NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077406

Metagenome / Metatranscriptome Family F077406

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077406
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 45 residues
Representative Sequence MKIHALTTGAVRVKHSFLFPSSGPRRQLDLFMPGPLSDPLPIHCWA
Number of Associated Samples 105
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.62 %
% of genes near scaffold ends (potentially truncated) 96.58 %
% of genes from short scaffolds (< 2000 bps) 91.45 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.744 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(16.239 % of family members)
Environment Ontology (ENVO) Unclassified
(21.368 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.863 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.86%    β-sheet: 20.27%    Coil/Unstructured: 64.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF16859TetR_C_11 16.24
PF07883Cupin_2 8.55
PF08241Methyltransf_11 3.42
PF12697Abhydrolase_6 1.71
PF01370Epimerase 1.71
PF00753Lactamase_B 1.71
PF13633Obsolete Pfam Family 1.71
PF01471PG_binding_1 1.71
PF03176MMPL 1.71
PF01546Peptidase_M20 1.71
PF13458Peripla_BP_6 1.71
PF03992ABM 0.85
PF00561Abhydrolase_1 0.85
PF01061ABC2_membrane 0.85
PF01027Bax1-I 0.85
PF12773DZR 0.85
PF00990GGDEF 0.85
PF14534DUF4440 0.85
PF00797Acetyltransf_2 0.85
PF12681Glyoxalase_2 0.85
PF02012BNR 0.85
PF00441Acyl-CoA_dh_1 0.85
PF00857Isochorismatase 0.85
PF13433Peripla_BP_5 0.85
PF14310Fn3-like 0.85
PF00378ECH_1 0.85
PF13302Acetyltransf_3 0.85
PF01966HD 0.85
PF01243Putative_PNPOx 0.85
PF04542Sigma70_r2 0.85
PF02424ApbE 0.85
PF00383dCMP_cyt_deam_1 0.85
PF00107ADH_zinc_N 0.85
PF08281Sigma70_r4_2 0.85
PF12802MarR_2 0.85
PF13410GST_C_2 0.85
PF04993TfoX_N 0.85
PF01037AsnC_trans_reg 0.85
PF09826Beta_propel 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 1.71
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 1.71
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.85
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.85
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.85
COG1477FAD:protein FMN transferase ApbEPosttranslational modification, protein turnover, chaperones [O] 0.85
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.85
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.85
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.85
COG2162Arylamine N-acetyltransferaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.85
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 0.85
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.74 %
UnclassifiedrootN/A10.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459017|G14TP7Y02IV0E6All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300002568|C688J35102_117699448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae500Open in IMG/M
3300002568|C688J35102_117948211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300002568|C688J35102_120881086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1990Open in IMG/M
3300004081|Ga0063454_102002680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300004092|Ga0062389_103782160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300004152|Ga0062386_101824790All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005177|Ga0066690_11032731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium515Open in IMG/M
3300005330|Ga0070690_101766130Not Available504Open in IMG/M
3300005332|Ga0066388_106057580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300005435|Ga0070714_102500658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300005436|Ga0070713_101577208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300005436|Ga0070713_102055152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300005439|Ga0070711_100068369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2496Open in IMG/M
3300005529|Ga0070741_11622528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia flavorosea529Open in IMG/M
3300005556|Ga0066707_10977316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium517Open in IMG/M
3300005560|Ga0066670_11017306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300005719|Ga0068861_101184362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300005719|Ga0068861_101630502Not Available636Open in IMG/M
3300005995|Ga0066790_10376468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300006038|Ga0075365_10083085All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300006051|Ga0075364_10295422All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300006059|Ga0075017_101213372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300006059|Ga0075017_101431772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300006237|Ga0097621_102281208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300006354|Ga0075021_10300246All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300006755|Ga0079222_10964358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales727Open in IMG/M
3300006755|Ga0079222_12441485Not Available524Open in IMG/M
3300006795|Ga0075520_1367862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales584Open in IMG/M
3300006847|Ga0075431_100963702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria821Open in IMG/M
3300006852|Ga0075433_11880457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300006853|Ga0075420_101703949Not Available540Open in IMG/M
3300006876|Ga0079217_10647798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales698Open in IMG/M
3300006881|Ga0068865_101639883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300006904|Ga0075424_100509706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1285Open in IMG/M
3300006954|Ga0079219_11801972All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.573Open in IMG/M
3300007076|Ga0075435_101640726All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300009093|Ga0105240_11236113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300009098|Ga0105245_12711171All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300009551|Ga0105238_10910590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium898Open in IMG/M
3300009660|Ga0105854_1297602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300009672|Ga0116215_1389793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300010048|Ga0126373_12803698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300010119|Ga0127452_1105433Not Available815Open in IMG/M
3300010343|Ga0074044_10919606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300010358|Ga0126370_10921379Not Available791Open in IMG/M
3300010371|Ga0134125_10142780All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomicrobium2666Open in IMG/M
3300010379|Ga0136449_102328291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria775Open in IMG/M
3300010867|Ga0126347_1547265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium546Open in IMG/M
3300010880|Ga0126350_12386820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300012198|Ga0137364_11041582All Organisms → cellular organisms → Bacteria → Terrabacteria group617Open in IMG/M
3300012212|Ga0150985_123212448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria851Open in IMG/M
3300012285|Ga0137370_11032153Not Available505Open in IMG/M
3300012469|Ga0150984_105963110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823848Open in IMG/M
3300012897|Ga0157285_10096064All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300012958|Ga0164299_11065685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300012958|Ga0164299_11325168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300012961|Ga0164302_11056289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300013768|Ga0120155_1181769Not Available562Open in IMG/M
3300014169|Ga0181531_10234062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia flavorosea1119Open in IMG/M
3300014200|Ga0181526_10725245All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300014493|Ga0182016_10252348All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300015077|Ga0173483_10117477All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300015373|Ga0132257_101329420All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300017821|Ga0187812_1043309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1526Open in IMG/M
3300017821|Ga0187812_1284224All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300017926|Ga0187807_1123955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300017946|Ga0187879_10448175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300018042|Ga0187871_10803602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300018064|Ga0187773_10919496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300018431|Ga0066655_11225027All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300018433|Ga0066667_10427716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300019356|Ga0173481_10040256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1555Open in IMG/M
3300021403|Ga0210397_11611687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300021407|Ga0210383_10224892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1608Open in IMG/M
3300025527|Ga0208714_1031332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1239Open in IMG/M
3300025898|Ga0207692_10375007All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300025906|Ga0207699_10527475Not Available855Open in IMG/M
3300025929|Ga0207664_10654232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria944Open in IMG/M
3300025937|Ga0207669_11804231All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300025944|Ga0207661_10770794Not Available886Open in IMG/M
3300025944|Ga0207661_11809756All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300025949|Ga0207667_11769695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300026316|Ga0209155_1135509All Organisms → cellular organisms → Bacteria → Terrabacteria group839Open in IMG/M
3300027866|Ga0209813_10369253Not Available572Open in IMG/M
3300027905|Ga0209415_10689371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria734Open in IMG/M
3300028775|Ga0302231_10518798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia flavorosea505Open in IMG/M
3300028789|Ga0302232_10362803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300028879|Ga0302229_10417237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia flavorosea596Open in IMG/M
3300029913|Ga0311362_10212367All Organisms → cellular organisms → Bacteria2188Open in IMG/M
3300029943|Ga0311340_10034091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6213Open in IMG/M
3300029944|Ga0311352_11390635Not Available528Open in IMG/M
3300030013|Ga0302178_10217881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia flavorosea910Open in IMG/M
3300030020|Ga0311344_10491123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae1091Open in IMG/M
3300030053|Ga0302177_10067012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2134Open in IMG/M
3300030294|Ga0311349_10551733All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300030336|Ga0247826_10327621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1108Open in IMG/M
3300030490|Ga0302184_10015507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4248Open in IMG/M
3300030520|Ga0311372_10194187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3408Open in IMG/M
3300030524|Ga0311357_10629018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium984Open in IMG/M
3300030580|Ga0311355_10333057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia flavorosea1511Open in IMG/M
3300030580|Ga0311355_11596213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia flavorosea560Open in IMG/M
3300030617|Ga0311356_11112686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia flavorosea731Open in IMG/M
3300030618|Ga0311354_10795213All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300031027|Ga0302308_10330715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium932Open in IMG/M
3300031236|Ga0302324_100480747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1821Open in IMG/M
3300031524|Ga0302320_10499595All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300031525|Ga0302326_10084325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5791Open in IMG/M
3300031525|Ga0302326_12348920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium675Open in IMG/M
3300031525|Ga0302326_12955146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300031561|Ga0318528_10801694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300031640|Ga0318555_10730516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300031679|Ga0318561_10836055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300031823|Ga0307478_11562282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300032515|Ga0348332_11098019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1690Open in IMG/M
3300034199|Ga0370514_005533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2839Open in IMG/M
3300034282|Ga0370492_0107481All Organisms → cellular organisms → Bacteria → Terrabacteria group1141Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa16.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.27%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.27%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.56%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.56%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.56%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.56%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.56%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.71%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.71%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.71%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.71%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.71%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.85%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.85%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.85%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.85%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.85%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.85%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010119Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_035793802170459017Switchgrass, Maize And Mischanthus LitterMRIHALNTGAVRVKDSFLYPSPGRRRQLDLFLPGDFSEPLPIHCWVIEHDGVLRLVD
C688J35102_11769944823300002568SoilMKIHALTTGTVSVKHSFLHPDPGPRRQLGLFLPGAWSASLPIHCWAVEHDG
C688J35102_11794821123300002568SoilMKIHALTTGAVRLKHSFLYPSAGRRRQLDLFMPGDFSDPMPVHCWAIEHEGVLRLVD
C688J35102_12088108613300002568SoilMKIHALTTGAVRVKDSFLFPSPGPRRQLALFMPGAFSDPLPIHCWAIEHQGVLRLVDSG
Ga0063454_10200268023300004081SoilMKIHALSTGTVRVKHSFLFAGTGIRRQLDLFLPDEWSDPLPIHAW
Ga0062389_10378216013300004092Bog Forest SoilMKIHALTTGTVRVKHSFLMPGSGARRQLNLFLPDAFSEPLPIHCWAIEH
Ga0062386_10182479013300004152Bog Forest SoilVKIHALSTGGLRVKRSFLFPKHGPRRQLDLFLPGAWSEPLPIHCWAIEH
Ga0066690_1103273123300005177SoilMRIHALRTGSVRLKHAFLYPRSGVRRQLDLVLPGPWSDPMPIH*
Ga0070690_10176613033300005330Switchgrass RhizosphereVRVKHSFLFPSHGRRRQLDLFMPGDFSEPLPIHCWAIEHE
Ga0066388_10605758023300005332Tropical Forest SoilMNIYALQTGTVRVKDSFLHPGAGRRRQLDLFLAGGWSEPLPIYCWVV
Ga0070714_10250065813300005435Agricultural SoilMKIHALTTGAVRVKQSFLYPNQGWHRQPDLFLPGPFSAPLPIHCWAIEH
Ga0070713_10157720813300005436Corn, Switchgrass And Miscanthus RhizosphereMRIHALRTGSVRVKHAFLFPPLGARRQLDLFLPGPWSEPL
Ga0070713_10205515213300005436Corn, Switchgrass And Miscanthus RhizosphereMKIHALTTGAVRVKHSFLYPRQGPRRQLDLFLPGAFSDPLPIHCWAIEHDG
Ga0070711_10006836913300005439Corn, Switchgrass And Miscanthus RhizosphereMKIHALSTGSIRVKHSFLFPSPGRRRQLDLFMPGPFSDPLPIHCWAIEHE
Ga0070741_1162252813300005529Surface SoilMKIHALTTGAVRVKHSFLFPSPGRRRQLDLFLPGGFS
Ga0066707_1097731623300005556SoilMRIHALRTGSLRLKHAFLFPRSGVRRQLDLFLPGPWSDPMPIHCWAVE
Ga0066670_1101730613300005560SoilMKIHALTTGAVRVKHSFLFPSSGPRRQLDLFMPGPLSDPLPIHCWA
Ga0068861_10118436223300005719Switchgrass RhizosphereMRIHALTTGTTRVKHAFLFAKTGARRQLDLFMPGPWSDPLPIHCWAIEH
Ga0068861_10163050213300005719Switchgrass RhizosphereMRIHALTTGTARLKHAFLHAKTGPRRQLDLFLPGPWSE
Ga0066790_1037646833300005995SoilMRIHALTTGATRVKHSFLFPRSGPRRQLDLFLPGPFSDPLPLHCWAIEHEGVL
Ga0075365_1008308513300006038Populus EndosphereMKIHALSTGTVRCKDSFLFARNGLRRQLDIFLPGEFSDPLPIHVW
Ga0075364_1029542213300006051Populus EndosphereMKIHALSTGTVRCKDSFLFARNGLRRQLDIFLPGEFS
Ga0075017_10121337223300006059WatershedsMRIHALTTGGVRLKRAFLFPRPGARRQLDLFLPGSWSEPYPIH
Ga0075017_10143177213300006059WatershedsMNIHALTTGTVSVKQSFLHPASGVRRQLNLFLPDAWSEPLPIHCWAIEHDGVLRL
Ga0097621_10228120813300006237Miscanthus RhizosphereMRIHALTTGTVSVKHAFLYASDGPLRQVRLFTPGPFSDPLPIHLWVVEHAGRRI
Ga0075021_1030024613300006354WatershedsMKIHALATGTVRVKRSFLMPSPGPRRQLNLFLPDAFSEPLPIHCWAIEH
Ga0079222_1096435823300006755Agricultural SoilMRIHALTTGAVRLKHAFMYAKTGPRRQLDLFLPGPWTDPVPIHCWAVEH
Ga0079222_1244148513300006755Agricultural SoilLRIHALTTGTVSCKHAFLFAGTGPMRQARLFMPGEFSDPLPI
Ga0075520_136786223300006795Arctic Peat SoilMKIHAMSTGSVRVKHSFLFPGKGLRRQLNLFLPGPFSDPLPIHCWA
Ga0075431_10096370223300006847Populus RhizosphereMRIHALTTGTVRVKHAFLHARSGPRRQLDLFLPGPWSDPLPI
Ga0075433_1188045713300006852Populus RhizosphereMRIHALTTGTVRLKHAFLHPRMGPRRQLDLFLPGPWSEPMPIHCWA
Ga0075420_10170394923300006853Populus RhizosphereMRIHALTTGTVRLKDAFLHAKTGPRRQLDLFLPGPWSGPMPIHCWAIEHE
Ga0079217_1064779823300006876Agricultural SoilMRIHALTTGTVRLKHAFLHARTGPRRQLDLFLPGPWSEPVPIHCWAIEH
Ga0068865_10163988323300006881Miscanthus RhizosphereMRIHALTTGTVSVKHAFLYASDGPLRQVRLFTPGPFSDPLPIHLWVVEHA
Ga0075424_10050970633300006904Populus RhizosphereMKIHALQTGTVRLKESFLHPSTGRRRQLDLFLPGSWSEPV
Ga0079219_1180197233300006954Agricultural SoilMKIYALTTGSVRVKHSFLFPSSGWRRQLHLFTPGDFSNPLPIHVWAIEH
Ga0075435_10164072613300007076Populus RhizosphereVRIHALQTGSVRVKRSFLFAGKGVRRQLDLFLPGPWA
Ga0105240_1123611313300009093Corn RhizosphereMVIHALTTGHVRVKHKFLFPSAGARRQLDLFLADAWSDPLPIHCW
Ga0105245_1271117123300009098Miscanthus RhizosphereMRIHALTTGTVRLKHAFLHAKTGPRRQLDLFLPGPWSESLPIHCWAIEH
Ga0105238_1091059023300009551Corn RhizosphereMVIHALTTGHVRVKHKFLFPSAGARRQIDLFLPDGWSDPLPIHCWAIEH
Ga0105854_129760223300009660Permafrost SoilMKIHALTTGTVQVKRSFLSPGHGARRQLNLLLPASSSDP
Ga0116215_138979313300009672Peatlands SoilLKIHALRTGAVRVKQSFLFPSSGARRQLDLFLPGAWSQPLPIHC
Ga0126373_1280369813300010048Tropical Forest SoilMKIHALSTGAVRVKNSFLFPSPGRRRQLDLFLPGDFSDPLPIHCWAIEHDG
Ga0127452_110543313300010119Grasslands SoilMRIHALTTGTVRVKHSFLFAGTGVRRQLDLFLPGEFSDPLPIHV
Ga0074044_1091960623300010343Bog Forest SoilMRIHALTTGAVRVKHTFLFPKSGARRQLDLFLPGPWSEPLPIHCWAIEH
Ga0126370_1092137913300010358Tropical Forest SoilVKIHALTTGAVRVKHSFLFPSSGWRRQVDLFTPGEFSDPLPIHFWAIEHDGVLR
Ga0134125_1014278033300010371Terrestrial SoilMRIHALSTGTVQVKHSFLFAREGARRQLDLFLPGPFSEPLPIHLWAIEHEGRLMLV
Ga0136449_10232829113300010379Peatlands SoilMRIHALKTGDVRVKHSFLFPRSGPRRQLDLFLPGPWSEPLPIHCWAIEHDG
Ga0126347_154726513300010867Boreal Forest SoilMRIHAISTGSVRLKRSFLFPSSGPRRQLDLFLPGPWSDPVPIHCW
Ga0126350_1238682013300010880Boreal Forest SoilMRIHALTTGTVRLKHAFLYPRRGVRRQLDLFLPGPWSDPVPIHCW
Ga0137364_1104158223300012198Vadose Zone SoilMQIHALSTGTVRVKHSFLFAKTGWRRQIDLLLPGPWSDPLPIHCWAI
Ga0150985_12321244823300012212Avena Fatua RhizosphereMRIHALQTGSVRLKDSFLHPSPGRRRQLDLFLPGAWSEPLPIYCWAIEHG
Ga0137370_1103215313300012285Vadose Zone SoilMKIHALTTGAVCVKHSFLFPSTGPRRQLDLFMPGP
Ga0150984_10596311023300012469Avena Fatua RhizosphereMRIHVAATGTVQVKQSFLFPKAGPRRQLALLMPDAWSEPLPIHVWAI
Ga0157285_1009606423300012897SoilMKIHALTTGTVRVKHSFLFPDPGPRRQLDLFMPGAFSDPLPIHCWAIEHQG
Ga0164299_1106568513300012958SoilVQIHALSTGTVRVKQSFLFARSGPRRQLSLFMPGPFSDPLPIHLWVVEHD
Ga0164299_1132516813300012958SoilVKIHALTTGAVRVKHSFLFPSAGRRRQLDLFLPGDF
Ga0164302_1105628913300012961SoilMRIHALTTGTVQVKHSFLFAGTGVRRQLDLLLPDEWSDPMPIHAWAVE
Ga0120155_118176913300013768PermafrostMRIHALTTGAVRVKRSFLFPNTGPRRQLDLFLPDA
Ga0181531_1023406213300014169BogMKIHALQTGNVRVKHSFLFPSSGARRQLDLFRPGAWSDPLPIHCW
Ga0181526_1072524523300014200BogMRIHALTTGAVRVKHSFLYPGHGPRRQLNLFLPGAFSEP
Ga0182016_1025234823300014493BogMKIHAIQTGTVQVKQSFLHPGRGPRRQLGLFMPSEWS
Ga0173483_1011747723300015077SoilMRIHALTTGTARLKHAFLHAKTGPRRQLDLFLPGPWSEPLPIHCWAIEHD
Ga0132257_10132942023300015373Arabidopsis RhizosphereMKIHALTTGAVRVKHSFLFPSSGARRQLDLFMPGAFSDPLPIHVW
Ga0187812_104330913300017821Freshwater SedimentMKIHALTTGAVRLKHSFLHPRQGPRRQLDLFLPGAFSDPLPIDCWAIEHD
Ga0187812_128422433300017821Freshwater SedimentMRIHALTTGTVRVKRSLLFPSQGARRQLDLFLPGPWSEELPIHCWAIE
Ga0187807_112395523300017926Freshwater SedimentMKIHALTTGAVRLKHSFLHPRQGPRRQLDLFLPGAFSDPLPIDCWAIEHDGIRR
Ga0187879_1044817533300017946PeatlandMRIHALRTGAVRVKHAFLFPNPGVRRQLDLFLPGTWSEPLPIHCWAIEHEGRL
Ga0187871_1080360213300018042PeatlandMKIHALTTGKVQVKRSFLYPGHGPRRQLNLFLPGPWAES
Ga0187773_1091949613300018064Tropical PeatlandMKIHALTTGAVRVKHSFLFPSPGVRRQPDLFLPGDFSDPLPIHCWAI
Ga0066655_1122502713300018431Grasslands SoilMKIHALSTGAVRLKHSFLFPSRGRRRQLDLFMPGEFSDPVPIHCWLIEHAGVLRLV
Ga0066667_1042771633300018433Grasslands SoilVRIHALQTGSVRLKRAFLFPSRGARRQLDLFLPGPWS
Ga0173481_1004025633300019356SoilMKIHPLQTGTVRVKNSFLHPSPGRRRQLDLFLPGAWSQPLPIHCW
Ga0210397_1161168713300021403SoilMKIYALTTGTVSVKHSFLFPRHGARRQLDLFVPGAFSEPLPIHCWAIEHDGVLRLVDTG
Ga0210383_1022489233300021407SoilMKIHALTTGAVRVKHSFLYPRPGPRRQLDLFLPGPFTDPSNP
Ga0208714_103133223300025527Arctic Peat SoilMKIHALTTGTVSVKHSFLFPSHGARRQLDLFLPGDFSDP
Ga0207692_1037500713300025898Corn, Switchgrass And Miscanthus RhizosphereVRIHALQTGSVRVKRSFLFAGKGVRRQLDLFLPGPWADP
Ga0207699_1052747513300025906Corn, Switchgrass And Miscanthus RhizosphereMRIHALRTGSVRVKHAFLFPYGGTRRQLGLFLPGPWS
Ga0207664_1065423213300025929Agricultural SoilMKIHALSTGAIRVKHSFLFPSPGRRRQLDLFTPGPFSDPLPIHCWAIE
Ga0207669_1180423113300025937Miscanthus RhizosphereMRIHALTTGTVRLKDAFLRAKTGPRRQLDLFLPGPWAEPM
Ga0207661_1077079413300025944Corn RhizosphereMRSVEWRPVRIHALSTGTVRVKQSFLFAAAGPTRQLRLFLPGDFSDRL
Ga0207661_1180975613300025944Corn RhizosphereMKIHALQTGTVRVKDRFLHPSPGRRRQLDLLLPGAWSEPLPIH
Ga0207667_1176969513300025949Corn RhizosphereMRIHALTTGTVSVKHAFLYATDGPLRQVRLFMPGPFSDPLPIHIWVVEHEDRRIL
Ga0209155_113550913300026316SoilVRIHALQTGSVRLKRAFLFPSRGARRQLDLFLPGPWSDPVPIHCW
Ga0209813_1036925323300027866Populus EndosphereVKIHALSTGTVRVKQSFLVARSGAMRQLSVFLPGPFTDPLPIHVWLVEHE
Ga0209415_1068937113300027905Peatlands SoilMKIYALTTGTVRVKRSFLLPAHGPRRQLNLFLPDAWSQPLPIHCWAIEHD
Ga0302231_1051879813300028775PalsaMKIHAIQTGTVQVKQSFLHPGRGPRRKLGLFMPSEW
Ga0302232_1036280323300028789PalsaLLAGVRSDPLSMKIHALTTGAVRLKHCFLCPSQGPRRQLDLFLPGDFGEPMPIHCWAIEHEGV
Ga0302229_1041723723300028879PalsaMKIHAIQTGSVRVKRSFLFPQPGPRRQLDLFMPGAWSEPLPIH
Ga0311362_1021236713300029913BogMKIHAIQTGSVRVKHSFLYPGRGPRRQLGLFMPSAWS
Ga0311340_10034091103300029943PalsaMKIHAIQTGNVRVKHSFLFPSSGARRQLDLFRPGAWSDPLPIHCWAIE
Ga0311352_1139063523300029944PalsaMQIHALMTGTVSLKHAFLFPDSGPRRQLGLFLPGPFSEPM
Ga0302178_1021788113300030013PalsaMKIHALTTGTVSVKHGFLFPRHGARRQLDLFLPGAFSEPLPIH
Ga0311344_1049112313300030020BogMRIHAIQTGNVRVKHSFLFPGKGARRQLDLFMPGPWSDPLPIHC
Ga0302177_1006701213300030053PalsaMKIHALTSGRVRVKRSFLYPGHGPRRQLNLFLPGP
Ga0311349_1055173313300030294FenMKIHALTTGTVSLKHAFLYASTGWRRQIDLILPGKWYPPAPIHCWA
Ga0247826_1032762113300030336SoilMKIHALQTGTVSVKRSFLHASPGRRRQLDLLLPGPW
Ga0302184_1001550713300030490PalsaVKIHALTTGAVRVKHSFLYPASGPRRQLSLFLPDAWS
Ga0311372_1019418763300030520PalsaMKIHAIQTGTVQVKQSFLHPGRGPRRQLGLFMPSEWSEPLPIYCWA
Ga0311357_1062901813300030524PalsaMKIHAIQTGTVEVKHSFLFPAKGRRRQLDLFMPGAWSDPLPIYCWAIE
Ga0311355_1033305733300030580PalsaMKIHAIQTGNVRVKHSFLFPSSGARRQLDLFRPGAWSDPLPIHCWAIEHEG
Ga0311355_1159621313300030580PalsaMKIHALRTGTVSVKHGFLFPRHGARRQLDLFLPGAFSEPLPIHCWAI
Ga0311356_1111268613300030617PalsaMKIHALTTGTVSVKHGFLFPRHGARRQLDLFLPGAFSEPLPIHCWAI
Ga0311354_1079521313300030618PalsaMKIHALTTGAVSVKHGFLFPRHGARRQLDLFLPGAFSEPLPIHCWAIEHDG
Ga0302308_1033071513300031027PalsaMKIHALTTGKVRVKHSFLYPGHGPRRQLNLFLPGPWADSLPIHCWAIEHDGVLRLVD
Ga0302324_10048074713300031236PalsaMKIHALTTGTVSVKHSFLYPGTGPRRQLNLFLPGAFSAPLPIHCWAIEHEG
Ga0302320_1049959513300031524BogMKIHAIQTGNVRVKQSFLFPAKGARRQLDLFVPGAWSEP
Ga0302326_1008432583300031525PalsaMQIHALMTGTVSLKHAFLFPDSGPRRQLGLFLPGP
Ga0302326_1234892023300031525PalsaMKIHALTTGTVQVKHSFLFPGQGPRRQLNLFLPGAWADPLPIHCWAIEHDGVLRL
Ga0302326_1295514623300031525PalsaMRIHALTTGFVRLKRAFLHPSSGARRQLDLFLPGPF
Ga0318528_1080169423300031561SoilMRIHALTTGNVRVKHAFLFPSSGARRQLDLFLPGPWSDPLPIHSW
Ga0318555_1073051613300031640SoilMRIHALTTGNVRVKHAFLFPSSGARRQLDLFLPGPWSDPLPIHSWIIEHE
Ga0318561_1083605513300031679SoilMRIHALTTGNVRVKHAFLFPSSGARRQLDLFLPGPWSD
Ga0307478_1156228213300031823Hardwood Forest SoilMKIHALTTGAVRVKHSFLFPRQGARRQLDLFLPGPLSDPLPI
Ga0348332_1109801933300032515Plant LitterMKIHAVTTGAVRVKHSFLYPRHGPRRQLDLFLPGAFSDPLPIHC
Ga0370514_005533_3_1163300034199Untreated Peat SoilMKIHALTSGRVRVKRSFLYPGHGPRRQLNLFLPGPWAE
Ga0370492_0107481_3_1433300034282Untreated Peat SoilMRIHALQTGTVSVKRSFLFAGTGVRRQLDLFLPGPWSDPLPIHCWAI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.