NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077333

Metagenome / Metatranscriptome Family F077333

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077333
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 73 residues
Representative Sequence AHNPEVTYGEQLDTVPGWYNGEHNVTDCDTALTVATGNGTELNFAPGSIVVDPWRKTPDIDGVEVIHYGNTRETR
Number of Associated Samples 107
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.85 %
% of genes near scaffold ends (potentially truncated) 97.44 %
% of genes from short scaffolds (< 2000 bps) 87.18 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (48.718 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(15.385 % of family members)
Environment Ontology (ENVO) Unclassified
(62.393 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(82.906 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.88%    β-sheet: 11.65%    Coil/Unstructured: 84.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF13186SPASM 29.91
PF136402OG-FeII_Oxy_3 12.82
PF13394Fer4_14 3.42
PF00155Aminotran_1_2 1.71
PF00487FA_desaturase 0.85
PF03721UDPG_MGDP_dh_N 0.85
PF04055Radical_SAM 0.85
PF13353Fer4_12 0.85
PF136612OG-FeII_Oxy_4 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.85
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.85
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.85
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.85
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.85
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.85
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.28 %
UnclassifiedrootN/A48.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000928|OpTDRAFT_10122487All Organisms → cellular organisms → Bacteria → Proteobacteria5944Open in IMG/M
3300001833|ACM24_1013888Not Available631Open in IMG/M
3300002176|JGI24820J26691_1044120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium916Open in IMG/M
3300004461|Ga0066223_1230268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37575Open in IMG/M
3300005606|Ga0066835_10310822All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300005971|Ga0066370_10221508All Organisms → cellular organisms → Bacteria → Proteobacteria665Open in IMG/M
3300006400|Ga0075503_1386484All Organisms → cellular organisms → Bacteria → Proteobacteria712Open in IMG/M
3300006641|Ga0075471_10598994Not Available541Open in IMG/M
3300006867|Ga0075476_10351428Not Available510Open in IMG/M
3300006869|Ga0075477_10329811Not Available602Open in IMG/M
3300006920|Ga0070748_1156567All Organisms → cellular organisms → Bacteria → Proteobacteria846Open in IMG/M
3300006924|Ga0098051_1003706All Organisms → cellular organisms → Bacteria5157Open in IMG/M
3300007113|Ga0101666_1046500All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria798Open in IMG/M
3300007539|Ga0099849_1172519Not Available826Open in IMG/M
3300007647|Ga0102855_1020195All Organisms → Viruses → Predicted Viral1838Open in IMG/M
3300007758|Ga0105668_1182332All Organisms → Viruses → Predicted Viral1014Open in IMG/M
3300008956|Ga0104261_1029304Not Available668Open in IMG/M
3300009002|Ga0102810_1021617All Organisms → Viruses → Predicted Viral2159Open in IMG/M
3300009071|Ga0115566_10018582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5110Open in IMG/M
3300009080|Ga0102815_10497671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium681Open in IMG/M
3300009420|Ga0114994_10556178Not Available754Open in IMG/M
3300009420|Ga0114994_10556179Not Available754Open in IMG/M
3300009425|Ga0114997_10764666Not Available503Open in IMG/M
3300009441|Ga0115007_10082888All Organisms → Viruses → Predicted Viral2027Open in IMG/M
3300009495|Ga0115571_1185186Not Available858Open in IMG/M
3300009526|Ga0115004_10639847Not Available630Open in IMG/M
3300009608|Ga0115100_11170822Not Available606Open in IMG/M
3300009785|Ga0115001_10147709All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300010150|Ga0098056_1102393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium977Open in IMG/M
3300010297|Ga0129345_1116013Not Available984Open in IMG/M
3300010297|Ga0129345_1162446Not Available803Open in IMG/M
3300010299|Ga0129342_1133781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium913Open in IMG/M
3300012528|Ga0129352_10257328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium745Open in IMG/M
3300012919|Ga0160422_10959367Not Available552Open in IMG/M
3300012954|Ga0163111_10161307All Organisms → Viruses → Predicted Viral1907Open in IMG/M
3300012954|Ga0163111_11238182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium730Open in IMG/M
3300012954|Ga0163111_12424366Not Available533Open in IMG/M
3300013004|Ga0164293_10545487Not Available760Open in IMG/M
3300013195|Ga0116815_1016123Not Available931Open in IMG/M
3300017709|Ga0181387_1019371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1320Open in IMG/M
3300017714|Ga0181412_1131887Not Available570Open in IMG/M
3300017719|Ga0181390_1098678All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium784Open in IMG/M
3300017720|Ga0181383_1137283Not Available656Open in IMG/M
3300017721|Ga0181373_1101457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37507Open in IMG/M
3300017724|Ga0181388_1146542Not Available561Open in IMG/M
3300017730|Ga0181417_1034787Not Available1240Open in IMG/M
3300017735|Ga0181431_1093360Not Available674Open in IMG/M
3300017741|Ga0181421_1000268All Organisms → cellular organisms → Bacteria → Proteobacteria14904Open in IMG/M
3300017742|Ga0181399_1142800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium578Open in IMG/M
3300017750|Ga0181405_1102311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37721Open in IMG/M
3300017753|Ga0181407_1034657All Organisms → Viruses → Predicted Viral1352Open in IMG/M
3300017755|Ga0181411_1007036All Organisms → Viruses → Predicted Viral3815Open in IMG/M
3300017757|Ga0181420_1217707Not Available550Open in IMG/M
3300017763|Ga0181410_1069381All Organisms → Viruses → Predicted Viral1053Open in IMG/M
3300017764|Ga0181385_1204475Not Available596Open in IMG/M
3300017766|Ga0181343_1081960Not Available925Open in IMG/M
3300017772|Ga0181430_1000478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium17502Open in IMG/M
3300017773|Ga0181386_1142643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium735Open in IMG/M
3300017782|Ga0181380_1204643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium661Open in IMG/M
3300017818|Ga0181565_10253597Not Available1193Open in IMG/M
3300017952|Ga0181583_10233986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium1192Open in IMG/M
3300017956|Ga0181580_10156047All Organisms → Viruses → Predicted Viral1631Open in IMG/M
3300017957|Ga0181571_10422700Not Available823Open in IMG/M
3300017962|Ga0181581_10507512Not Available745Open in IMG/M
3300017985|Ga0181576_10721105Not Available594Open in IMG/M
3300017985|Ga0181576_10839024Not Available542Open in IMG/M
3300017986|Ga0181569_10174461All Organisms → Viruses → Predicted Viral1519Open in IMG/M
3300018424|Ga0181591_10297184Not Available1232Open in IMG/M
3300019253|Ga0182064_1256543Not Available508Open in IMG/M
3300019459|Ga0181562_10263824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium871Open in IMG/M
3300020051|Ga0181555_1171547Not Available861Open in IMG/M
3300020185|Ga0206131_10182671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED371053Open in IMG/M
3300020377|Ga0211647_10120834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37885Open in IMG/M
3300020380|Ga0211498_10009824All Organisms → Viruses → Predicted Viral3482Open in IMG/M
3300020419|Ga0211512_10538352Not Available518Open in IMG/M
3300020437|Ga0211539_10297196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium669Open in IMG/M
3300020437|Ga0211539_10385483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium584Open in IMG/M
3300020453|Ga0211550_10300358All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium752Open in IMG/M
3300021085|Ga0206677_10000288Not Available46865Open in IMG/M
3300021335|Ga0213867_1036092All Organisms → Viruses → Predicted Viral1940Open in IMG/M
3300021335|Ga0213867_1198761Not Available667Open in IMG/M
3300021350|Ga0206692_1487750All Organisms → Viruses → Predicted Viral2488Open in IMG/M
3300021364|Ga0213859_10093951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED371422Open in IMG/M
3300021373|Ga0213865_10092621All Organisms → Viruses → Predicted Viral1621Open in IMG/M
3300021373|Ga0213865_10337965Not Available688Open in IMG/M
3300021961|Ga0222714_10655955Not Available517Open in IMG/M
3300022187|Ga0196899_1214868Not Available504Open in IMG/M
(restricted) 3300022920|Ga0233426_10046917All Organisms → Viruses → Predicted Viral2090Open in IMG/M
3300022929|Ga0255752_10368911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium578Open in IMG/M
3300022935|Ga0255780_10136019All Organisms → Viruses → Predicted Viral1368Open in IMG/M
3300023110|Ga0255743_10336695Not Available766Open in IMG/M
(restricted) 3300024255|Ga0233438_10014445Not Available5222Open in IMG/M
(restricted) 3300024255|Ga0233438_10397521Not Available503Open in IMG/M
(restricted) 3300024264|Ga0233444_10073496All Organisms → Viruses → Predicted Viral1900Open in IMG/M
3300025645|Ga0208643_1091897Not Available846Open in IMG/M
3300025658|Ga0209659_1101465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium935Open in IMG/M
3300025810|Ga0208543_1156529Not Available531Open in IMG/M
3300025869|Ga0209308_10136337All Organisms → Viruses → Predicted Viral1143Open in IMG/M
3300026183|Ga0209932_1032180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED371323Open in IMG/M
3300026199|Ga0208638_1117638Not Available744Open in IMG/M
3300027131|Ga0255066_1044037Not Available624Open in IMG/M
3300027142|Ga0255065_1028501Not Available1065Open in IMG/M
3300027486|Ga0255086_1007433Not Available2355Open in IMG/M
3300027813|Ga0209090_10226392Not Available954Open in IMG/M
3300028008|Ga0228674_1120594Not Available898Open in IMG/M
3300028197|Ga0257110_1268532Not Available628Open in IMG/M
3300028282|Ga0256413_1239587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium646Open in IMG/M
3300028418|Ga0228615_1167086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37557Open in IMG/M
3300031569|Ga0307489_10802108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37663Open in IMG/M
3300031588|Ga0302137_1041748All Organisms → Viruses → Predicted Viral1933Open in IMG/M
3300031766|Ga0315322_10652825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium667Open in IMG/M
3300031774|Ga0315331_10765679Not Available676Open in IMG/M
3300032011|Ga0315316_10938996Not Available707Open in IMG/M
3300032073|Ga0315315_11317416Not Available634Open in IMG/M
3300034060|Ga0334983_0294352Not Available972Open in IMG/M
3300034200|Ga0335065_0018131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED374968Open in IMG/M
3300034200|Ga0335065_0405789Not Available835Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.38%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.82%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh12.82%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.55%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.84%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.84%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.27%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.42%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.42%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater2.56%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.56%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.56%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.56%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.56%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.85%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.85%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.85%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater0.85%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.85%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.85%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.85%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.85%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.85%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.85%
Volcanic Co2 Seep SeawaterEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater0.85%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.85%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001833Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM24, ROCA_DNA012_0.2um_2lEnvironmentalOpen in IMG/M
3300002176Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50mEnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005606Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84EnvironmentalOpen in IMG/M
3300005971Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_AEnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007113Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-isEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007647Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02EnvironmentalOpen in IMG/M
3300007758Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300008956Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLaneEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013195Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station7_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020051Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020377Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)EnvironmentalOpen in IMG/M
3300020380Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020453Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300022935Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaGEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300026183Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026199Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV51 (SPAdes)EnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027486Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031588Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCMEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
OpTDRAFT_1012248713300000928Freshwater And MarinePGWYNGEHSVTDCDTALTVATGNGTELNFAKESIIVDPWRKTPDITGVTVIHYGNTRGK*
ACM24_101388813300001833Marine PlanktonYVKGWYNGKHRVTEADEALTVATANGTELSFPEGSIVVDPWRKIPPMEMVQVVHYGNTRADALR*
JGI24820J26691_104412023300002176MarineDQLDTVPGWYNGKHNVTDCDTALTVSTGNGTELNFAPGSIVVDPWRKTPKLENVEVIHYGNTRETQ*
Ga0066223_123026823300004461MarineLLAHNPGVTYGDQLDTVPGWYGDHKATDCDGALRVTTGNGSELSFAKGSFVVDPWRKTPNLEGVKVIHYGNTRGK*
Ga0066835_1031082223300005606MarineKPAVYLLAHNPSITYGDQLDTVPGWYDGEHNVTDCDTALISTGNGTELNFAPNSIVVDPWRKTPLIMGIKVVHYGNTRKESMR*
Ga0066370_1022150813300005971MarineTYGEQLDTVPGWYNGKHNVTDCDTALTVSTGNGTELNFAEGSIIVDPWRKTPQLEGVEVIHYGNTRETI*
Ga0075503_138648423300006400AqueousYLLAHNPEVTYGDQLDFVKGWYDQHRVTGADEALTIATANGTELKFAEGSVVVDPWRKLPPMMGVRVIHYGNTRKDSLR*
Ga0075471_1059899413300006641AqueousDFVKGWYNDHRVTGADEALTVATANGTELKFAEGSVVVDPWRKTPNTIPGVRVVHYGNTRKESPR*
Ga0075476_1035142813300006867AqueousGEQLDFVPKWYGEHNVTDCDEALAISTGNGTELSFAPDSTVVDPWRKTPSIEGVKVIHYGNTRGA*
Ga0075477_1032981123300006869AqueousAVYLLAHNPQVTYGEQLDFVNDWYNDHRVTGADEALTVATANGTTLQFAEGSVVVDPWRKTPSMPGVQVVHYGNTRRESLR*
Ga0070748_115656723300006920AqueousYYYDEETNDIPPKEVLGAPAVYLLAHNPQVTYGDQLDFVKSWYDNHRVTDCDTALTIATANGTSLYFHPQSIVLDPWRTVPDLGPDITVIHYGNTRPTQKG*
Ga0098051_100370653300006924MarineDFVKGWYDQHRVTGADEALTVATANGSELSFAEGSVIIDPWRKIPEIPGCSVVHYGNTRLDALR*
Ga0101666_104650013300007113Volcanic Co2 Seep SeawaterVYLLAHNPSITYGEQLDFVPKWYGEHNVTDCDEALTVTTGNGSELNFAPGSIVVDPWRKTPDIMGVDVIHYGNTRGVR*
Ga0099849_117251913300007539AqueousDTVPGWYGDHKVTGCDDALISTGNGTELNFASGSIVIDPWRKTPNISNVDVVHYGNTRRK
Ga0102855_102019513300007647EstuarineITYGDQLDTVPGWYNGEHSVTDCDTALTVATGNGTELNFAKESIIVDPWRKTPDIAGVTVIHYGNTRGK*
Ga0105668_118233223300007758Background SeawaterTYGDQLGFVKGWYNGNHSVTSADQALTVATASGTELNFPKGSVIVDPWRVIPKINNNNVKVVHYGNTREESLS*
Ga0104261_102930413300008956Ocean WaterNPEVTYGDQLDFVKSWYNEHRVTQSDEALTVATANGTGLAFAPGSIVVDPWRKIPNIPDVDVIHYGNTRIEV*
Ga0102810_102161733300009002EstuarineITYGEQLDTVPGWYGDHKVTDCDDALVETGNGTELSFAKGSVDIDPCRKTPDIDGIKVIHYGNTRVK*
Ga0115566_1001858213300009071Pelagic MarinePGITYGEQLDFVPKWYGEHNVTDCDEALAVSTGNGTELNFAPGSIVVDPWRKTPAIEDVQVVHYGNTRQESLR*
Ga0102815_1049767123300009080EstuarineLAHNPEVTYGEQLDFVSKWYGDHNVTDCDTALTVKTGNGTDLSFAEGSVVIDPWRKTPKAQGITVIHYGNTRGE*
Ga0114994_1055617813300009420MarineAVYLMAHNPRVTYGDQLDTVPGWYGEHNATDCDSALTVATGNGSELTFAENSVILDPWRTLPDVLGCQVIHYGNTRKIK*
Ga0114994_1055617913300009420MarineAVYLMAHNPRVTYGDQLDTVPGWYGEHNATDCDSALTVATGNGSELTFAENSVILDPWRTLPDVAGCTVIHYGNTRKIK*
Ga0114997_1076466623300009425MarinePGVTYGDQLDTVPGWYGDHKATDCDGALTVTTGNGSELSFAQGSFVLDPWRKTPKVDGITVIHYGNTRVN*
Ga0115007_1008288813300009441MarineLLAHNPEVTYGEQLDFVSKWYGDHNVTDCDTALTVKTGNGTELSFAEGSVVVDPWRKTPKAPGITVIHYGNTRVDV*
Ga0115571_118518613300009495Pelagic MarineITYGDQLDTVPGWYNGEHSVTDCDTALTVATGNGTELNFAPDSIIVDPWRKTPDINGVTVIHYGNSRGK*
Ga0115004_1063984713300009526MarineDNVPGWYNGKHNRTDCDTALSVSTGNGTELQFAPGSIVLDPWRQIPDIDGVTVIHYGNTRIKKQG*
Ga0115100_1117082223300009608MarineEITYGDQLDTVPGWYNGKHKRTDCDNALSVSTGNGTELQFAPGSIVLDPWRKTPDIAGVQVVHYGNTRGNV*
Ga0115001_1014770913300009785MarineDVPSEEVLNNPAVYLLAHNPGVTYGDQLDTVPGWYGDHKATDCDGALTVTTGNGSELSFAQGSFVLDPWRKTPKVDGITVIHYGNTRVN*
Ga0098056_110239323300010150MarineAHNPEVTYGEQLDTVPNWYGEHNVTDCDEALSVKTGNGSDLSFAKGSIVVDPWRKTPNIDGVMVIHYGNTRGK*
Ga0129345_111601313300010297Freshwater To Marine Saline GradientHNPGITYGDQLDTVPGWYGDHKVTDCDDALVSTGNGTELNFASGSIVVDPWRKTPDIEGVKVIHYGNTRVK*
Ga0129345_116244623300010297Freshwater To Marine Saline GradientHNPEITYGDQLDFVKGWYDDHRVTESDEALTVATANGTELTFAPGSCVVDPWRKIPDLPNVEVIHYGNTRC*
Ga0129342_113378113300010299Freshwater To Marine Saline GradientVYLLAHNPEITYGEQLDSVPGWYDNKNVSQADEALTVQTANGSQIKFAEGSIVVDPWRKLPSTMGIRVVHYGNTRAEAPR*
Ga0129352_1025732813300012528AqueousVTDCDEALSVKTGNGSELSFAINSTVVDPWRKTPDIEGVTVIHYGNTRGAK*
Ga0160422_1095936713300012919SeawaterLLAHNPGITYGDQLDTVPGWYDDHNVSDCDTALVSTGNGTELNFAPNSIVVDPWRKTPAINDVRVVHYGNTREEALR*
Ga0163111_1016130713300012954Surface SeawaterPAVYLLAHNPQITYGEQLDTVPGWYDTHKVTGADEALTVATGNGTNMSFAEGSIVLDPWRKTPDIEGVTVIHYGNTRNKDT*
Ga0163111_1123818223300012954Surface SeawaterAHNPEVTYGEQLDTVPGWYNGKHNVTDCDTALTVSTGNGTELNFAEGSIIVDPWRKTPQLEGVEVIHYGNTRETI*
Ga0163111_1242436613300012954Surface SeawaterNKPAVYLLAHNPEITYGEQLDYVKGWYNGKHRVTEADEALTVATANGTELSFAEGSIVVDPWRKIPPMEMVQVVHYGNTRADALR*
Ga0164293_1054548723300013004FreshwaterNPQITYGEQLDFVKGWYADHRVTGADEALTVATANGTALNFAASSVVVDPWRKTPHLEGVTVVHYGNTR*
Ga0116815_101612323300013195MarineAVYLLAHNPGITYGEQLDFVKGWYNGKHRVTEADEALTVATANGTELEFAEGSIVVDPWRKIPAIEGVHVIHYGNTRADALR*
Ga0181387_101937113300017709SeawaterLAHNPQVTYGEQLDTVPGWYGNHTTTGEEASFITTANGSNLGFAEGSVVIDPWRKTPEAPGITVIHYGNTRNR
Ga0181412_113188723300017714SeawaterLLAHNPGITYGDQLDTVPGWYNGEHNVTDCDTALISTGNGTELNFAPDSIVVDPWRKTPDIEGVTVIHYGNTR
Ga0181390_109867813300017719SeawaterVPGWYDNHNVSGCDTALAVKTGNGTELTFAPGSIVLDPWRKTPDIADVQVVHYGNTRREV
Ga0181383_113728323300017720SeawaterSTPCVYLLAHNPEITYGDQLDTVPGWYNGKHKRTDCDNALSVSTGNGTELQFASGSIVLDPWRKTPDIAGVQVVHYGNTRGNV
Ga0181373_110145723300017721MarineNPGVTYGDQLDTVPGWYNKQHVTDCDTALVSTGNGTELTFAPGSIVVDPWRKTPDIEGVQVIHYGNTRGK
Ga0181388_114654213300017724SeawaterPAVYLLAHNPGITYGDQLDTVPGWYNGEHSVTDCDTALTVATGNGTELNFAPGSIVLDPWRKTPDIEGVEVLHYGNTRSK
Ga0181417_103478723300017730SeawaterGDQLDTVPGWYNGKHKRTDCDNALSVSTGNGTELQFAPGSIVLDPWRKTPDIAGVQVVHYGNTRGNV
Ga0181431_109336013300017735SeawaterQEVLDKPAVYLLAHNPEITYGDQLDNVPGWYNGKHNRTDCDTALTVATGNGTELNFAPNSIVVDPWRKTPDIDNVQVVHYGNTRGRM
Ga0181421_100026813300017741SeawaterTYGDQLDFVPGWYDDHNVSDCDTALVSTGNGTELSFAKGSIIVDPWRKTPDIEGVQVIHYGNTRGVK
Ga0181399_114280023300017742SeawaterDNHNVSGCDTALAVKTGNGTELTFAPGSIVLDPWRKTPDIADVQVVHYGNTRREV
Ga0181405_110231123300017750SeawaterNPGITYGDQLDTVPGWYNEQHVTDCDTALVSTGNGTELTFAPGSIVVDPWRKTPDIEGVEVIHYGNTRGK
Ga0181407_103465733300017753SeawaterVYLLAHNPEVTYGEQLDTVPGWYDDHNISDCDTALVSTGNGTELNFAKGSIVVDPWRKTPNIDNVEVVHYGNTREIQ
Ga0181411_100703613300017755SeawaterVPLDDILSTPCVYLLAHNPEITYGDQLDTVPGWYNGKHKRTDCDNALSVSTGNGTELQFAPGSIVLDPWRKTPDIAGVQVVHYGNTRGNV
Ga0181420_121770723300017757SeawaterPEVTYGEQLDTVPGWYNDHNVSDCDTALVSTGNGTELNFAPGSIVVDPWRKTPDINSVQVIHYGNTRESI
Ga0181410_106938123300017763SeawaterDTVPGWYGEHNATDCDGALTVATGNGSELTFAENSTILDPWRTLPEIEGCTVIHYGNTRKIK
Ga0181385_120447513300017764SeawaterEVTYGEQLDFVKGWYNGKHRVTEADEALTVATANGTDLSFAPGSVVVDPWRKIPDLPGVEIVHYGNTRTEV
Ga0181343_108196013300017766Freshwater LakeAVYLLAHNPQITYGEQLDFVAGWYKDHRVTGADEALTVATANGTTLSFAAGSVVVDPWRKTPQLPGVTVVHYGNTR
Ga0181430_100047813300017772SeawaterNVPLDDILSTPCVYLLAHNPEITYGDQLDTVPGWYNGKHKRTDCDNALSVSTGNGTELQFAPGSIVLDPWRKTPDIAGVQVVHYGNTRGNV
Ga0181386_114264323300017773SeawaterPAVYLLAHNPEVTYGEQLDTVPGWYDNHNVSGCDTALAVKTGNGTELTFAPGSIVLDPWRKTPDIADVQVVHYGNTRREV
Ga0181380_120464323300017782SeawaterPEVTYGDQLDTVPNWYGEHNVTDCDEALSVKTGNGSELSFAPNSIVVDPWRKTPDIDGVSVIHYGNTRGAK
Ga0181565_1025359723300017818Salt MarshGDQLDFVKGWYDDHRVTESDEALTVATANGTELTFAPGSCVVDPWRKIPDLPNVEVIHYGNTRC
Ga0181583_1023398633300017952Salt MarshYGDQLDTVPKWYGDHNVTDCDTALTITTGNGTDVGFAEGSVVIDPWRKTPKAEGITVIHYGNTRER
Ga0181580_1015604713300017956Salt MarshVTDCDEALSVKTGNGSELSFAINSTVVDPWRKTPDIEGVTVIHYGNTRGAK
Ga0181571_1042270023300017957Salt MarshLLAHNPSITYGDQLDTVPGWYGEEHSVTDCDTALVSTGNGTELNFAPGSVVVDPWRKTPPIMGVEVIHYGNTRRN
Ga0181581_1050751213300017962Salt MarshYLIAHNPQVTYGEQLDTVPTWYGDHNVKDCDTALTITTGNGTDIGFAEGSVIVDPWRKTPQAPGITVIHYGNTRSGT
Ga0181576_1072110513300017985Salt MarshGEQLDFVKGWYDDHRVTESDEALTVATANGTELTFAPGSCVVDPWRKIPDLPDVEVIHYGNTRTR
Ga0181576_1083902413300017985Salt MarshHNPAITYGEQLDFVKGWYDDHKVTESDEALTVATANGTELKFAPGSVVVDPWRKIPDIEDVEVIHYGNTRSN
Ga0181569_1017446113300017986Salt MarshNILNKPAVYLLAHNPGITYGEQLDFVKGWYNGKHRVTEADEALTVATANGTELNFAKGSVVFDPWRKIPEIEGVRVIHYGNTRSDALR
Ga0181591_1029718413300018424Salt MarshLDFVKGWYDDHRVTESDEALTVATANGTELTFAPGSCVVDPWRKIPDLPNVEVIHYGNTR
Ga0182064_125654323300019253Salt MarshHNPEITYGEQLDFVKGWYEEHRVTGADEALTVATANGTELNFAEGSVVVDPWRKIPKLDGITVIHYGNTRKDALR
Ga0181562_1026382423300019459Salt MarshYGDQLDTVPSWYGEHNVTDCDEALSVKTGNGSELSFAINSTVVDPWRKTPDIEGVTVIHYGNTRGAK
Ga0181555_117154723300020051Salt MarshHNPGITYGDQLDTVPGWYGDHKVTDCDDALVSTGNGTELNFASGSIVVDPWRKTPDIEGVKVIHYGNTRGK
Ga0206131_1018267123300020185SeawaterPEITYGKQLDFVKGWYDEHRVTGADEALTVATANGTELNFAQGSIVLDPWRKLPPMEGVRVVHYGNTRNEALR
Ga0211647_1012083423300020377MarineQLDTVPGWYDTHKVTGADEALTVATGNGTNMSFAKGSIVLDPWRKTPDIEGVEVIHYGNTRNKDT
Ga0211498_1000982413300020380MarinePAVYLLAHNPQITYGEQLDTVPGWYDTHKVTGADEALTVATGNGTNMSFAEGSIVLDPWRKTPDIEGVEVIHYGNTRNKDT
Ga0211512_1053835213300020419MarineVLDNPAVYLLAHNPGITYGEQLDTVPGWYNGEHSVTDCDTALTVATGNGTELKFAPESIVVDPWRKTPDIEDVEVIHYGNTRK
Ga0211539_1029719613300020437MarineTYGDQLDFVPKWYGDHNVTDCDEALTVKTGNGSELNFAKGSIVVDPWRKTPNIDGVQVIHYGNTRGVT
Ga0211539_1038548313300020437MarineGDQLDFVPKWYGEYNVTDCDEALTVTTGNGSELKFAKGSIVVDPWRKTPDIEGVEVIHYGNTRGAK
Ga0211550_1030035823300020453MarineAHNPEVTYGEQLDTVPGWYNGEHNVTDCDTALTVATGNGTELNFAPGSIVVDPWRKTPDIDGVEVIHYGNTRETR
Ga0206677_1000028813300021085SeawaterYLLAHNPGITYGDQLDTVPGWYGDHKVTDCDDALVSTGNGTELNFAPGSIVVDPWRKTPDIEGVQVIHYGNTRGK
Ga0213867_103609213300021335SeawaterDFVKGWYNGKHRVTEADEALTVATANGTELQFASGSTVIDPWRKIPAIEGVQVVHYGNTRADALR
Ga0213867_119876123300021335SeawaterYLLAHNPEVTYGEQLDFVKGWYKDKHRVTEADQALTVATANGSNLSFASGSVIVDPWRKIPDMPNVEVVHYGNTR
Ga0206692_148775023300021350SeawaterMAHNPAVTYGDQLDTVPGWYGEHNATDCDGALTVATGNGSELTFAEKSVILDPWRTLPEIEGCTVIHYGNTRNIK
Ga0213859_1009395113300021364SeawaterNPSITYGDQLDTVPGWYNEKHNVTDCDTALISTGNGTELNFASGSIVVDPWRKTPSIMGVEVVHYGNTRRS
Ga0213865_1009262133300021373SeawaterLDTVPSWYGEHNVTDCDEALSVKTGNGSELSFAIDSTVVDPWRKTPDIEGVTVIHYGNTRGAK
Ga0213865_1033796523300021373SeawaterPPQSVLEKPAVYLLAHNPEVTYGDQLDFVKGWYNGKHRVTEADEALTVATANGTELQFASGSTVIDPWRKIPAIEGVQVVHYGNTRADALR
Ga0222714_1065595513300021961Estuarine WaterAVYLLAHNPEVTYGDQLDFVKGWYDQHRVTGADEALTIATANGTELKFAEGSIVIDPWRKLPSMIGVRVIHYGNTRKDSLR
Ga0196899_121486813300022187AqueousHNPGITYGDQLDTVPGWYGDHKVTDCDDALVSTGNGTELNFASGSIVVDPWRKTPDIEGVKVIHYGNTRRK
(restricted) Ga0233426_1004691743300022920SeawaterGEQLDTVPGWYDNHNVSDCDTALAVLTGNGSELSFAQGSIVVDPWRKTPNITGVQVIHYGNTRGAV
Ga0255752_1036891123300022929Salt MarshWYGEHNVTDCDEALSVKTGNGSELSFAINSTVVDPWRKTPDIEGVTVIHYGNTRGAK
Ga0255780_1013601933300022935Salt MarshHNPEVTYGDQLDTVPSWYGEHNVTDCDEALSVKTGNGSELSFAINSTVVDPWRKTPDIEGVTVIHYGNTRGAK
Ga0255743_1033669513300023110Salt MarshGDQLDTVPGWYGEEHSVTDCDTALVSTGNGTELNFAPGSVVVDPWRKTPPIMGVEVIHYGNTRRN
(restricted) Ga0233438_1001444513300024255SeawaterLLAHNPGITYGDQLDTVPGWYGDHKVTDCDDALVSTGNGTELNFAPGSIVVDPWRKTPDIEGVQVIHYGNTRGK
(restricted) Ga0233438_1039752123300024255SeawaterEVLERPAVYLLAHNPGVTYGDQLDFVKGWYNGKHRVTEADEALTVATANGTDLLFAPGSIVVDPWRKIPDLPGVEVIHYGNTRD
(restricted) Ga0233444_1007349633300024264SeawaterLLAHNPEITYGDQLDFVKGWYNGKHRVTEADEALTVATANGTDLLFAPGSIVVDPWRKIPDLPGVEVIHYGNTRD
Ga0208643_109189713300025645AqueousYYYDEETNDIPPKEVLGAPAVYLLAHNPQVTYGDQLDFVKSWYDNHRVTDCDTALTIATANGTSLYFHPQSIVLDPWRTVPDLGPDITVIHYGNTRPTQKG
Ga0209659_110146523300025658MarineQLDTVPGWYDNHNVSDCDTALAVLTGNGSELSFAQGSIVVDPWRKTPDITGVQVIHYGNTRGAV
Ga0208543_115652923300025810AqueousDTVPGWYGEHNATDCDGALTVATGNGSELTFAEKSVILDPWRTLPEIEGCTVIHYGNTRNIK
Ga0209308_1013633713300025869Pelagic MarineGEQLDFVPKWYGEHNVTDCDEALAVSTGNGTELNFAPGSIVVDPWRKTPAIEDVQVVHYGNTRQESLR
Ga0209932_103218023300026183Pond WaterHNPGITYGDQLDTVPGWYGDHKVTDCDDALVSTGNGTELNFAPGSIVVDPWRKTPDIEGVKVIHYGNTRRK
Ga0208638_111763823300026199MarineILENPAVYLLAHNPEITYGDQLDTVPGWYNGEHNVTDCDTALTVATGNGTELTFAPGSIVLDPWRKTPDILNVRVVHYGNTRGRM
Ga0255066_104403733300027131FreshwaterFVKGWYNNHRVTGADEALTVATANGTALNFAEGSVVVDPWRKTPNTIPGVRVVHYGNTRKESPR
Ga0255065_102850153300027142FreshwaterYLLAHNPQITYGEQLDFVKGWYNNHRVTGADEALTVATANGTALNFAEGSVVVDPWRKTPNTIPGVRVVHYGNTRKESPR
Ga0255086_100743313300027486FreshwaterTAVLNKPAVYLLAHNPQITYGEQLDFVKGWYNNHRVTGADEALTVATANGTALNFAEGSVVVDPWRKTPNTIPGVRVVHYGNTRKESPR
Ga0209090_1022639223300027813MarinePAVYLMAHNPRVTYGDQLDTVPGWYGEHNATDCDSALTVATGNGSELTFAENSVILDPWRTLPDVLGCQVIHYGNTRKIK
Ga0228674_112059423300028008SeawaterGDNVPKEVLERPAVYLLAHNPEVTYGEQLDFVKGWYNGKHRVTEADEALTVATANGTGLSFAPGSVVVDPWRKIPNLPGVEVVHYGNTRTEV
Ga0257110_126853223300028197MarineLTGDVPPQEILDEPAVYLLAHNPEVTYGDQLDTVPGWYDNHNVSDCDTALVSTGNGTQLTFASGSIVVDPWRKTPDINNVQVIHYGNTREIK
Ga0256413_123958713300028282SeawaterLLAHNPEVTYGEQLDTVPGWYDDHNISDCDTALVSTGNGTELNFAKGSIVVDPWRKTPNIDNVEVVHYGNTREIQ
Ga0228615_116708613300028418SeawaterNPGITYGDQLDTVPGWYNGEHSVTDCDTALTVATGNGTELNFAKESIIVDPWRKTPDIAGVTVIHYGNTRGK
Ga0307489_1080210813300031569Sackhole BrineVYLLAHNPGVTYGDQLDTVPGWYGDHKATDCDGALTVTTGNGSELSFAKGSFVLDPWRKTPNLEGVKVIHYGNTRGK
Ga0302137_104174813300031588MarineTYGDQLDTVPGWYGEHNATDCDSALTVATGNGSELTFAENSVILDPWRTLPDVLGCQVIHYGNTRKIK
Ga0315322_1065282523300031766SeawaterPGWYDNHNVSGCDTALAVKTGNGTELTFAPGSIVLDPWRKTPDIADVQVVHYGNTRREV
Ga0315331_1076567923300031774SeawaterNPAVTYGDQLDTVPGWYGEHNATDCDGALTVATGNGSELTFAEKSVILDPWRTLPEIEGCTVIHYGNTRNIK
Ga0315316_1093899623300032011SeawaterQEVLNNPAVYLLAHNPGITYGDQLDTVPGWYNGEHNVTDCDTALISTGNGTELNFAPNSIVVDPWRKTPDIEGVTVIHYGNTR
Ga0315315_1131741623300032073SeawaterITYGDQLDTVPGWYNGEHSVTDCDTALTVATGNGTELNFAPGSIVLDPWRKTPDIEGVEVLHYGNTRSK
Ga0334983_0294352_695_9643300034060FreshwaterMGEVPPADVLSSPAVYLLAHNPQITYGEQLDFVKGWYADHRVTGADEALTVATANGTALNFAASSVVVDPWRKTPHLEGVTVVHYGNTR
Ga0335065_0018131_4758_49673300034200FreshwaterNPQITYGEQLDFVKGWYNDHRVTGADEALTVATANGTTLSFAEGSVVVDPWRKTPDLTGVEVVHYGNTR
Ga0335065_0405789_599_8203300034200FreshwaterLLAHNPQITYGEQLDFVKGWYNDHRVTGADEALTVATANGTALSFAPGSVVVDPWRKTPNLEGVDVVHYGNTR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.