005435 | Agricultural Soil | TVTGGAGAFANATGNGTIATQFDLCAGTASGTYTGTISQPNSN* |
| Ga0070700_1005670492 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | YTVTGGTGAFANATGSGTISTETNLCAGTALGTFTGTISKPNSN* |
| Ga0070699_1003065131 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | YTVTGGTGAFANATGSGTISTQIDLCASTATGTYTGTISKPNTN* |
| Ga0070697_1017133511 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GTGAFANATGSGTITTQIDQCASTATGTYTGTISQPNSN* |
| Ga0068853_1010991152 | 3300005539 | Corn Rhizosphere | VSPGDKCLVTSTGIYTVTGGAGAFANATGSGTISTQFDLCAGTATGTYTGTISQPNSN* |
| Ga0068853_1019856312 | 3300005539 | Corn Rhizosphere | GGTGAFANATGSGTYEAQRDVCAATGTHMYTGTFSKPNSN* |
| Ga0070696_1017322261 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TITGGTGAFNNATGSGTILTVIDVCAATASGVYTGTICRPNSN* |
| Ga0068859_1000448851 | 3300005617 | Switchgrass Rhizosphere | IGTYTVTGGAGAFANATGGGIFEAQADVCAGTGSGTYTGTISRPHSN* |
| Ga0068859_1004064352 | 3300005617 | Switchgrass Rhizosphere | KDKCVITSTGTFTVTGGTGAFANATGGGTTFTRIDLCADTTSGAYIGTISRPNSN* |
| Ga0068859_1006775293 | 3300005617 | Switchgrass Rhizosphere | TSKDKCVRTSIGTYTVTGGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISRPNSN* |
| Ga0068859_1012111681 | 3300005617 | Switchgrass Rhizosphere | GTYTVTGGTGAFANATGSGIFEAQRDVCVGTGSGTYTGTISKPNSN* |
| Ga0068866_113053651 | 3300005718 | Miscanthus Rhizosphere | FANATGSGTIETQTDVCAGTASGIYSGTISRPHSN* |
| Ga0068861_1008342342 | 3300005719 | Switchgrass Rhizosphere | TYTVTGGAGAFANATGSGTVTTQIDQCAGTATGTYMGTISRPH* |
| Ga0068870_102068741 | 3300005840 | Miscanthus Rhizosphere | YTVTGGAGAFANATGSGTISTEIDLCVGTAKGTYTGTISKPNSN* |
| Ga0068863_1010755542 | 3300005841 | Switchgrass Rhizosphere | GTYIVTGGTGVFANATGSGIFEAQSDVCADTSSGTYTGTISRPNSN* |
| Ga0068858_1003993951 | 3300005842 | Switchgrass Rhizosphere | GGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISKPNLN* |
| Ga0068858_1021741301 | 3300005842 | Switchgrass Rhizosphere | YTVTGGAGAFANATGSGTIVTQFDLCTSTATGTYTGTISKPNSN* |
| Ga0068860_1003445694 | 3300005843 | Switchgrass Rhizosphere | TVTGGTGAFANATGSGTISTETNLCAGTALGTFTGTISRPNSN* |
| Ga0068860_1018460862 | 3300005843 | Switchgrass Rhizosphere | GAFANATGSGTIATETNLCTGSAVGTFTGTISKPNSN* |
| Ga0068862_1003043173 | 3300005844 | Switchgrass Rhizosphere | YTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN* |
| Ga0068862_1020811622 | 3300005844 | Switchgrass Rhizosphere | GAFANATGSGTIDTLTDLCAGTSTGTYTGTISKPNSN* |
| Ga0097621_1002987452 | 3300006237 | Miscanthus Rhizosphere | TVTGGTGAFANATGGGIFEAQFDLCANTSSGTYTGTISRPNSN* |
| Ga0068871_1014462601 | 3300006358 | Miscanthus Rhizosphere | TYTVTGGAGAFANATGSGTIVTQFDLCANTATGTYTGTISKPNSN* |
| Ga0075428_1002122393 | 3300006844 | Populus Rhizosphere | VTGGTGAFANATGSGTITTEIDQCEGTATGIYEGTISRPNSG* |
| Ga0075425_1000644861 | 3300006854 | Populus Rhizosphere | TYTVTGGTGAFANATGSGTFTAQFDLCSGTASGTFTGTISRPSSG* |
| Ga0075425_1019367751 | 3300006854 | Populus Rhizosphere | TSTGTYTVTGGTGAFANATGSGIILTVTDVCAGTASGTYSGTISRPNSN* |
| Ga0075434_1004286383 | 3300006871 | Populus Rhizosphere | GTGAFANATGSGTITTEIDLCAGTARGTYTGTISRPNSG* |
| Ga0105245_105999443 | 3300009098 | Miscanthus Rhizosphere | VTGGAGAFADATGSGTINTQIDMCAGTATGTYTGTISKPH* |
| Ga0105247_101203194 | 3300009101 | Switchgrass Rhizosphere | MGTYTVTSGAGAFDNATGSGPIDTEIDLGANTARGTYTGT |
| Ga0105247_102780043 | 3300009101 | Switchgrass Rhizosphere | TSTGTYTVTGGAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN* |
| Ga0105247_103993371 | 3300009101 | Switchgrass Rhizosphere | AFANATGGGTTFTRIDLCADTTSGAYIGTISRPNSN* |
| Ga0105247_108533492 | 3300009101 | Switchgrass Rhizosphere | GTYTVTGGAGAFDNATGSGTIDTEIDLCANTARGTYTGTISKPH* |
| Ga0105243_104703792 | 3300009148 | Miscanthus Rhizosphere | AFANATGSGTISTQIDLCAGTALGIYTGTISRPNSN* |
| Ga0111538_120655212 | 3300009156 | Populus Rhizosphere | TGGTGAFANATGGGIFEAQADVCAGTGSGTYTGTISKPNSN* |
| Ga0105241_115117691 | 3300009174 | Corn Rhizosphere | TSTGTYTVTGGAGAFANATGSGTIVTQFDLCARTATGTYTGTISKPNSN* |
| Ga0105241_123998621 | 3300009174 | Corn Rhizosphere | GAGAFANATGSGTINTQIDQCAGTASGTYTGTISKPH* |
| Ga0105248_103517951 | 3300009177 | Switchgrass Rhizosphere | KCVVMSTGTYTVTGGAGAFANATGSGTIVTQFDLCANTATGTYTGTISKPNSN* |
| Ga0105248_120011442 | 3300009177 | Switchgrass Rhizosphere | VVLSTGTYTVTGGAGAFANATGNGTIVTQFDLCTSTATGTYTGTISKPNSN* |
| Ga0105237_102438351 | 3300009545 | Corn Rhizosphere | TGGAGAFADATGSGTINTQIDMCAGTATGTYTGTISKPH* |
| Ga0105249_110757591 | 3300009553 | Switchgrass Rhizosphere | TGTYTVTGGAGAFANATGSGSIVTQFDLCARTATGTYTGTISKPNSN* |
| Ga0126372_127164472 | 3300010360 | Tropical Forest Soil | TGGTGAFANATGSGIFEAQRDVCAGNGSGTYTGTISQPNSN* |
| Ga0134125_121426611 | 3300010371 | Terrestrial Soil | DKCEGTSIGTYTVTGGTGAFANATGSGTFEAEFDLCANTSSGTYTGTISRPNSN* |
| Ga0134124_117753362 | 3300010397 | Terrestrial Soil | YTVTGGTGAFANATGSGTITTEIDRCEGTATGTYEGPISRPNSG* |
| Ga0134127_102569121 | 3300010399 | Terrestrial Soil | TGAFANATGSGTISTETNLCAGTALGTFTGTISRPNSN* |
| Ga0134127_128184431 | 3300010399 | Terrestrial Soil | KDKCLFTSTGVYTVTGGTGAFANATGSGAIDTLTDLCAGTSTGTYTGTISRPNSK* |
| Ga0134122_100108041 | 3300010400 | Terrestrial Soil | TVTGGTGAFANATGSGTITTEIDQCEGTATGTYEGTISRPNSG* |
| Ga0134122_110020001 | 3300010400 | Terrestrial Soil | YIVTGGSGAFANATGSGTIDTQIDLCANTAKGTYTGTISKPNSN* |
| Ga0134122_114268342 | 3300010400 | Terrestrial Soil | GNCLINSTGSYTITGGTGAFNNATGSRTILTTIDLCAATASGVYTGTISRPNSN* |
| Ga0134122_122785152 | 3300010400 | Terrestrial Soil | TGTYTVTGGTGAFANATGSGTTFTERDECAGTGGGTYTGTISRPSSG* |
| Ga0134122_132813551 | 3300010400 | Terrestrial Soil | AFANATGSGTIVTQFDLCAGTATGTYTGTISKPNLN* |
| Ga0134121_117575212 | 3300010401 | Terrestrial Soil | GGTGAFANATGSGTITTEIDQCAGTATGTYEGTISRPNSG* |
| Ga0134123_100459904 | 3300010403 | Terrestrial Soil | GTGAFANATGSGTISTETNLCAGTALGTFTGTISRPNSN* |
| Ga0134123_119977062 | 3300010403 | Terrestrial Soil | GGTGAFANATGSGTIVTLIDLCAATATGTYTGTISRPNSN* |
| Ga0105246_115364211 | 3300011119 | Miscanthus Rhizosphere | FANATGSGIFEAQSDVCADTSSGTYTGTISRPNSN* |
| Ga0127502_108499312 | 3300011333 | Soil | ANATGSGTITTQIDQCAGTATGTYTGTISQPNSG* |
| Ga0150985_1050853441 | 3300012212 | Avena Fatua Rhizosphere | TGAFANATGSGTFTAQADLCAGTGFGTYTGTISRPSSG* |
| Ga0157303_102620061 | 3300012896 | Soil | STGTYTVTGGAGAFENATGSGTIVTQIDLCAGTASGTYAGTISKPNTN* |
| Ga0164302_108753091 | 3300012961 | Soil | CVVTSTGIYTITGGAGAFANATGSGTISTQFDLCAGTATGTYTGTISQPNSN* |
| Ga0164306_110965172 | 3300012988 | Soil | GTGAFANATGSGTTFTERDECADTGFGTYTGTISRPNSG* |
| Ga0157373_110709091 | 3300013100 | Corn Rhizosphere | VVTSTGTYTVTGGAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN* |
| Ga0157371_107700032 | 3300013102 | Corn Rhizosphere | MSTGTYTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN* |
| Ga0157378_125390032 | 3300013297 | Miscanthus Rhizosphere | VTGGAGAFANATGSGTINTQIDQCAGTATGTYTGTISKPNSN* |
| Ga0163162_130164812 | 3300013306 | Switchgrass Rhizosphere | VVMSTGTYTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN* |
| Ga0157380_133370071 | 3300014326 | Switchgrass Rhizosphere | TGGAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN* |
| Ga0182000_102371021 | 3300014487 | Soil | LGGAGAFANATGSGTINTQIDLCANTATGTYTGTISKPKSN* |
| Ga0157377_103682222 | 3300014745 | Miscanthus Rhizosphere | VTSTGTYTVTGGAGAFDNATGSGTIDTEIDLCANTARGTYTGTISKPH* |
| Ga0132258_114629934 | 3300015371 | Arabidopsis Rhizosphere | FLNATGSGTITTEIDQCAGTAKGTYTGTISKPKTN* |
| Ga0190273_121190442 | 3300018920 | Soil | GGTGAFANATGSGTITTVTDQCAGTASGTYEGTISRPNSG |
| Ga0247748_10077933 | 3300023168 | Soil | TYTVTGGTGAFLDATGSGIISTEIDQCAGTATGTYTGTISQPNSN |
| Ga0207692_102819171 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GIYTITGGAGAFANATGSGTITTEFNLCTGTADGTYTGTISQPNSN |
| Ga0207710_100644614 | 3300025900 | Switchgrass Rhizosphere | TSTGTYTVTGGAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN |
| Ga0207710_104492921 | 3300025900 | Switchgrass Rhizosphere | MGTYTVTSGAGAFDNATGSGPIDTEIDLGANTARGTNT |
| Ga0207680_101203381 | 3300025903 | Switchgrass Rhizosphere | TGGTGAFANATGSGITTTEIDQCAGTATGTYTGTISRPNSG |
| Ga0207654_105787331 | 3300025911 | Corn Rhizosphere | TGAFANATGSGIFEAQSDVCAGTGSGTYTGTISRPNSN |
| Ga0207700_117402132 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FNGKSPGDKCVVTSTGTYTVTGGAGAFANATGSGTISTQFDLCAGTASGTYTGTISQPNS |
| Ga0207686_103788083 | 3300025934 | Miscanthus Rhizosphere | GAGAFANATGSGTISTEIDLCAGTAKGTYTGTISKPNSN |
| Ga0207709_106869282 | 3300025935 | Miscanthus Rhizosphere | TVTGGTGAFANATGSGTIDTLTDLCAGTSTGTYTGTISKPNSN |
| Ga0207670_105288592 | 3300025936 | Switchgrass Rhizosphere | TGGTGAFANATGSGTITTEIDQCEGTATGMYEGTISRPNSG |
| Ga0207670_109986642 | 3300025936 | Switchgrass Rhizosphere | CVLTSTGTYTVTGGTGAFANATGSGTISTEIDQCAGTATGTYEGTISRPSSG |
| Ga0207691_102587252 | 3300025940 | Miscanthus Rhizosphere | KCLVTSTGTYTVTGGAGAFANATGSGSIVTQFDLCARTATGTYTGTISKPH |
| Ga0207691_107872571 | 3300025940 | Miscanthus Rhizosphere | LFTSTGVYTVTGGTGAFANATGSGTIDTLTDLCAGTSTGTYSGTISRPNLN |
| Ga0207651_106845161 | 3300025960 | Switchgrass Rhizosphere | CVRTSIGTYTVTGGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISKPNLN |
| Ga0207640_116993512 | 3300025981 | Corn Rhizosphere | STGIYTVTGGGGAFANATGSGTITTETNFCTGTASGTYSGTISKPNSN |
| Ga0207703_114016752 | 3300026035 | Switchgrass Rhizosphere | CVVMSTGTYTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN |
| Ga0207708_108601091 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAGAFANATGSGTINTQIDLCAGTATGTYTGTISKPH |
| Ga0207641_113960812 | 3300026088 | Switchgrass Rhizosphere | TGTYTVTGGAGAFANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN |
| Ga0207648_120753032 | 3300026089 | Miscanthus Rhizosphere | TYTVTGGTGAFANATGSGIFEAQFDLCAGTGGGTYTGTISRPNSN |
| Ga0207676_110503373 | 3300026095 | Switchgrass Rhizosphere | TVTGGTGAFANATGSGIFEAQSDVCANTSSGTYTGTISKPNSN |
| Ga0207675_1002058631 | 3300026118 | Switchgrass Rhizosphere | GHFEGGQGNSCVVTSTGTYTVTGGAGAFANATGSGTVTTQIDQCAGTATGTYMGTISRPH |
| Ga0207675_1004740533 | 3300026118 | Switchgrass Rhizosphere | FANATGSGTIDTLTDLCAGTSTGTYTGTISKPNSN |
| Ga0207675_1027526402 | 3300026118 | Switchgrass Rhizosphere | FANATGSGTIVTQFDLCTNTATGTYTGTISKPNSN |
| Ga0209216_10725142 | 3300027530 | Forest Soil | GTYTVVGGTGKFANATGSGIIITQFDICTLTASGIYTGTISRPNSTD |
| Ga0268265_110484952 | 3300028380 | Switchgrass Rhizosphere | GAFANATGGGIFEAQADVCAGTGSGTYTGTISRPNSN |
| Ga0268265_111976011 | 3300028380 | Switchgrass Rhizosphere | GTGAFVNATGSGTISTEIDQCAGTATGTYTGTISQPNAG |
| Ga0268264_102971701 | 3300028381 | Switchgrass Rhizosphere | TVTGGTGAFANATGSGTISTETNLCAGTALGTFTGTISRPNSN |
| Ga0075405_119887881 | 3300030847 | Soil | GIYIITGGAGAFANATGSGTIATQFDLCAGTASGTYTGTISQPNSN |
| Ga0307468_1000118186 | 3300031740 | Hardwood Forest Soil | TGAFANATGSGTTFTERDECVGTGFGTYTGTISRPNSG |
| Ga0315912_107364441 | 3300032157 | Soil | TGAFANATGSGTFTAQHNPCTGTGGSATYEGTISRPNSG |
| ⦗Top⦘ |