NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077335

Metagenome / Metatranscriptome Family F077335

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077335
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 205 residues
Representative Sequence DEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFNQFAQLRADPPSTGVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Number of Associated Samples 93
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.87 %
% of genes near scaffold ends (potentially truncated) 92.31 %
% of genes from short scaffolds (< 2000 bps) 98.29 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.291 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(40.171 % of family members)
Environment Ontology (ENVO) Unclassified
(76.923 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(70.085 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.73%    β-sheet: 23.45%    Coil/Unstructured: 66.81%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.29 %
UnclassifiedrootN/A1.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009436|Ga0115008_10173484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1557Open in IMG/M
3300009543|Ga0115099_10349091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300009544|Ga0115006_10602547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani964Open in IMG/M
3300009608|Ga0115100_10299465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300009677|Ga0115104_10740970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300010985|Ga0138326_11609392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani816Open in IMG/M
3300010987|Ga0138324_10300384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani768Open in IMG/M
3300012504|Ga0129347_1049466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani876Open in IMG/M
3300012518|Ga0129349_1242372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300012520|Ga0129344_1015978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300012963|Ga0129340_1230062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300012965|Ga0129346_1059849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300012966|Ga0129341_1195901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300016781|Ga0182063_1023585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300016781|Ga0182063_1270318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300017710|Ga0181403_1116903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300017951|Ga0181577_10480657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani780Open in IMG/M
3300018538|Ga0193022_104102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300018599|Ga0188834_1008434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1040Open in IMG/M
3300018724|Ga0193391_1034086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300018742|Ga0193138_1021707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani831Open in IMG/M
3300018742|Ga0193138_1037432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300018749|Ga0193392_1053753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300018765|Ga0193031_1020453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani968Open in IMG/M
3300018765|Ga0193031_1027014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani884Open in IMG/M
3300018765|Ga0193031_1027541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani878Open in IMG/M
3300018765|Ga0193031_1044632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani729Open in IMG/M
3300018776|Ga0193407_1062966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300018806|Ga0192898_1039899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300018823|Ga0193053_1034467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani815Open in IMG/M
3300018823|Ga0193053_1062077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300018825|Ga0193048_1040880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300018838|Ga0193302_1060914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300018838|Ga0193302_1068768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300018842|Ga0193219_1026936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani869Open in IMG/M
3300018852|Ga0193284_1039181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani721Open in IMG/M
3300018852|Ga0193284_1046123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300018852|Ga0193284_1046953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani665Open in IMG/M
3300018860|Ga0193192_1043395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300018870|Ga0193533_1081837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300018932|Ga0192820_10037608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1015Open in IMG/M
3300018932|Ga0192820_10046530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani936Open in IMG/M
3300018932|Ga0192820_10069802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300018932|Ga0192820_10070202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani790Open in IMG/M
3300018955|Ga0193379_10025896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1501Open in IMG/M
3300018955|Ga0193379_10126790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani722Open in IMG/M
3300018955|Ga0193379_10201393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300018955|Ga0193379_10203822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300018967|Ga0193178_10048108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300018980|Ga0192961_10129396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani769Open in IMG/M
3300018982|Ga0192947_10053162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1269Open in IMG/M
3300018989|Ga0193030_10082396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani954Open in IMG/M
3300018989|Ga0193030_10171688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300019010|Ga0193044_10255495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300019025|Ga0193545_10141145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani514Open in IMG/M
3300019032|Ga0192869_10257389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300019032|Ga0192869_10263800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300019045|Ga0193336_10312091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300019103|Ga0192946_1042467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300019117|Ga0193054_1044067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300019118|Ga0193157_1034442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300020055|Ga0181575_10587736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300020436|Ga0211708_10270780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300021169|Ga0206687_1156328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300021350|Ga0206692_1249394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani872Open in IMG/M
3300021350|Ga0206692_1614738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani712Open in IMG/M
3300021875|Ga0063146_127799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300021921|Ga0063870_1026313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300021924|Ga0063085_1005563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1196Open in IMG/M
3300021926|Ga0063871_1049101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani959Open in IMG/M
3300021930|Ga0063145_1039486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300021930|Ga0063145_1066133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300021941|Ga0063102_1019187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300021950|Ga0063101_1065179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani744Open in IMG/M
3300023175|Ga0255777_10291767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani927Open in IMG/M
3300023698|Ga0228682_1040230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300026448|Ga0247594_1054570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300026468|Ga0247603_1070967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300026495|Ga0247571_1076801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani768Open in IMG/M
3300028290|Ga0247572_1184695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300031032|Ga0073980_11393959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300031032|Ga0073980_11402478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani869Open in IMG/M
3300031037|Ga0073979_10002230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani789Open in IMG/M
3300031037|Ga0073979_12457130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300031062|Ga0073989_10011263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani985Open in IMG/M
3300031062|Ga0073989_10025180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani845Open in IMG/M
3300031737|Ga0307387_10581498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani699Open in IMG/M
3300032463|Ga0314684_10679085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani594Open in IMG/M
3300032470|Ga0314670_10430567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300032492|Ga0314679_10340471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani684Open in IMG/M
3300032518|Ga0314689_10665482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300032519|Ga0314676_10362378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani858Open in IMG/M
3300032519|Ga0314676_10738752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300032521|Ga0314680_10543155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani733Open in IMG/M
3300032540|Ga0314682_10496028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300032615|Ga0314674_10466849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani654Open in IMG/M
3300032650|Ga0314673_10490497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300032666|Ga0314678_10320667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani698Open in IMG/M
3300032707|Ga0314687_10432709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300032708|Ga0314669_10469452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani692Open in IMG/M
3300032713|Ga0314690_10583048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300032714|Ga0314686_10391194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300032725|Ga0314702_1228089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300032727|Ga0314693_10337978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300032729|Ga0314697_10284872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani737Open in IMG/M
3300032730|Ga0314699_10258504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani778Open in IMG/M
3300032732|Ga0314711_10529226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani603Open in IMG/M
3300032733|Ga0314714_10557256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300032743|Ga0314707_10563492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300032747|Ga0314712_10457089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani604Open in IMG/M
3300032748|Ga0314713_10286270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300032750|Ga0314708_10283503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani813Open in IMG/M
3300032754|Ga0314692_10411781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300032755|Ga0314709_10356099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani902Open in IMG/M
3300032755|Ga0314709_10646659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine40.17%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater23.93%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine16.24%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.98%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.27%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.27%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.56%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.85%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.85%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018538Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002101 (ERX1789665-ERR1719366)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018724Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789589-ERR1719194)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018806Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000722 (ERX1789621-ERR1719484)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018852Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001606 (ERX1809471-ERR1739847)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021926Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 ARK-20-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075488_156759613300006397AqueousDITMKGNKFHFVEKPAQLAQFATGMNGDEDLGEDITMKGNKFHFNQNYVQFATGMNGDEDLGEDITMKGNKFHFVEKPEELVQFATGMNGDEDLGEDITMKGNKFHFVQNPLSAHALAQAEPASTAVVYDTKGYPAPDKVDEHFDPKIAKAHTTFYNKK*
Ga0103876_103336123300009269Surface Ocean WaterGQDITMKGEKFDYNQPSFVQFATGMNGDEDLGQDITMKGEKFHYNQSNLVQFATGMNGDEDLGQDITMKGDKFHFAQNLAQAPKSGSSGGTAIVYDTTGYGPVEKLSFFDPKITKAHTSFYAQ*
Ga0115008_1017348433300009436MarineMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDMGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFAQNVQLSAEPAAKPSTGVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0115099_1034909113300009543MarineDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0115006_1060254713300009544MarineFATGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDMGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFAQNVQLSAEPAAKPSTGVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0115100_1029946513300009608MarineQLFATGMNGDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFAQNNYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0115104_1074097013300009677MarineDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQRPTNYVQFATGMNGDEDLGEDITMKGDKFHFNQYIQTGSHFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTS
Ga0138326_1160939213300010985MarinePSNNQLFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQFAQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPQAQALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQIRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTS
Ga0138324_1030038413300010987MarineQRPASKKLFATGMNGDEDLGEDITMKGDKFHYVQRPSQQKLFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK*
Ga0129347_104946613300012504AqueousGMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDISMKGDKFHFNQKPHRLVQFATGMNGDEDLGEDISMKGDKFHFNQRPQANALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQVKAEPSTAVVYDTTGYGPNGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0129349_124237213300012518AqueousMKGDKFHFNQKPHRLVQFATGMNGDEDLGEDITMKGDKFHFNQRPQANALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLKAEPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0129344_101597813300012520AqueousKFHFNQRPQANALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQVKAEPSTAVVYDTTGYGPNGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0129340_123006213300012963AqueousMKGDKFHFNQKPHRLVQFATGMNGDEDLGEDITMKGDKFHFNQRPQANALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTESRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQVKAEPSTAVVYDTTGYGPNGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0129346_105984913300012965AqueousLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQVKAEPSTAVVYDTTGYGPNGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0129341_119590113300012966AqueousKFHFNQRPQANALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAEIKAEPSTAVVYNTTGYGPNGGVEKLSFFDPKVAKAHTSFYNKK*
Ga0182063_102358513300016781Salt MarshSFFDPKITKAHTTFYAQFATGMNGDEDLGEDITMKGDKFHFNQRPQRLSQFATGMNGDEDLGEDITMKGDKFHFVQRPQRLTQFATGMNGDEDLGEDITMKGDKFHFVQRPYRLSQFATGMNGDEDLGEDITMKGDKFHFAQNLAQAEPIVYDTKGYGPVEKLSFFDPKITKAHTTFYAQADPSPSPEPEKVAILDPKIA
Ga0182063_127031813300016781Salt MarshMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLKAEPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0181403_111690313300017710SeawaterQAHNYFATGMNGDEDLGEDITMMGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPQAHNYFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTKADPPSTAVVYDTKGYGANF
Ga0181577_1048065713300017951Salt MarshFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQSGSRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLKAEPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193022_10410213300018538MarineGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLRADPPSTGVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0188834_100843423300018599Freshwater LakeMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193391_103408613300018724MarinePHRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTAVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193138_102170713300018742MarineKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193138_103743213300018742MarineKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQARADPPSTEVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193392_105375313300018749MarineAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193031_102045313300018765MarineKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193031_102701413300018765MarineMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPYRLSQFATGMNGDEDLGEDITMKGDKFHFNQRPQAHNLFATGMNGDEDLGEDITMKGDKFHFNQRPTNYVQFATGMNGDEDLGEDITMKGDKFHFNQYIQTGSHFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193031_102754113300018765MarineKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193031_104463213300018765MarineATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPSQYVQFATGMNGDEDLGEDITMKGDKFHFNQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTHADPPATGVVYDTKGYGANGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193407_106296613300018776MarineGEDITMKGDKFHFNQKPAQHNFAQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0192898_103989913300018806MarineMKGDKFHFAQNRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPHAQALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTAEPVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193053_103446713300018823MarineATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPQAHNYFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTRADPPSTAVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193053_106207713300018823MarineAQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQSNLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQARADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAK
Ga0193048_104088013300018825MarineGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPQAHNYFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTAEPVVYDTKGYG
Ga0193302_106091413300018838MarineGEDITMKGDKFHFNQRPAAHNYFATGMNGDEDLGEDITMKGDKFHFNQRPATHNYFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193302_106876813300018838MarineKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPATHNYFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193219_102693613300018842MarineKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPAAHNYFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLLQTRADPPSTAVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193284_103918113300018852MarineMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQQRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193284_104612313300018852MarineCTQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQQRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193284_104695313300018852MarineQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQQRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193192_104339513300018860MarineTGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193533_108183713300018870MarineLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPQAHNYFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGY
Ga0192820_1003760813300018932MarineKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPQAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLA
Ga0192820_1004653013300018932MarineDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPQAHNYFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTRADPPSTAVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0192820_1006980213300018932MarineNQRPQAHNYFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTRADPPSTAVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0192820_1007020213300018932MarineMGPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTRADPPSTAVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193379_1002589623300018955MarineMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYIQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193379_1012679013300018955MarineQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPSQYVQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYIQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193379_1020139313300018955MarineGDKFHFNQRPATHNYFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193379_1020382213300018955MarineDKFHFNQRPETGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193178_1004810813300018967MarineHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQVRADPPSTGVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0192961_1012939613300018980MarineEDITMKGDKFHYVQRPAQHTLFATGMNGDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0192947_1005316223300018982MarineMNGDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDMGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193030_1008239613300018989MarineGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQRPSQYVQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLRADPPSTGVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193030_1017168813300018989MarineNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193044_1025549513300019010MarineMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193545_1014114513300019025MarineGLFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0192869_1025738913300019032MarineATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGPNGGVEKLSFFDPKIPKAHTSFYNKK
Ga0192869_1026380013300019032MarineATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTAEPVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193336_1031209113300019045MarineTWEHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIA
Ga0192946_104246713300019103MarineATGMNGDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0193054_104406713300019117MarineGEDITMKGDKFHFNQRPQAHNYFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTKADPPSTAVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0193157_103444213300019118MarineITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0181575_1058773613300020055Salt MarshDITMKGDKFHFNQRPQANALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLKAEPSTAVVYDSKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0211708_1027078013300020436MarineYHYTQKKTQSRAQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTKADPPSTAVVYDTKGYGANGGVEKLSFFDPKIAKAHTSFYNKK
Ga0206687_115632813300021169SeawaterDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPYRLSQFATGMNGDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0206692_124939413300021350SeawaterDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPYRLSQFATGMNGDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0206692_161473813300021350SeawaterRLAQFATGMNGDEDLGEDITMKGDKFHFNQRRNNLVQFATGMNGDEDLGEDITMKGDKFHFNQRPSQYVQFATGMNGDEDLGEDITMKGDKFHFNQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQTHADPPATGVVYDTKGYGANGGVEKLSFFDPKIAKAHTSFYNKK
Ga0063146_12779913300021875MarineDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFNQFAQLRADPPSTGVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0063870_102631313300021921MarineFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFAQNVQLSAEPVKYDTKGYGANGGVEKLSFFDPKVAKAH
Ga0063085_100556323300021924MarineMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDMGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFAQNVQLSAEPAAKPSTGVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0063871_104910123300021926MarineMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDMGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFAQNVQLSAEPAAKPS
Ga0063145_103948613300021930MarineMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYIQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFNQFAQLRADPPSTGVVYDTKGY
Ga0063145_106613313300021930MarineGDEDLGEDITMKGDKFHFNQRPHAQALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQAHAEPVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0063102_101918713300021941MarineITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDMGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFAQNVQLSAEPAAKPSTGVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0063101_106517913300021950MarineKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDMGEDITMKGDKFHFNQNLVQFATGMNGDEDMGEDITMKGDKFHFAQNVQLSAEPAAKPSTGVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYN
Ga0255777_1029176713300023175Salt MarshDEDLGEDITMKGDKFHFNQRPQANALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSRFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQLKAEPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0228682_104023013300023698SeawaterSALALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0247594_105457013300026448SeawaterGDEDLGDDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0247603_107096713300026468SeawaterDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0247571_107680113300026495SeawaterITMKGDKFHFNQKPYRLSQFATGMNGDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDLGEDITMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0247572_118469513300028290SeawaterITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFAQNNLVQFATGMNGDEDLGEDITMKGDKFHFNQFAQVRADPPSTDVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0073980_1139395913300031032MarineAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYIQTGSKFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNK
Ga0073980_1140247813300031032MarineVSCTPSNNQLFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0073979_1000223013300031037MarineGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQKPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTGVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0073979_1245713023300031037MarineMAQFATGMNGDEDLGEDITMKGDKFHFIQRPAANKLFATGMNGDEDLGEDITMKGDHFHYMQRPAEQKLFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTAVVYDTKGYGPNGGVEKLSFFDPKVAKAHTSFYNKK
Ga0073989_1001126313300031062MarineMYGVKGVSCTPANNQLFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFVQGLAQADPPSTAVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYN
Ga0073989_1002518013300031062MarineATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFNQHPAQHNLAQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDLGEDITMKGDKFHFVQGLAQARADPPSTEVVYDTKGYGPNGGVEKLSFFDPKIAKAHTSFYNKK
Ga0307387_1058149813300031737MarineFHFNQKPYRLSQFATGMNGDEDLGEDITMKGDKFHFNQRPSAHALFATGMNGDEDLGEDISMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQYLQTGSHFATGMNGDEDMGEDITMKGDKFHFAQNNYVQFATGMNGDEDMGEDISMKGDKFHFNQFVQTRADPPSTDVVYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314684_1067908513300032463SeawaterDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314670_1043056713300032470SeawaterDADLGEANPMTGDKFNFQQHAHRLAQFATGMTGDEDLGEDITMKGDKFHFNQRPHSQAHFATVMNGDDDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314679_1034047113300032492SeawaterTGMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTS
Ga0314689_1066548213300032518SeawaterAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314676_1036237813300032519SeawaterQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSAEPVKYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314676_1073875213300032519SeawaterMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314680_1054315513300032521SeawaterQFATGMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFASGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314682_1049602813300032540SeawaterGDEDLGEDITMKGDKFHFAQHNLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNIQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTS
Ga0314674_1046684913300032615SeawaterGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314673_1049049713300032650SeawaterQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314678_1032066713300032666SeawaterMIGDEELGDDITLKVDNFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314687_1043270913300032707SeawaterQFATGMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314669_1046945213300032708SeawaterDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHTLAQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNIQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314690_1058304813300032713SeawaterFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGYKFHFKQNLAQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTGVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314686_1039119413300032714SeawaterMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNK
Ga0314702_122808913300032725SeawaterGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314693_1033797813300032727SeawaterTGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSAEPVKYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314697_1028487213300032729SeawaterMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314699_1025850413300032730SeawaterQVESACAMFGVDGVTCAPANNELFATGMNGDEDLGEDITMKGDKFHFQQMAQAKFATGMNGDEDLGEDITMKGDKFHFNQKPHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314711_1052922613300032732SeawaterDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314714_1055725613300032733SeawaterLALFLGTASTVSINENFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDP
Ga0314707_1056349213300032743SeawaterDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314712_1045708913300032747SeawaterMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314713_1028627013300032748SeawaterGMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314708_1028350323300032750SeawaterMNGDEDLGEDITMKGEKFHLAQHQLAQFATGMKGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314692_1041178113300032754SeawaterFATGMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSAYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314709_1035609913300032755SeawaterQFATGMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFNQRPHSQALFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSAEPVKYDTKGYGANGGVEKLSFFDPKVAKAHTSFYNKK
Ga0314709_1064665913300032755SeawaterQFATGMNGDEDLGEDITMKGDKFHFAQHQLAQFATGMNGDEDLGEDITMKGDKFHFQQKAHRLAQFATGMNGDEDLGEDITMKGDKFHFQQKPSSYVQFATGMNGDEDLGEDITMKGDKFHFAQHNLVQFATGMNGDEDLGEDITMKGDKFHFNQNLVQFATGMNGDEDLGEDITMKGDKFHFAQNVQLSGEPAAKPSTDVTYDTKGYGAN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.