NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077366

Metagenome / Metatranscriptome Family F077366

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077366
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 55 residues
Representative Sequence MIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNGIY
Number of Associated Samples 89
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 73.28 %
% of genes near scaffold ends (potentially truncated) 36.75 %
% of genes from short scaffolds (< 2000 bps) 87.18 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (40.171 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(47.863 % of family members)
Environment Ontology (ENVO) Unclassified
(75.214 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.598 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.43%    β-sheet: 10.71%    Coil/Unstructured: 67.86%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF03592Terminase_2 28.21
PF12957DUF3846 12.82
PF12236Head-tail_con 1.71
PF00149Metallophos 0.85
PF03237Terminase_6N 0.85
PF07120DUF1376 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG3728Phage terminase, small subunitMobilome: prophages, transposons [X] 28.21
COG3756Uncharacterized conserved protein YdaU, DUF1376 familyFunction unknown [S] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.76 %
UnclassifiedrootN/A16.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10082530All Organisms → Viruses → Predicted Viral1267Open in IMG/M
3300000116|DelMOSpr2010_c10096423All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1127Open in IMG/M
3300000116|DelMOSpr2010_c10149577All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.802Open in IMG/M
3300002482|JGI25127J35165_1122015All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.515Open in IMG/M
3300004829|Ga0068515_126701All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.721Open in IMG/M
3300004951|Ga0068513_1003198All Organisms → Viruses → Predicted Viral1718Open in IMG/M
3300006025|Ga0075474_10027146All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2033Open in IMG/M
3300006025|Ga0075474_10071372Not Available1147Open in IMG/M
3300006025|Ga0075474_10147327All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300006027|Ga0075462_10059766All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300006027|Ga0075462_10268226All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.503Open in IMG/M
3300006357|Ga0075502_1006375All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes916Open in IMG/M
3300006357|Ga0075502_1036497All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300006400|Ga0075503_1692966All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1040Open in IMG/M
3300006401|Ga0075506_1000585All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1202Open in IMG/M
3300006402|Ga0075511_1765243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes894Open in IMG/M
3300006403|Ga0075514_1104627All Organisms → Viruses → Predicted Viral1491Open in IMG/M
3300006637|Ga0075461_10175434All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella siphonis648Open in IMG/M
3300006735|Ga0098038_1000503Not Available17385Open in IMG/M
3300006735|Ga0098038_1241843All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.572Open in IMG/M
3300006802|Ga0070749_10433815All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.721Open in IMG/M
3300006802|Ga0070749_10494794All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.666Open in IMG/M
3300006810|Ga0070754_10095465All Organisms → Viruses → Predicted Viral1476Open in IMG/M
3300006810|Ga0070754_10275352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica762Open in IMG/M
3300006868|Ga0075481_10328283All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006916|Ga0070750_10098393Not Available1358Open in IMG/M
3300006916|Ga0070750_10406108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica568Open in IMG/M
3300006919|Ga0070746_10330458All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.695Open in IMG/M
3300006920|Ga0070748_1095505All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300006921|Ga0098060_1085208All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.904Open in IMG/M
3300006929|Ga0098036_1004587All Organisms → Viruses → Predicted Viral4716Open in IMG/M
3300007234|Ga0075460_10080963All Organisms → Viruses → Predicted Viral1184Open in IMG/M
3300007234|Ga0075460_10232378All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300007344|Ga0070745_1104214All Organisms → Viruses → Predicted Viral1107Open in IMG/M
3300007346|Ga0070753_1229850All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica678Open in IMG/M
3300007538|Ga0099851_1147245All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.878Open in IMG/M
3300007542|Ga0099846_1015556Not Available2976Open in IMG/M
3300007963|Ga0110931_1119292All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.793Open in IMG/M
3300009000|Ga0102960_1207675All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.698Open in IMG/M
3300009481|Ga0114932_10536752All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56687Open in IMG/M
3300010153|Ga0098059_1055682All Organisms → Viruses → Predicted Viral1586Open in IMG/M
3300010299|Ga0129342_1254160All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.612Open in IMG/M
3300010368|Ga0129324_10026592All Organisms → cellular organisms → Bacteria2802Open in IMG/M
3300011013|Ga0114934_10054542All Organisms → Viruses → Predicted Viral2048Open in IMG/M
3300012920|Ga0160423_10004578Not Available11359Open in IMG/M
3300012952|Ga0163180_10102701All Organisms → Viruses → Predicted Viral1826Open in IMG/M
3300012953|Ga0163179_10150069Not Available1742Open in IMG/M
3300017818|Ga0181565_10530407All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.762Open in IMG/M
3300017951|Ga0181577_10295934All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1052Open in IMG/M
3300017951|Ga0181577_10314774All Organisms → Viruses → Predicted Viral1013Open in IMG/M
3300017967|Ga0181590_10334648All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1091Open in IMG/M
3300017967|Ga0181590_10735764All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300017985|Ga0181576_10227252All Organisms → Viruses → Predicted Viral1210Open in IMG/M
3300017986|Ga0181569_10103055All Organisms → Viruses → Predicted Viral2033Open in IMG/M
3300018417|Ga0181558_10517935All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.619Open in IMG/M
3300018420|Ga0181563_10802494All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella siphonis515Open in IMG/M
3300018424|Ga0181591_10501784Not Available884Open in IMG/M
3300018424|Ga0181591_10576482All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.809Open in IMG/M
3300018424|Ga0181591_11145154All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.521Open in IMG/M
3300018428|Ga0181568_10445378All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300019708|Ga0194016_1014694All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300019751|Ga0194029_1064053All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella siphonis618Open in IMG/M
3300019751|Ga0194029_1066021All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.610Open in IMG/M
3300020269|Ga0211484_1045613All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.812Open in IMG/M
3300020281|Ga0211483_10101314Not Available950Open in IMG/M
3300020349|Ga0211511_1110292All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.635Open in IMG/M
3300020381|Ga0211476_10288441All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.560Open in IMG/M
3300020409|Ga0211472_10105393All Organisms → Viruses → Predicted Viral1114Open in IMG/M
3300020414|Ga0211523_10254880All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.722Open in IMG/M
3300020417|Ga0211528_10047771All Organisms → Viruses → Predicted Viral1887Open in IMG/M
3300020422|Ga0211702_10278950All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.523Open in IMG/M
3300020436|Ga0211708_10311165All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.641Open in IMG/M
3300020464|Ga0211694_10487979All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56536Open in IMG/M
3300020468|Ga0211475_10342169Not Available731Open in IMG/M
3300021364|Ga0213859_10063341Not Available1758Open in IMG/M
3300021958|Ga0222718_10425880All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.657Open in IMG/M
3300021959|Ga0222716_10090236All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2088Open in IMG/M
3300021959|Ga0222716_10355502All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella siphonis866Open in IMG/M
3300021960|Ga0222715_10010434Not Available7454Open in IMG/M
3300021961|Ga0222714_10168482Not Available1295Open in IMG/M
3300022050|Ga0196883_1001395Not Available2668Open in IMG/M
3300022050|Ga0196883_1019046All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.823Open in IMG/M
3300022057|Ga0212025_1018624All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300022057|Ga0212025_1030451All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.907Open in IMG/M
3300022057|Ga0212025_1059049All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300022065|Ga0212024_1016280All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300022067|Ga0196895_1014301All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.865Open in IMG/M
3300022068|Ga0212021_1063011All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.758Open in IMG/M
3300022068|Ga0212021_1070451All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica716Open in IMG/M
3300022069|Ga0212026_1042934All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella siphonis677Open in IMG/M
3300022069|Ga0212026_1044594All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.665Open in IMG/M
3300022071|Ga0212028_1005544All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1807Open in IMG/M
3300022074|Ga0224906_1128489All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.728Open in IMG/M
3300022167|Ga0212020_1026680All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300022167|Ga0212020_1041721All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.777Open in IMG/M
3300022168|Ga0212027_1017068All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.996Open in IMG/M
3300022168|Ga0212027_1043224All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella siphonis576Open in IMG/M
3300022183|Ga0196891_1058395All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.695Open in IMG/M
3300022183|Ga0196891_1058826All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.692Open in IMG/M
3300022187|Ga0196899_1185516All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.558Open in IMG/M
3300022934|Ga0255781_10078699All Organisms → Viruses → Predicted Viral1856Open in IMG/M
3300025086|Ga0208157_1003694Not Available5888Open in IMG/M
3300025099|Ga0208669_1007993All Organisms → Viruses → Predicted Viral3076Open in IMG/M
3300025674|Ga0208162_1036298Not Available1756Open in IMG/M
3300025769|Ga0208767_1213265All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.637Open in IMG/M
3300025771|Ga0208427_1062815All Organisms → Viruses → Predicted Viral1342Open in IMG/M
3300025803|Ga0208425_1133333All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300025818|Ga0208542_1070521All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1049Open in IMG/M
3300025889|Ga0208644_1157203All Organisms → Viruses → Predicted Viral1035Open in IMG/M
3300029318|Ga0185543_1040052Not Available1028Open in IMG/M
3300029448|Ga0183755_1000344Not Available28215Open in IMG/M
3300032136|Ga0316201_10894644All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.749Open in IMG/M
3300034374|Ga0348335_060037Not Available1400Open in IMG/M
3300034374|Ga0348335_066436All Organisms → Viruses → Predicted Viral1288Open in IMG/M
3300034374|Ga0348335_108298All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Aquicella → Aquicella siphonis853Open in IMG/M
3300034375|Ga0348336_070410All Organisms → Viruses → Predicted Viral1316Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous47.86%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh11.97%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.97%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.69%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.27%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.56%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.71%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.71%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.71%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.71%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.85%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.85%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.85%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.85%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.85%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water0.85%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.85%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019708Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MGEnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020269Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041)EnvironmentalOpen in IMG/M
3300020281Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116)EnvironmentalOpen in IMG/M
3300020349Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859)EnvironmentalOpen in IMG/M
3300020381Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620)EnvironmentalOpen in IMG/M
3300020409Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020417Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020464Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1008253063300000116MarineGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEENTYGN*
DelMOSpr2010_1009642323300000116MarineMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVHKTIEKKPITKMEDKHGIY*
DelMOSpr2010_1014957723300000116MarineMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKHGIY*
JGI25127J35165_112201513300002482MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLKKEDKNGI
Ga0068515_12670123300004829Marine WaterMIKMRIKGKLYTGQSVYDCLCQAVRQPINIRAKMVDVNKLISKTNITKNENKNGIY*
Ga0068513_100319863300004951Marine WaterMIKMRIKGKLYTGQSVYDCLCQAVRQPINIRAKMVDVNKLISKTNITKKENKNGIY*
Ga0075474_1002714623300006025AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVHKTIEKKPITKMEDKNGIY*
Ga0075474_1007137233300006025AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNGIY*
Ga0075474_1014732723300006025AqueousYSYQTRKQEGMVMVKMRIKGILYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY*
Ga0075462_1005976623300006027AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPIIKMEENTYGN*
Ga0075462_1026822623300006027AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPIT
Ga0075502_100637523300006357AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPINKMEDKHGIY*
Ga0075502_103649713300006357AqueousVMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYGN*
Ga0075503_169296623300006400AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVHKTIEKKPITKMEDKNGIY*
Ga0075506_100058513300006401AqueousGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPINKMEDKHGIY*
Ga0075511_176524323300006402AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNGIY*
Ga0075514_110462713300006403AqueousGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNGIY*
Ga0075461_1017543423300006637AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEENTYGN*
Ga0098038_1000503393300006735MarineGVGQMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLTKEDKDGIH
Ga0098038_124184323300006735MarineGVGQMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVNKLISKQPKLTKENKDGIY
Ga0070749_1043381523300006802AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITK
Ga0070749_1049479433300006802AqueousREDIMIKMRIKGILYTGKTVYECLCKAVREPINIHAKMVDVEKTISKKPITKMEDKNGIY
Ga0070754_1009546553300006810AqueousMVKMRIKGILYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY*
Ga0070754_1027535213300006810AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPIIKMEENTYGN*
Ga0075481_1032828313300006868AqueousTRKQEGMVMVKMRIKGILYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY*
Ga0070750_1009839333300006916AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPI
Ga0070750_1040610823300006916AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKM
Ga0070746_1033045833300006919AqueousGKHMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVHKTIEKKPITKMEDKNGIY*
Ga0070748_109550533300006920AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEENTYGN*
Ga0098060_108520823300006921MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVNKLISKQPKLTKENKNGIY*
Ga0098036_1004587103300006929MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVNKLISKQPKLTKENKDGIY*
Ga0075460_1008096323300007234AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYGN*
Ga0075460_1023237813300007234AqueousMVMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEENTYGN*
Ga0070745_110421423300007344AqueousMVMVKMRIKGILYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY*
Ga0070753_122985013300007346AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPIIK
Ga0099851_114724523300007538AqueousMVMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKHGIY*
Ga0099846_101555663300007542AqueousMVMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNGIY*
Ga0110931_111929243300007963MarineQDYIGVGQMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLTKEDKDGIH*
Ga0102960_120767523300009000Pond WaterMIKMRIKGVLYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYGN*
Ga0114932_1053675223300009481Deep SubsurfaceMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKKPITKKEDKNGIY*
Ga0098059_105568243300010153MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLTKEDKDGIH*
Ga0129342_125416013300010299Freshwater To Marine Saline GradientIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNGIY*
Ga0129324_10026592103300010368Freshwater To Marine Saline GradientMVMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYGN*
Ga0114934_1005454243300011013Deep SubsurfaceMIKMRIKGKLYTGQSVYDCLCQAVRQPINIRAKMVDVHKLISKKPITKKEDKNGIY*
Ga0160423_10004578173300012920Surface SeawaterMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVNKLISKQPKLKKEDKNGIY*
Ga0163180_1010270123300012952SeawaterMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLTKEDKDGIY*
Ga0163179_1015006963300012953SeawaterMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLKKEDKDGIH*
Ga0181565_1053040723300017818Salt MarshMIKMRIKGKLYTGQTVYECLCKAVKEPINIHAKMVDINETIKNKPIKPKEDNHGLY
Ga0181577_1029593423300017951Salt MarshMIKMRIKGVLYTGKTVYECLCKAVKEPINIHAKMVDINQTIKNKPIKPKEDNHGLY
Ga0181577_1031477433300017951Salt MarshMSGNIKMRIKGVLYTGQTVYECLCKAVKEPINIHAKMVDINETIKNKPIKPKEDNHGLY
Ga0181590_1033464813300017967Salt MarshMRIKGILYTGKTVYECLCKAVRQPIDIHAKMVDVNKTIEKKPITKMEDKNGIY
Ga0181590_1073576413300017967Salt MarshLYTGKTVYECLCKAVREPIDIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0181576_1022725223300017985Salt MarshMIKMRIKGKLYTGQSVYDCLCQAVRQPINIRAKMVDVNKLISKTNITKKEDNNGIY
Ga0181569_1010305563300017986Salt MarshMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVNKLISKTNITKKEDKNGIY
Ga0181558_1051793523300018417Salt MarshLVVNRIKIMEGYVMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVNKLISKTNITKKEDKNGIY
Ga0181563_1080249413300018420Salt MarshMIKMRIKGVLYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEENTYGN
Ga0181591_1050178413300018424Salt MarshMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNGIY
Ga0181591_1057648233300018424Salt MarshYVMIKMRIKGKLYTGQSVYDCLCQAVRQPINIRAKMVDVNKLISKTNITKKEDNNGIY
Ga0181591_1114515413300018424Salt MarshKRRYVMNGNIKMRIKGVLYTGKTVYDCLCKAVREPINIHAKMVDIEKTIAKKPITKMEDKNGIY
Ga0181568_1044537833300018428Salt MarshMIKMRIKGKLYTGQTVYDCLCQAVRQPINIHAKMVDVNKLISKTNITKKEDKNG
Ga0194016_101469413300019708SedimentMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEENTYGN
Ga0194029_106405323300019751FreshwaterMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEENTYGN
Ga0194029_106602113300019751FreshwaterMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYGN
Ga0211484_104561333300020269MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLKKEDKNGIY
Ga0211483_1005485143300020281MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIRAKMVDVHKLISKKP
Ga0211483_1010131433300020281MarineMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLKKEDKNGIY
Ga0211511_111029223300020349MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIRAKMVDVHKLISKKPITKKEDKDGIY
Ga0211476_1028844123300020381MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKKPITKKEDKNGIY
Ga0211472_1010539343300020409MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIRAKMVDVHKLISKKPITKKEDKNGIY
Ga0211523_1025488033300020414MarineMIKMRIKGKLYTGQTVYDCLCQAVRQPINIHAKMVDVNKLISKTNITKKEDKNGIY
Ga0211528_1004777133300020417MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVNKLISKQPKLKKEDKNGIY
Ga0211702_1027895023300020422MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKKPITKKEDNDGIY
Ga0211708_1031116513300020436MarineQQDVGVGQMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLKKEDKNGIY
Ga0211694_1048797923300020464MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLNKEDKNGIY
Ga0211475_1034216923300020468MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLTKEDKNDK
Ga0213859_1006334133300021364SeawaterMVKMRIKGILYTGKTVYECLCKAVREPINIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0222718_1042588033300021958Estuarine WaterMIKMRIKGVLYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQTKAKEGNYGNVNKR
Ga0222716_1009023683300021959Estuarine WaterMSGNIKMRIKGVLYTGKTVYDCLCKAIREPINIHAKMVDIEKKIQNKPINKMEENNGIY
Ga0222716_1035550223300021959Estuarine WaterMIKMRIKGVLYTGKTVFDCLCKAIREPINIHAKMVDIEKKIQNKSITKMEENTYGN
Ga0222715_10010434123300021960Estuarine WaterMVKMRIKGILYTGKTVYECLCKAIREPINIHAKMVDIEKKIQNKPINKMEENTYGN
Ga0222714_1016848223300021961Estuarine WaterMIKMRIKGVLYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYGN
Ga0196883_100139563300022050AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPINKMEDKHGIY
Ga0196883_101904623300022050AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0212025_101862413300022057AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKME
Ga0212025_103045123300022057AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNGIY
Ga0212025_105904913300022057AqueousGILYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0212024_101628023300022065AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPIIKMEENTYGN
Ga0196895_101430113300022067AqueousLMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPINKMEDKHGIY
Ga0212021_106301123300022068AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYGN
Ga0212021_107045113300022068AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNG
Ga0212026_104293413300022069AqueousVMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYGN
Ga0212026_104459423300022069AqueousKHMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0212028_100554433300022071AqueousMVKMRIKGILYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0224906_112848923300022074SeawaterMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLTKEDKNGIH
Ga0212020_102668023300022167AqueousQTRKQEGMVMVKMRIKGILYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0212020_104172133300022167AqueousKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPINKMEDKHGIY
Ga0212027_101706843300022168AqueousVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKNGIY
Ga0212027_104322413300022168AqueousYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYGN
Ga0196891_105839513300022183AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIQKKPITKMEENTYG
Ga0196891_105882623300022183AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKHGIY
Ga0196899_118551623300022187AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVHKTIEKKPITKMEENTYGN
Ga0255781_1007869963300022934Salt MarshMIKMRIKGVLYTGKSVYECLCKAVKEPINIHAKMVDINQTIKNKPIKPKEDNHGLY
Ga0208157_100369453300025086MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKQPKLTKEDKDGIH
Ga0208669_1007993113300025099MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVNKLISKQPKLTKENKNGIY
Ga0208162_103629823300025674AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDKHGIY
Ga0208767_121326513300025769AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKW
Ga0208427_106281513300025771AqueousSYQTRKQEGMVMVKMRIKGILYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0208425_113333313300025803AqueousMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEDK
Ga0208542_107052123300025818AqueousMIKMRIKGILYTGKTVYECLCKAVREPINIHAKMVDVEKTISKKPITKMEDKNGIY
Ga0208644_115720333300025889AqueousEGMVMVKMRIKGILYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0185543_104005233300029318MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVNKLISKQPKLKKEDKNGIH
Ga0183755_100034423300029448MarineMIKMRIKGKLYTGQSVYDCLCQAVRQPINIHAKMVDVHKLISKKPITKKEDKDGIY
Ga0316201_1089464423300032136Worm BurrowMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPITKMEEN
Ga0348335_060037_1111_12873300034374AqueousMVMVKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPINKMEDKHGIY
Ga0348335_066436_2_1423300034374AqueousYTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY
Ga0348335_108298_443_6133300034374AqueousMIKMRIKGILYTGKTVYECLCKAVREPIDIHAKMVDVNKTIEKKPINKMEENTYGN
Ga0348336_070410_3_1403300034375AqueousTGKTVYECLCKAVRQPIDIHAKMVDVHKTIEKKPITKMEDKNGIY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.