Metagenome / Metatranscriptome Family F077302

Basic Information
Family ID	F077302
Family Type	Metagenome / Metatranscriptome
Number of Sequences	117
Average Sequence Length	43 residues
Representative Sequence	MYVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRI
Number of Associated Samples	102
Number of Associated Scaffolds	117

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	19.66 %
% of genes near scaffold ends (potentially truncated)	23.08 %
% of genes from short scaffolds (< 2000 bps)	58.97 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Most Common Taxonomy
Group	Unclassified (50.427 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (12.821 % of family members)
Environment Ontology (ENVO)	Unclassified (38.462 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (44.444 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 16.90% β-sheet: 12.68% Coil/Unstructured: 70.42%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF13671	AAA_33	8.55
PF00149	Metallophos	4.27
PF00535	Glycos_transf_2	1.71
PF06067	DUF932	1.71
PF03118	RNA_pol_A_CTD	1.71
PF03796	DnaB_C	1.71
PF05766	NinG	1.71
PF03235	DUF262	0.85
PF00085	Thioredoxin	0.85
PF14423	Imm5	0.85
PF03869	Arc	0.85
PF00574	CLP_protease	0.85
PF03013	Pyr_excise	0.85
PF01176	eIF-1a	0.85
PF03602	Cons_hypoth95	0.85
PF09511	RNA_lig_T4_1	0.85
PF16225	DUF4884	0.85
PF05063	MT-A70	0.85
PF13538	UvrD_C_2	0.85
PF02195	ParBc	0.85
PF02086	MethyltransfD12	0.85
PF10651	BppU_N	0.85
PF06289	FlbD	0.85
PF16677	GP3_package	0.85
PF09643	YopX	0.85
PF03167	UDG	0.85
PF01569	PAP2	0.85
PF01555	N6_N4_Mtase	0.85
PF00929	RNase_T	0.85
PF01541	GIY-YIG	0.85
PF11325	DUF3127	0.85

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG1066	DNA repair protein RadA/Sms, contains AAA+ ATPase domain	Replication, recombination and repair [L]	1.71
COG4725	N6-adenosine-specific RNA methylase IME4	Translation, ribosomal structure and biogenesis [J]	1.71
COG0202	DNA-directed RNA polymerase, alpha subunit/40 kD subunit	Transcription [K]	1.71
COG0740	ATP-dependent protease ClpP, protease subunit	Posttranslational modification, protein turnover, chaperones [O]	1.71
COG0305	Replicative DNA helicase	Replication, recombination and repair [L]	1.71
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	1.71
COG1479	DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains	Defense mechanisms [V]	0.85
COG3663	G:T/U-mismatch repair DNA glycosylase	Replication, recombination and repair [L]	0.85
COG3392	Adenine-specific DNA methylase	Replication, recombination and repair [L]	0.85
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	0.85
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	0.85
COG2242	Precorrin-6B methylase 2	Coenzyme transport and metabolism [H]	0.85
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.85
COG1582	Swarming motility protein SwrD	Cell motility [N]	0.85
COG1573	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.85
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	0.85
COG0338	DNA-adenine methylase	Replication, recombination and repair [L]	0.85
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.85
COG1030	Membrane-bound serine protease NfeD, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	0.85
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.85
COG0742	16S rRNA G966 N2-methylase RsmD	Translation, ribosomal structure and biogenesis [J]	0.85
COG0361	Translation initiation factor IF-1	Translation, ribosomal structure and biogenesis [J]	0.85
COG0692	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
All Organisms	root	All Organisms	49.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Viruses	superkingdom	All Organisms → Viruses	26.50 %
cellular organisms	root	All Organisms → cellular organisms	23.08 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	23.08 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	16.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
unclassified viruses	clade	All Organisms → Viruses → unclassified viruses	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	16.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	8.55 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.71 %
unclassified DNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses	0.85 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	0.85 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	16.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	8.55 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.71 %
unclassified dsDNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses	0.85 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.85 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	16.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	8.55 %
Rickettsiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales	1.71 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.85 %
Spirochaetales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales	0.85 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	5.98 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	3.42 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	3.42 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	3.42 %
unclassified Rickettsiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales	1.71 %
Fipvunavirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fipvunavirus	0.85 %
Plateaulakevirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Plateaulakevirus	0.85 %
Treponemataceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae	0.85 %
Ficleduovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Ficleduovirus	0.85 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.85 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.85 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.85 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5.98 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	3.42 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	3.42 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	1.71 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	1.71 %
Bacteroidetes bacterium ADurb.BinA104	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	1.71 %
Treponema	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema	0.85 %
Plateaulakevirus pv2L372X	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Plateaulakevirus → Plateaulakevirus pv2L372X	0.85 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.85 %
Fipvunavirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fipvunavirus	0.85 %
Ficleduovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Ficleduovirus	0.85 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.85 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.85 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5.98 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	3.42 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	1.71 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	1.71 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	1.71 %
Bacteroidetes bacterium ADurb.BinA104	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	1.71 %
unclassified Treponema	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → unclassified Treponema	0.85 %
Spirosomaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae	0.85 %
Plateaulakevirus pv2L372X	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Plateaulakevirus → Plateaulakevirus pv2L372X	0.85 %
Fipvunavirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fipvunavirus	0.85 %
Ficleduovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Ficleduovirus	0.85 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.85 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.85 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5.98 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	3.42 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	1.71 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	1.71 %
Bacteroidetes bacterium ADurb.BinA104	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	1.71 %
Treponema sp.	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → unclassified Treponema → Treponema sp.	0.85 %
Telluribacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Telluribacter	0.85 %
Seonamhaeicola	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Seonamhaeicola	0.85 %
Plateaulakevirus pv2L372X	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Plateaulakevirus → Plateaulakevirus pv2L372X	0.85 %
Fipvunavirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fipvunavirus	0.85 %
Ficleduovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Ficleduovirus	0.85 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.85 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.85 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5.98 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	3.42 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	1.71 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	1.71 %
Bacteroidetes bacterium ADurb.BinA104	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	1.71 %
unclassified Seonamhaeicola	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Seonamhaeicola → unclassified Seonamhaeicola	0.85 %
Telluribacter humicola	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Telluribacter → Telluribacter humicola	0.85 %
Treponema sp.	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → unclassified Treponema → Treponema sp.	0.85 %
Plateaulakevirus pv2L372X	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Plateaulakevirus → Plateaulakevirus pv2L372X	0.85 %
Fipvunavirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fipvunavirus	0.85 %
Ficleduovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Ficleduovirus	0.85 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.85 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.85 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.40 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5.98 %
Elemovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	3.42 %
Rickettsiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	1.71 %
Bacteroidetes bacterium ADurb.Bin028	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	1.71 %
Bacteroidetes bacterium ADurb.BinA104	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	1.71 %
Seonamhaeicola sp. W255	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Seonamhaeicola → unclassified Seonamhaeicola → Seonamhaeicola sp. W255	0.85 %
Telluribacter humicola	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Telluribacter → Telluribacter humicola	0.85 %
Treponema sp.	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → unclassified Treponema → Treponema sp.	0.85 %
Plateaulakevirus pv2L372X	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Plateaulakevirus → Plateaulakevirus pv2L372X	0.85 %
Fipvunavirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fipvunavirus	0.85 %
Ficleduovirus	genus	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Ficleduovirus	0.85 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.85 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.85 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001282\|B570J14230_10007132	Not Available	4392	Open in IMG/M
3300001605\|Draft_10487382	Not Available	646	Open in IMG/M
3300001963\|GOS2229_1002179	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → unclassified Treponema → Treponema sp.	1805	Open in IMG/M
3300002408\|B570J29032_109160567	Not Available	616	Open in IMG/M
3300002514\|JGI25133J35611_10051915	All Organisms → Viruses → Predicted Viral	1379	Open in IMG/M
3300002835\|B570J40625_100082463	All Organisms → cellular organisms → Bacteria	4139	Open in IMG/M
3300003986\|Ga0063233_10091683	All Organisms → cellular organisms → Bacteria	889	Open in IMG/M
3300004369\|Ga0065726_14647	Not Available	16202	Open in IMG/M
3300005581\|Ga0049081_10179050	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	767	Open in IMG/M
3300005582\|Ga0049080_10260156	Not Available	565	Open in IMG/M
3300005758\|Ga0078117_1042236	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1641	Open in IMG/M
3300005824\|Ga0074474_1574153	Not Available	834	Open in IMG/M
3300005824\|Ga0074474_1663128	Not Available	960	Open in IMG/M
3300005825\|Ga0074476_1482852	Not Available	554	Open in IMG/M
3300006484\|Ga0070744_10014488	All Organisms → Viruses → Predicted Viral	2338	Open in IMG/M
3300006749\|Ga0098042_1044445	All Organisms → Viruses → Predicted Viral	1221	Open in IMG/M
3300006789\|Ga0098054_1359574	Not Available	515	Open in IMG/M
3300006802\|Ga0070749_10350026	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Seonamhaeicola → unclassified Seonamhaeicola → Seonamhaeicola sp. W255	821	Open in IMG/M
3300006810\|Ga0070754_10240724	Not Available	829	Open in IMG/M
3300007644\|Ga0102902_1192395	Not Available	602	Open in IMG/M
3300007653\|Ga0102868_1109925	Not Available	635	Open in IMG/M
3300008113\|Ga0114346_1003048	Not Available	12017	Open in IMG/M
3300008266\|Ga0114363_1064636	Not Available	4345	Open in IMG/M
3300008470\|Ga0115371_10459090	Not Available	1911	Open in IMG/M
3300009081\|Ga0105098_10309632	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	761	Open in IMG/M
3300009085\|Ga0105103_10678578	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300009095\|Ga0079224_100292842	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	2343	Open in IMG/M
3300009095\|Ga0079224_102833565	Not Available	692	Open in IMG/M
3300009128\|Ga0118727_1294242	Not Available	972	Open in IMG/M
3300009130\|Ga0118729_1055681	All Organisms → Viruses → Predicted Viral	2190	Open in IMG/M
3300009149\|Ga0114918_10000016	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	149006	Open in IMG/M
3300009149\|Ga0114918_10703617	Not Available	529	Open in IMG/M
3300009161\|Ga0114966_10075888	All Organisms → Viruses → Predicted Viral	2311	Open in IMG/M
3300009165\|Ga0105102_10420928	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	713	Open in IMG/M
3300009165\|Ga0105102_10471335	Not Available	677	Open in IMG/M
3300009165\|Ga0105102_10690326	Not Available	572	Open in IMG/M
3300009181\|Ga0114969_10042563	All Organisms → Viruses → Predicted Viral	3075	Open in IMG/M
3300010148\|Ga0098043_1009422	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	3253	Open in IMG/M
3300010153\|Ga0098059_1004562	Not Available	6207	Open in IMG/M
3300010885\|Ga0133913_13040511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	1117	Open in IMG/M
3300010932\|Ga0137843_1051360	Not Available	1679	Open in IMG/M
3300011188\|Ga0136587_1037091	Not Available	1184	Open in IMG/M
3300012346\|Ga0157141_1004539	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2304	Open in IMG/M
3300013004\|Ga0164293_10054010	Not Available	3225	Open in IMG/M
3300013004\|Ga0164293_10091181	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	2359	Open in IMG/M
3300013004\|Ga0164293_10158965	Not Available	1671	Open in IMG/M
3300013101\|Ga0164313_11699524	Not Available	507	Open in IMG/M
(restricted) 3300013127\|Ga0172365_10062072	Not Available	2449	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10046974	All Organisms → Viruses → Predicted Viral	4243	Open in IMG/M
3300013295\|Ga0170791_15549832	Not Available	625	Open in IMG/M
3300014266\|Ga0075359_1110051	Not Available	574	Open in IMG/M
3300014913\|Ga0164310_10387477	Not Available	824	Open in IMG/M
3300014962\|Ga0134315_1001221	All Organisms → cellular organisms → Bacteria	4917	Open in IMG/M
3300017722\|Ga0181347_1007599	Not Available	3552	Open in IMG/M
3300017722\|Ga0181347_1071283	Not Available	1024	Open in IMG/M
3300017722\|Ga0181347_1142051	Not Available	660	Open in IMG/M
3300017766\|Ga0181343_1102398	Not Available	813	Open in IMG/M
3300017774\|Ga0181358_1016845	All Organisms → cellular organisms → Bacteria	2951	Open in IMG/M
3300017777\|Ga0181357_1032780	Not Available	2047	Open in IMG/M
3300017778\|Ga0181349_1188734	Not Available	719	Open in IMG/M
3300017780\|Ga0181346_1277656	Not Available	575	Open in IMG/M
3300017785\|Ga0181355_1059837	All Organisms → Viruses → Predicted Viral	1609	Open in IMG/M
3300020048\|Ga0207193_1003335	All Organisms → cellular organisms → Bacteria	27178	Open in IMG/M
3300020048\|Ga0207193_1067642	Not Available	3527	Open in IMG/M
3300020160\|Ga0211733_11049669	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Plateaulakevirus → Plateaulakevirus pv2L372X	554	Open in IMG/M
3300020205\|Ga0211731_10126797	Not Available	10255	Open in IMG/M
3300020388\|Ga0211678_10138751	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1050	Open in IMG/M
3300020519\|Ga0208223_1031783	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	668	Open in IMG/M
3300020573\|Ga0208485_1007075	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin028	2670	Open in IMG/M
3300021962\|Ga0222713_10002600	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19192	Open in IMG/M
3300021963\|Ga0222712_10058813	Not Available	2828	Open in IMG/M
3300021963\|Ga0222712_10614972	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	625	Open in IMG/M
3300022206\|Ga0224499_10000228	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	14019	Open in IMG/M
3300022206\|Ga0224499_10238684	Not Available	617	Open in IMG/M
3300022407\|Ga0181351_1002023	All Organisms → cellular organisms → Bacteria	6881	Open in IMG/M
3300022407\|Ga0181351_1131675	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	924	Open in IMG/M
3300023184\|Ga0214919_10022385	All Organisms → cellular organisms → Bacteria	6982	Open in IMG/M
(restricted) 3300024052\|Ga0255050_10000170	Not Available	8704	Open in IMG/M
3300024262\|Ga0210003_1000004	Not Available	494080	Open in IMG/M
3300024346\|Ga0244775_10012192	All Organisms → cellular organisms → Bacteria	8114	Open in IMG/M
3300024346\|Ga0244775_10496190	Not Available	998	Open in IMG/M
3300024358\|Ga0255173_1000468	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	8932	Open in IMG/M
3300024506\|Ga0255168_1031138	All Organisms → cellular organisms → Bacteria	904	Open in IMG/M
3300024549\|Ga0256308_1040948	Not Available	1004	Open in IMG/M
3300025109\|Ga0208553_1000536	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	13519	Open in IMG/M
3300025131\|Ga0209128_1174659	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	625	Open in IMG/M
3300027145\|Ga0255114_1015328	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1541	Open in IMG/M
3300027503\|Ga0255182_1048347	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104	1113	Open in IMG/M
3300027608\|Ga0208974_1160421	Not Available	565	Open in IMG/M
3300027683\|Ga0209392_1001485	Not Available	6118	Open in IMG/M
3300027707\|Ga0209443_1018751	Not Available	3121	Open in IMG/M
3300027754\|Ga0209596_1268894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	691	Open in IMG/M
3300027798\|Ga0209353_10340533	Not Available	628	Open in IMG/M
3300027836\|Ga0209230_10094549	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fipvunavirus	1652	Open in IMG/M
3300027892\|Ga0209550_10681373	Not Available	594	Open in IMG/M
3300027956\|Ga0209820_1159606	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	624	Open in IMG/M
3300027963\|Ga0209400_1028487	All Organisms → Viruses → Predicted Viral	3142	Open in IMG/M
3300028361\|Ga0306872_100198	All Organisms → cellular organisms → Bacteria	26170	Open in IMG/M
3300028394\|Ga0304730_1028693	Not Available	2908	Open in IMG/M
3300028920\|Ga0272441_10008315	All Organisms → cellular organisms → Bacteria	16472	Open in IMG/M
3300031539\|Ga0307380_10644599	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Telluribacter → Telluribacter humicola	903	Open in IMG/M
3300031565\|Ga0307379_10525935	Not Available	1100	Open in IMG/M
3300031645\|Ga0307990_1185854	Not Available	830	Open in IMG/M
3300031786\|Ga0315908_11503641	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	524	Open in IMG/M
3300031885\|Ga0315285_10143227	Not Available	2000	Open in IMG/M
3300031951\|Ga0315904_10934057	Not Available	696	Open in IMG/M
3300031952\|Ga0315294_11189441	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	620	Open in IMG/M
3300032061\|Ga0315540_10126962	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1152	Open in IMG/M
3300032092\|Ga0315905_10188755	Not Available	2036	Open in IMG/M
3300033984\|Ga0334989_0012967	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Ficleduovirus	4331	Open in IMG/M
3300033996\|Ga0334979_0029761	Not Available	3642	Open in IMG/M
3300034013\|Ga0334991_0093452	All Organisms → Viruses → Predicted Viral	1459	Open in IMG/M
3300034013\|Ga0334991_0254803	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus	731	Open in IMG/M
3300034102\|Ga0335029_0003877	All Organisms → cellular organisms → Bacteria	11877	Open in IMG/M
3300034112\|Ga0335066_0055114	All Organisms → Viruses → Predicted Viral	2636	Open in IMG/M
3300034118\|Ga0335053_0113266	Not Available	1864	Open in IMG/M
3300034200\|Ga0335065_0867560	Not Available	500	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.15%
Engineered	Engineered	0.85%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	94.87%
Terrestrial	Environmental → Terrestrial	4.27%
Wastewater	Engineered → Wastewater	0.85%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	60.68%
Marine	Environmental → Aquatic → Marine	27.35%
Soil	Environmental → Terrestrial → Soil	4.27%
Sediment	Environmental → Aquatic → Sediment	3.42%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	2.56%
Unclassified	Environmental → Aquatic → Unclassified	0.85%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.85%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	25.64%
Lentic	Environmental → Aquatic → Freshwater → Lentic	20.51%
Oceanic	Environmental → Aquatic → Marine → Oceanic	8.55%
Unclassified	Environmental → Aquatic → Marine → Unclassified	6.84%
Sediment	Environmental → Aquatic → Freshwater → Sediment	5.98%
River	Environmental → Aquatic → Freshwater → River	4.27%
Coastal	Environmental → Aquatic → Marine → Coastal	3.42%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.42%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	2.56%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	2.56%
Hydrothermal Vents	Environmental → Aquatic → Marine → Hydrothermal Vents	1.71%
Sediment	Environmental → Aquatic → Marine → Sediment	1.71%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.71%
Clay	Environmental → Terrestrial → Soil → Clay	1.71%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.85%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.85%
Inlet	Environmental → Aquatic → Marine → Inlet	0.85%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.85%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.85%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	21.37%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	17.95%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	6.84%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	5.98%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	5.98%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.27%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	4.27%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	3.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.42%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.56%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	2.56%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	2.56%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	2.56%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.71%
Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment	1.71%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	1.71%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.71%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	1.71%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Marine → Inlet → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.85%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.85%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.85%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.85%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.85%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	12.82%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	11.11%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	5.98%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	5.98%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	5.13%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	4.27%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.56%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.56%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	2.56%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.56%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	2.56%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	2.56%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.56%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	2.56%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	2.56%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.71%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.71%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	1.71%
Marine	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine	1.71%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.71%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.71%
Marine Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment	1.71%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	1.71%
Saline Lake	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake	1.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil	1.71%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	1.71%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.85%
Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water	0.85%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.85%
Surface Water	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water	0.85%
Seawater	Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater	0.85%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.85%
Salt Marsh Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment	0.85%
Marine Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment	0.85%
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	0.85%
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	0.85%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline	0.85%
Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment	0.85%
Subsea Pool	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool	0.85%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.85%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300001605	Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin	Engineered	Open in IMG/M
3300001963	Marine microbial communities from Nags Head, North Carolina, USA - GS013	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002514	Marine viral communities from the Pacific Ocean - ETNP_6_85	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003986	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)	Environmental	Open in IMG/M
3300004369	Saline microbial communities from the South Caspian sea - cas-15	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005758	Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore	Environmental	Open in IMG/M
3300005824	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC	Environmental	Open in IMG/M
3300005825	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006749	Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG	Environmental	Open in IMG/M
3300006789	Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006810	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01	Environmental	Open in IMG/M
3300007644	Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02	Environmental	Open in IMG/M
3300007653	Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008470	Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009095	Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015	Environmental	Open in IMG/M
3300009128	Combined Assembly of Gp0137084, Gp0137083	Environmental	Open in IMG/M
3300009130	Combined Assembly of Gp0139511, Gp0139512	Environmental	Open in IMG/M
3300009149	Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300010148	Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG	Environmental	Open in IMG/M
3300010153	Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300010932	Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1	Environmental	Open in IMG/M
3300011188	Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #563	Environmental	Open in IMG/M
3300012346	Freshwater microbial communities from Emily Creek, Ontario, Canada - S29	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013101	Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm	Environmental	Open in IMG/M
3300013127 (restricted)	Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental	Open in IMG/M
3300014266	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1	Environmental	Open in IMG/M
3300014913	Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm	Environmental	Open in IMG/M
3300014962	Surface water microbial communities from Bangladesh - BaraHaldiaSW0309	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020388	Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)	Environmental	Open in IMG/M
3300020519	Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020573	Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022206	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024052 (restricted)	Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5	Environmental	Open in IMG/M
3300024262	Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024358	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d	Environmental	Open in IMG/M
3300024506	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d	Environmental	Open in IMG/M
3300024549	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025109	Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)	Environmental	Open in IMG/M
3300025131	Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes)	Environmental	Open in IMG/M
3300027145	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h	Environmental	Open in IMG/M
3300027503	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027683	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027707	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027836	Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027956	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028361	Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #498 (v2)	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300028920	Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N	Environmental	Open in IMG/M
3300031539	Soil microbial communities from Risofladan, Vaasa, Finland - UN-3	Environmental	Open in IMG/M
3300031565	Soil microbial communities from Risofladan, Vaasa, Finland - UN-2	Environmental	Open in IMG/M
3300031645	Marine microbial communities from Ellis Fjord, Antarctic Ocean - #129	Environmental	Open in IMG/M
3300031786	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300032061	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300033984	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034013	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034	Environmental	Open in IMG/M
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034118	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F077302

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J14230_100071323	3300001282	Freshwater	MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLRGNWFWRTRKIKE*
Draft_104873822	3300001605	Hydrocarbon Resource Environments	MLTVAERRFFIWKLELWWIAFDSVEFHPEGRKHLKNNWFWRT*
GOS2229_10021794	3300001963	Marine	MEVNVAQRRFFIWKLELWWIALDSPQFYPDGRKHLKGNWFWRQ*
B570J29032_1091605672	3300002408	Freshwater	MKEYNVAQRKFFIWKLELWWIAFNSAEFYPENRKHLKWNWFWRI*
JGI25133J35611_100519152	3300002514	Marine	MEVNVAQRRFYIWKLELWWIAFGSPQFYPENRKHIKGNWFWRQ*
B570J40625_1000824632	3300002835	Freshwater	MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLRGIGSGEPEK*
Ga0063233_100916833	3300003986	Freshwater Lake	MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKK*
Ga0065726_146477	3300004369	Saline	VAVRLFHIWKLEYWWVAFDLQDFYPKGRKHLKGKWFWRKIKKNEDI*
Ga0049081_101790502	3300005581	Freshwater Lentic	MSTFKVAERLFYIWKLERWWIAFDDDAFYPEDRKHLTGNWFWRI*
Ga0049080_102601562	3300005582	Freshwater Lentic	MFNVAERRFYIWKLELWWIAFDDDAFYPKDRIHLIGNWFWKI*
Ga0078117_10422364	3300005758	Lake Water	MYVNVAQRRFYIWKIELWWIAFDKTEFYPEGRKHLKGNWFWRT*
Ga0074474_15741533	3300005824	Sediment (Intertidal)	MEVNVAQRKIYIWKLELWWIAFGSSQFYPEGRKHIKGNWFWKQ*
Ga0074474_16631281	3300005824	Sediment (Intertidal)	QRKIYIWKLELWWIAFGSPQFYPNGRSHLKGGWFWRK*
Ga0074476_14828523	3300005825	Sediment (Intertidal)	MEVNVAQRKIYIWKLELWWIAFGSPQFYPNGRSHLKGGWFWRK*
Ga0070744_100144882	3300006484	Estuarine	MKEYIVNQRRFFIWKLELWWIAFDSVEFYPEDRKHLRGNWFWRN*
Ga0098042_10444454	3300006749	Marine	MEVTVAYRKFHIWKLELWWVFSDAFPPKGRKKIKGNWYWRTTKPQ*
Ga0098054_13595742	3300006789	Marine	MEVNVAQRRFYIWKLELWWIAFDSPQFYPEDRAHIKGNWFWR*
Ga0070749_103500264	3300006802	Aqueous	MEVNVAQRRFFIWKLELWWIAFDSPQFYPEGRKQIKGNWFWRQ*
Ga0070754_102407242	3300006810	Aqueous	MEVNVAQRRFYIWKLELWWIAFDSPQFYPEDRSHIKGNWFWRQ*
Ga0102902_11923952	3300007644	Estuarine	MLEYNVSERIFFIWKLELWWIAFDHPQFYPEGRKHL
Ga0102868_11099251	3300007653	Estuarine	MKEYIVNQRRFHIWKLELWWVAFDSQQFYPDGRTKLKGNWFWRNNCNL
Ga0114346_100304830	3300008113	Freshwater, Plankton	MLEYNVSERIFFIWKLEYWWIAFDHPQFHPDDRKHLRGNWFWRTKK*
Ga0114363_10646362	3300008266	Freshwater, Plankton	MMMTVNERRFYIWKLELWWVAFNSVEFYPEHRKHLINNWFWRT*
Ga0115371_104590905	3300008470	Sediment	MEVNVAQRRFFIWKLELWWIALESASFYPDGRKHLKGNWFWRTQKNKN
Ga0105098_103096322	3300009081	Freshwater Sediment	MEYNVAQRRFFIWKLELWWIAFDDNAFHPKNRIHLTGNWFWRI*
Ga0105103_106785782	3300009085	Freshwater Sediment	AERIFYIWKLEYWWIAFDRVEFYPEGRKHLRGNWFWRK*
Ga0079224_1002928424	3300009095	Agricultural Soil	MYVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRI*
Ga0079224_1028335652	3300009095	Agricultural Soil	MTNKKTKFMVNVAERTFYIWKLEYWWIAFDKPAFYPEGRKHLKGGWFWRK*
Ga0118727_12942423	3300009128	Marine	MEVNVAQRRFYIWKLELWWIAFDSPQFYPESRKHIKGNWFWRQ*
Ga0118729_10556817	3300009130	Marine	MEVNVAQRRFYIWKLELWWIAFDSPQFYPESRKHIKGNWFWR
Ga0114918_1000001612	3300009149	Deep Subsurface	MEVSVAQRRFYIWKLELWWIAFDSPQFYPEDRNHIKGNWFWRS*
Ga0114918_107036171	3300009149	Deep Subsurface	MDVITGERKFFIWKLEWWWIVFDKEEFYPEGRAHIKGNMFWRK*
Ga0114966_100758883	3300009161	Freshwater Lake	MLEYNVSERRFFIWKLELWWIAFDHPQFYPDGRKYLRGNWFWRTKK*
Ga0105102_104209281	3300009165	Freshwater Sediment	KRRFHIWKLELWWVAFNKVEFHPEDRKHLIGNWFWRT*
Ga0105102_104713352	3300009165	Freshwater Sediment	MLELNVAQRRFFIWKLELWWIAFDKAEFHPEGRKHLKGNWFWRQ*
Ga0105102_106903261	3300009165	Freshwater Sediment	MKDYIVNERRFYIWKLELWYVAFNDSQFYPDCRVKLKGNW
Ga0114969_100425638	3300009181	Freshwater Lake	MYTIAQRRFYIWKLELWWIAFDDDAFHPKNRIHLIGNWFWRL*
Ga0098043_10094223	3300010148	Marine	MKVTVAYRKFHIWKLELWWVFSDAFPPKGRKKIKGNWYWRTNKPQ*
Ga0098059_10045622	3300010153	Marine	MEVNVAQRRFYVWKLELWWVAFDSPQFYPVSRKHIKGNWFWRQ*
Ga0133913_130405112	3300010885	Freshwater Lake	MYTVAQRRFYIWKLELWWIAFDDDAFHPEGRKHIKGNWFWRI*
Ga0137843_10513601	3300010932	Subsea Pool	MKVNVAQRRFYIWKLELWWIAFDISKFYPKGRKYIKGNWFWRQ*
Ga0136587_10370914	3300011188	Saline Lake	MVTINERTFYIWKLEFWWVAFNKEEFYPEDRKHLFKNVFWRI*
Ga0157141_10045393	3300012346	Freshwater	MYTVAERIFYIWRLEFWWVAFNDVGFYPEDRKHLKGRWFWRK*
Ga0164293_1005401012	3300013004	Freshwater	MITVNERRFYIWKLELWWIAFDKVEFHPENRKHLTGNWFWRT*
Ga0164293_100911811	3300013004	Freshwater	MLELNVAQRRFFIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRQ*
Ga0164293_101589652	3300013004	Freshwater	MKEYNVAQRLFYVWKLELWWIAFNSVEFYPEDRKHLKGNWFWRT*
Ga0164313_116995241	3300013101	Marine Sediment	MVNVGQRIFFIWKLELWWIAFDDPQFYPDDRTHIKGHWFWRH*
(restricted) Ga0172365_100620722	3300013127	Sediment	MVNVAEREFYIWKLEFWWIAFDKEEFYPAGRIHIKGGWFWRR*
(restricted) Ga0172372_100469746	3300013132	Freshwater	MIIVSERRFYIWKLELWWIAFNSVEFHPEDRKHLRGNWFWRT*
Ga0170791_155498323	3300013295	Freshwater	RQYTVAQRRFYIWKLELWWIAFDSPQFYPDGRKQLKGNWFWRT*
Ga0075359_11100512	3300014266	Natural And Restored Wetlands	MFEVNVAQRRFFIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRM*
Ga0164310_103874772	3300014913	Marine Sediment	MEVTVAYRKFHIWKLELWWVFSDAFPPKGRKKIKGNWYWRTNKPQ*
Ga0134315_100122110	3300014962	Surface Water	MYVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKDNWFWRM*
Ga0181347_100759910	3300017722	Freshwater Lake	VSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKK
Ga0181347_10712831	3300017722	Freshwater Lake	VSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKKIKE
Ga0181347_11420513	3300017722	Freshwater Lake	KVAERVFYIWKLERWWIAFDDDAFYPEDRKHLIGNWFWRT
Ga0181343_11023984	3300017766	Freshwater Lake	MITVAERKFYIWRLEFWWVAFNIAEYYPEDRKHLKGGWFWRK
Ga0181358_10168452	3300017774	Freshwater Lake	MEYNVAQRRFFIWKLELWWIAFDDDAFYPKNRIHLIGNWFWRI
Ga0181357_10327803	3300017777	Freshwater Lake	MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKKIKE
Ga0181349_11887342	3300017778	Freshwater Lake	MKEYNVAQRLFYIWKLELWWIAFNSVELYPEDRKHLRG
Ga0181346_12776561	3300017780	Freshwater Lake	IWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKKIKE
Ga0181355_10598373	3300017785	Freshwater Lake	MEYNVAQRRFFIWKLELWWIAFDDDAFYPKDRIHLIGNWFWKI
Ga0207193_100333564	3300020048	Freshwater Lake Sediment	MYNSAERIFYIWKLEYWWIAFDRVEFYPEGRKHLRGNWFWRK
Ga0207193_10676424	3300020048	Freshwater Lake Sediment	MKVVSERQFYIWKLEFWWVAFNALEFYPKDRKPLGHNWFWRK
Ga0211733_110496691	3300020160	Freshwater	MLEYKVSQRRFFIWKLEYWWIAFDHPQFYPDGRNYLRGNWFWRAKKIKKII
Ga0211731_101267977	3300020205	Freshwater	MYINSAERIFYIWKLELWWIAFDKAYFYPEGRKHLRGNWFWRTKKNKK
Ga0211678_101387512	3300020388	Marine	MEVNVAQRRFYIWKLELWWIAFDSPQFYPESRKHIKGNWFWRQ
Ga0208223_10317831	3300020519	Freshwater	AQRKFFIWKLELWWIAFNSAEFYPENRKHLKWNWFWRI
Ga0208485_10070754	3300020573	Freshwater	MLELNVAQRRFFIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRQ
Ga0222713_1000260032	3300021962	Estuarine Water	MEYNVAQRRFFIWKLELWWIAFDDDAFHPKNRIHLIGKWFWRI
Ga0222712_100588136	3300021963	Estuarine Water	MKEYIVNQRRFHIWKLELWWVAFDSPQFYPDGRTKLKGNWFWRNYCNL
Ga0222712_106149721	3300021963	Estuarine Water	MLEYNASERIFFIWKLEYWWIAFDHPQFYPEDRKHLRGNWFWRTRKIKD
Ga0224499_100002286	3300022206	Sediment	MEVNVAQRRFYIWKLELWWIAFDSPRFYPEGRKHIKGNWFWRQ
Ga0224499_102386842	3300022206	Sediment	MEVNVAQRRFYIWKLELWWIAFDSPQFYPEGRKHIKGN
Ga0181351_10020235	3300022407	Freshwater Lake	MSTFNVAERLFYIWKLEKWWIAFDSVEFYPEDRKHLVGNWFWRI
Ga0181351_11316751	3300022407	Freshwater Lake	WKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKKIKE
Ga0214919_100223853	3300023184	Freshwater	MFNVAERRFYIWKLELWWIAFDDDAFYPKDRIHLIGNWFWRI
(restricted) Ga0255050_1000017019	3300024052	Seawater	MEVNVAKRRFYIWKIELWWIAFDSPQFYPEDRSHIKGNWFWRQ
Ga0210003_1000004578	3300024262	Deep Subsurface	MEVSVAQRRFYIWKLELWWIAFDSPQFYPEDRNHIKGNWFWRS
Ga0244775_1001219219	3300024346	Estuarine	MKEYIVNQRRFFIWKLELWWIAFDSVEFYPEDRKHLRGNWFWRN
Ga0244775_104961902	3300024346	Estuarine	MLEYNVAVRRLYIWKLELWWIAFDSPQFYPEGRTHLKGNWFWRNRKDKK
Ga0255173_10004687	3300024358	Freshwater	MLEVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRM
Ga0255168_10311383	3300024506	Freshwater	MLEVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWF
Ga0256308_10409483	3300024549	Freshwater	MSTFKVAERRFFIWKLELWWIAFDDDAFYPEDRRHLIGNWFWRI
Ga0208553_100053637	3300025109	Marine	MEVTVAYRKFHIWKLELWWVFSDAFPPKGRKKIKGNWYWRTTKPQ
Ga0209128_11746591	3300025131	Marine	MEVNVAQRRFYIWKLELWWIAFGSPQFYPENRKHIKGNWFWRQ
Ga0255114_10153281	3300027145	Freshwater	MLEYNVSERIFFIWKLEYWWIAFDHPQFHPEDRKHL
Ga0255182_10483471	3300027503	Freshwater	AVKITIMLEVNVAQRRFYIWKLELWWIAFDKAEFYPEGRKHLKGNWFWRM
Ga0208974_11604213	3300027608	Freshwater Lentic	MFNVAERRFYIWKLELWWIAFDDDAFYPKDRIHLIGNWFWKI
Ga0209392_10014855	3300027683	Freshwater Sediment	MKDYIVNERRFYIWKLELWYVAFNDSQFYPDCRVKLKGNWFWRK
Ga0209443_10187512	3300027707	Freshwater Lake	MLEYNVSERIFFIWKLEYWWIAFDHPQFYPEDRKHLIGNWFWRTKK
Ga0209596_12688942	3300027754	Freshwater Lake	MYTVAQRRFYIWKLELWWIAFDDDAFHPEGRKHIKGNWFWRI
Ga0209353_103405331	3300027798	Freshwater Lake	VMYVAEREFYIWKLEKWWIAFDDDAFHPKNRVHLIGNWFWRI
Ga0209230_100945493	3300027836	Freshwater And Sediment	MYVAEREFYIWKLEKWWIAFDDDAFHPKNRVHLIGNWFWRI
Ga0209550_106813731	3300027892	Freshwater Lake	MYTVAQRRFFIWKLELWWIAFDSCEFYPEGRKQLKGNWFW
Ga0209820_11596062	3300027956	Freshwater Sediment	MEYNVAQRRFFIWKLELWWIAFDDNAFHPKNRIHLTGNWFWRI
Ga0209400_10284873	3300027963	Freshwater Lake	MLEYNVSERRFFIWKLELWWIAFDHPQFYPDGRKHLRGNWFWRTKK
Ga0306872_10019839	3300028361	Saline Lake	MVTINERTFYIWKLEFWWVAFNKEEFYPEDRKHLFKNVFWRI
Ga0304730_102869310	3300028394	Freshwater Lake	MYTIAQRRFYIWKLELWWIAFDDDAFHPKNRIHLIGNWFWRL
Ga0272441_1000831525	3300028920	Marine Sediment	MLNLIVAKRRFYIWKLELWWIAFNSPEFYPKGRINIKGNWFWRL
Ga0307380_106445992	3300031539	Soil	MDVIVSQRKFFIWKLELWWIAFDKIEFHPSGRGHIKGNWFWRK
Ga0307379_105259351	3300031565	Soil	MEVNVAQRRFYIWKLELWWIAFDSPQFYPEDRSHIKGNWFWRQ
Ga0307990_11858541	3300031645	Marine	MDLNVAQRRFYIGKLEFWWIAFNSNEFYPKGRKQLKGN
Ga0315908_115036411	3300031786	Freshwater	MYTVAQRRFFIWKLELWWIAFDSCEFYPEGCKQLKGN
Ga0315285_101432275	3300031885	Sediment	MVELNVAQRRLFIWKLELWWIAFDKAEFYPEGRKHLRGSWFWRQ
Ga0315904_109340571	3300031951	Freshwater	VNVAQRRFFVWKLELWWVAFDKAEFYPEGRKHLKGNWFWRT
Ga0315294_111894412	3300031952	Sediment	MSTFNVAERLFYIWKLEKWWIAFDSVEFYPEDRKHLVGNWFWRT
Ga0315540_101269623	3300032061	Salt Marsh Sediment	MINVAIREFYIWKLEYWWIALDNPQFYPEDRIHLFKNWFWRK
Ga0315905_101887555	3300032092	Freshwater	MLEYNVSERIFFIWKLEYWWIAFDHPQFYPDDRKHLRGNWFWRTKKIKE
Ga0334989_0012967_3340_3471	3300033984	Freshwater	MKYNVAQRRFFIWKLELWWIAFDNDAFHPKNRIHLIGNWFWRI
Ga0334979_0029761_782_910	3300033996	Freshwater	MITVNERRFYIWKLELWWIAFDKVEFHPENRKHLTGNWFWRT
Ga0334991_0093452_570_704	3300034013	Freshwater	MKEYNVAQRLFYVWKLELWWIAFNSVEFYPEDRKHLKGNWFWRT
Ga0334991_0254803_278_418	3300034013	Freshwater	MSTFKVAERVFYIWKLERWWIAFGDDAFYPSNRKHLIGNWFWRTKK
Ga0335029_0003877_11093_11227	3300034102	Freshwater	MKEYNVAQRLFYVWKLELWWIAFNSVEFYPEDIKHLKGNWFWRT
Ga0335066_0055114_2438_2572	3300034112	Freshwater	MLELNVAQRRFFIWKLELWWIAFDKAEFSPEGRKHLKGNWFWRQ
Ga0335053_0113266_1741_1863	3300034118	Freshwater	TVNERRFYIWKLELWWIAFDKVEFHPENRKHLTGNWFWRT
Ga0335065_0867560_1_111	3300034200	Freshwater	MLELNVAQRRFFIWKLELWWIAFDKAEFYPEGRKHLK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign