| Basic Information | |
|---|---|
| Family ID | F077295 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ENCDSELEDPDNLIRDAFDEHDLEKCPNCATIEEMTLVGLEK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.29 % |
| % of genes from short scaffolds (< 2000 bps) | 86.32 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (82.051 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (19.658 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.248 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.265 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 0.00% Coil/Unstructured: 81.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF14025 | DUF4241 | 18.80 |
| PF00037 | Fer4 | 0.85 |
| PF00210 | Ferritin | 0.85 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 82.05 % |
| All Organisms | root | All Organisms | 17.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.66% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 19.66% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.13% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.13% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.27% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.71% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.71% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.71% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.71% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.85% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.85% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020492 | Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020507 | Freshwater microbial communities from Lake Mendota, WI - 12SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027192 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes) | Environmental | Open in IMG/M |
| 3300027220 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027531 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200110853 | 2199352005 | Freshwater | ENCSAEFEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLEKK |
| JGI25924J51412_10337511 | 3300003491 | Freshwater Lake | WYYCEACDSELEDPDNLIRDAFQEQDLEKCPNCATIEEMTLVGLETK* |
| Ga0063233_102742583 | 3300003986 | Freshwater Lake | YYCEACDSELEDPDNLIRDAFDEHDLEKCPNCATLEEMTLVGLDTK* |
| Ga0066178_100916613 | 3300004124 | Freshwater Lake | NWFFCENCHAEFEDPDNLIRDAFDEQDLEKCPQCATIEEMTLVGLEK* |
| Ga0066180_103713582 | 3300004128 | Freshwater Lake | HNWFYCENCGAEFEDPDNIIRDAFDEADLQKCTECATIEEMTLVGLEK* |
| Ga0007787_104354023 | 3300004240 | Freshwater Lake | YCESCDSEWEDQDNIIRDAFQEQDLEKCPNCATIEELTLVGLETQ* |
| Ga0070374_101638241 | 3300005517 | Freshwater Lake | SYNWFYCENCRAEFEDPDNLIRDAFDEQDLEKCPQCATIEEMTLVGLEK* |
| Ga0070374_104757251 | 3300005517 | Freshwater Lake | NWHYCTNCSSEMEDPDNLIRDAFDEADLQKCPQCATIEEMTLVGLEK* |
| Ga0049081_102784811 | 3300005581 | Freshwater Lentic | WYYCENCDSELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA* |
| Ga0049085_101756681 | 3300005583 | Freshwater Lentic | DPDNIIRDAFQEVDLEKCPNCATIEEMTLVGLETQNAQL* |
| Ga0078894_109668213 | 3300005662 | Freshwater Lake | PWYYCENCDTEWEDIDNLIRDKFQEHDLEKCPNCATIEEIRMMEMK* |
| Ga0078894_116098101 | 3300005662 | Freshwater Lake | EDPDNLIRDAFQEQDLEKCPNCATLDEMTLVGMENK* |
| Ga0078894_116296281 | 3300005662 | Freshwater Lake | AEFEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLETK* |
| Ga0070744_100232491 | 3300006484 | Estuarine | EDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLEIK* |
| Ga0070744_100890551 | 3300006484 | Estuarine | CENCHAELEDPDNLIRDSFQDHDLEKCTECATLEEMTLVGLEK* |
| Ga0102877_11456741 | 3300007548 | Estuarine | FEDPDNTIRDAFDEADLQKCPQCATIEEMTLVGLETQNA* |
| Ga0102817_11626673 | 3300007555 | Estuarine | RVSYNWFYCEGCGAEFEDPDNLIRDAFDEHDLYKCPQCATLEEMTLVGLEIK* |
| Ga0102915_11798793 | 3300007562 | Estuarine | PWYYCESCDSEWEDPDNLIRDAFQEQDLEKCPNCATIEEMTLVGLDKANA* |
| Ga0102919_12188693 | 3300007597 | Estuarine | DNIIRDAFDEHDLYKCPQCATIEEMTLVGLDKANA* |
| Ga0102923_12888803 | 3300007606 | Estuarine | DNTVRDAFDEHDLEKCPNCATLKELTLVGLENYVIQV* |
| Ga0102897_10904751 | 3300007617 | Estuarine | SEWEDPDNLIRDAFQEQDLEKCPNCATIEEMTLVGLEK* |
| Ga0102871_11954083 | 3300007620 | Estuarine | VSHNWYYCENCGTEMEDPDNLIRDAFDEADLQKCPQCATIEEMTLVGLETQNA* |
| Ga0102872_11494591 | 3300007621 | Estuarine | SETEDPDNLIRDAFQEEDLEKCPDCATLEEMTLVGLDKK* |
| Ga0102895_12065901 | 3300007629 | Estuarine | ESCDSEWEDPDNLIRDAFQEQDLEKCPNCATIEEMTLVGLEK* |
| Ga0102859_10205256 | 3300007708 | Estuarine | YCEACDSEWEDPDNLIRDAFQEQDLEKCPNCATIEEMTLVEMENK* |
| Ga0105746_13593831 | 3300007973 | Estuary Water | VQVGIPWYYCEACDSEWEDPDNLIRDAFQEQDLEKCPNCATLDEMTLVGMENK* |
| Ga0102922_10147321 | 3300008021 | Estuarine | DPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLEIK* |
| Ga0114340_11136421 | 3300008107 | Freshwater, Plankton | AEFEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLDTRC* |
| Ga0114341_104055254 | 3300008108 | Freshwater, Plankton | EFEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLDTRC* |
| Ga0114341_104195841 | 3300008108 | Freshwater, Plankton | FEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLDTK* |
| Ga0114351_12368244 | 3300008117 | Freshwater, Plankton | NCHAELEDPDNLIRDAFQEHDLEKCTECATLEEMTLVGLER* |
| Ga0114351_13935941 | 3300008117 | Freshwater, Plankton | NCHAELEDPDNLIRDAFQEHDLEKCTECATLEEMTLVGLKIKETQ* |
| Ga0114355_12032991 | 3300008120 | Freshwater, Plankton | WFYCEGCGAEFEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLDTKC* |
| Ga0102891_11969891 | 3300008950 | Estuarine | PDNIIRDAFDEHDLEKCPQCATIEEMTLVGLETLNA* |
| Ga0102831_12933043 | 3300008996 | Estuarine | CSAEFEDPDNTIRDAFDEADLLKCPECAKIDEMTIVGLDKK* |
| Ga0102829_11180853 | 3300009026 | Estuarine | HAEFQDPDNLIRDAFDEADLQKCPQCATIDEMTLVELDK* |
| Ga0102860_10359884 | 3300009056 | Estuarine | WYYCENCDAEMEDPDNLIRDAFQEQDLEKCPKCATIEELTLVGLEK* |
| Ga0114973_102278845 | 3300009068 | Freshwater Lake | GAEFEDPDNTIRDAFDEHDLEKCPQCGTVEELKLVGVESPRNANL* |
| Ga0114973_105040444 | 3300009068 | Freshwater Lake | GAEFEDPDNTIRDAFDEHDLEKCPQCGTVEELKLVGVESPKNANL* |
| Ga0114978_107201413 | 3300009159 | Freshwater Lake | CDSELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQ* |
| Ga0114966_107111473 | 3300009161 | Freshwater Lake | ENCDSELEDPDNLIRDAFDEHDLEKCPNCATIEEMTLVGLEK* |
| Ga0114970_101957285 | 3300009163 | Freshwater Lake | PDNTIRDAFDEHDLEKCPQCGTVEELKLVGVESPKNANL* |
| Ga0114975_104040283 | 3300009164 | Freshwater Lake | CDSELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA* |
| Ga0114979_103077013 | 3300009180 | Freshwater Lake | QIRVSFNWFYCENCQAEFEDPDNIIRDAFDEHDLEKCPQCATIEELKLIRLETQ* |
| Ga0114976_104607583 | 3300009184 | Freshwater Lake | WFYCENCQAEFEDPDNIIRDAFDEHDLEKCPQCATIEELKLIRLETQ* |
| Ga0153801_10430433 | 3300012017 | Freshwater | SYNWFYCENCSAEFEDPDNIIRDKFDEADLEKCPNCATLEELLLIETDTPQ* |
| Ga0157623_10940681 | 3300012707 | Freshwater | WEDQDNIIRDAFQEQDLEKCPNCATIEELTLVGLETQ* |
| Ga0164293_100717257 | 3300013004 | Freshwater | EFEDPDNTVRDAFDEAELQKCPDCATLEEMTLVGMENK* |
| Ga0164293_103883811 | 3300013004 | Freshwater | VPWYFCENCDSELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA* |
| Ga0164293_108504783 | 3300013004 | Freshwater | EWEDPDNLIRDAFQEQDLEKCPNCATIEEMTLVGLEK* |
| Ga0164292_105577003 | 3300013005 | Freshwater | CENCDSELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA* |
| Ga0163199_11287041 | 3300013092 | Freshwater | DPDNLIRDAFDEHDLQKCPNCATIEEMTLLGLEK* |
| Ga0157622_11981023 | 3300013310 | Freshwater | WYYCESCDSEWEDQDNIIRDAFQEQDLEKCPNCATIEELTLVGLETQ* |
| Ga0177922_101459581 | 3300013372 | Freshwater | YYCEACDSELEDPDNLIRDAFQEQDLEKCPNCATLEEMTLVGLDNK* |
| Ga0177922_108658136 | 3300013372 | Freshwater | CENCHAELEDPDNLIRDSFQDHDLEKCPQCATLDEMTLVGMDTK* |
| Ga0181358_11376884 | 3300017774 | Freshwater Lake | ACDSELEDPDNLIRDAFQEQDLEKCPNCATIEEMTLVGLETK |
| Ga0181358_11790703 | 3300017774 | Freshwater Lake | VQVGIPWYYCEACDSELEDPDNLIRDAFQEQDLEKCPNCATLEEMTLVGLDNK |
| Ga0211732_10792641 | 3300020141 | Freshwater | CDSEWEDPDNLIRDAFQEQDLEKCPNCATIEEMTLVGLEK |
| Ga0211736_102587614 | 3300020151 | Freshwater | FEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLDTK |
| Ga0211736_104045581 | 3300020151 | Freshwater | SEWEDPDNLIRDAFQEQDLEKCPNCATLEEMTLVGLEK |
| Ga0211736_106257334 | 3300020151 | Freshwater | FEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLETK |
| Ga0211736_106628163 | 3300020151 | Freshwater | SELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA |
| Ga0211733_102134651 | 3300020160 | Freshwater | WYYCESCDSEWEDQDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA |
| Ga0211726_103425565 | 3300020161 | Freshwater | WEDQDNIIRDAFQEQDLEKCPNCATIEELTLVGLETQ |
| Ga0211729_108435544 | 3300020172 | Freshwater | ISHNWFYCENCGAEFEDPDNTIRDAFDEHDLEKCPQCGTVEELKLVGVESQRNANL |
| Ga0211729_108439455 | 3300020172 | Freshwater | ISHNWFYCENCGAEFEDPDNTIRDAFDEHDLEKCPQCGTVEELKLVGVGTPLTT |
| Ga0208483_10034451 | 3300020492 | Freshwater | PWYYCENCDSELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA |
| Ga0208697_10043786 | 3300020507 | Freshwater | DNIVRDAFDEHDLEKCPECATLEEITLVGLENRNANV |
| Ga0208599_10363491 | 3300020554 | Freshwater | LISHNWFYCENCGAEFEDPNNTIRDAFDEEDLQKCPQCATIEELTLVGLETQNNANI |
| Ga0208723_10057166 | 3300020571 | Freshwater | CENCGAEFEDPNNTIRDAFDEEDLQKCPQCATIEELTLVGLETQNNANI |
| Ga0208053_10366104 | 3300020575 | Freshwater | SEMEDIDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA |
| Ga0194048_103746313 | 3300021519 | Anoxic Zone Freshwater | NAELEDTNNTIRDAFQEQDLEKCPQCATIEEMKLVGLESINATI |
| Ga0222713_101162676 | 3300021962 | Estuarine Water | ENCHAELEDPDNLIRDAFQEHDLEKCTECATLEEMTLVGLKIKETQ |
| Ga0222713_101502791 | 3300021962 | Estuarine Water | CENCEAELEDPDNLIRDAFDEADLQKCPECATIEEMTLVGMEKK |
| Ga0244777_101640556 | 3300024343 | Estuarine | VRVSFNWFYCENCGAEFEDPDNLVRDAFDEADLQKCPQCATIEEMTLIEMEVK |
| Ga0244775_104262495 | 3300024346 | Estuarine | FYCEGCGAEFEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLEPK |
| Ga0244775_113331721 | 3300024346 | Estuarine | YCENCRAEFEDPDNLIRDAFDEHDLEKCPQCATLEELTLVGLETQNA |
| Ga0244776_102525456 | 3300024348 | Estuarine | QVGIPWYYCEACDSEWEDPDNLIRDAFQEQDLEKCPNCATIEEMTLVEMENK |
| Ga0244776_108069861 | 3300024348 | Estuarine | CENCHAEFEDPDNIIRDSFDEHDLYKCPQCATIEEMTLVGLDKANA |
| Ga0208546_10801483 | 3300025585 | Aqueous | DAEFEDPDNTIRDAFDEHDLEKCPNCATLEEMTLVGLETKND |
| Ga0208005_11642483 | 3300025848 | Aqueous | YCENCDAEFEDPDNTIRDAFDEHDLEKCPNCATLEEMTLVGLETKND |
| Ga0255064_10450993 | 3300027138 | Freshwater | ESCDSEWEDQDNLIRDAFQEQDLEKCPNCATIEELTLVGLETQ |
| Ga0255063_10867733 | 3300027151 | Freshwater | WEDQDNLIRDAFQEQDLEKCPNCATIEELTLVGLETQ |
| Ga0208673_10065806 | 3300027192 | Estuarine | CEGCSAEFEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLEIK |
| Ga0208927_10082231 | 3300027220 | Estuarine | CENCSTEMEDPDNIIRDSFQEHDLEKCPECATLEEMTLVGLETQNA |
| Ga0208440_10109441 | 3300027281 | Estuarine | GCSAEFEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLEIK |
| Ga0208923_10855894 | 3300027320 | Estuarine | CENCDSELEDPDNIIRDAFQEQDLEKCPNCATLEEMTLVGLDTK |
| Ga0208682_11089123 | 3300027531 | Estuarine | YCENCDSELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA |
| Ga0208897_11290684 | 3300027571 | Estuarine | SCGAEFEDPDNTIRDAFDEVDLQKCPNCATLEEMTLVGLDTP |
| Ga0209297_13692251 | 3300027733 | Freshwater Lake | QVLVSHNWFYCENCSAEFEDPDNIIRDKFDEADLEKCPNCATLEELLLIETDTPQ |
| Ga0209190_10301351 | 3300027736 | Freshwater Lake | TIRDAFDEHDLEKCPQCGTVEELKLVGVESPRNANL |
| Ga0209296_10465851 | 3300027759 | Freshwater Lake | NCDSEMEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA |
| Ga0209768_102218974 | 3300027772 | Freshwater Lake | EDPDNTIRDAFDEHDLEKCPQCGTVEELKLVGVESPKNANL |
| Ga0209500_102804001 | 3300027782 | Freshwater Lake | VSFNWFYCENCSAELEDPDNIIRDAFDEHDLQKCPQCATIEELKLIRLETQ |
| Ga0209358_101561311 | 3300027804 | Freshwater Lake | YCESCDSEWEDQDNIIRDAFQEQDLEKCPNCATIEELTLVGLETQ |
| Ga0209229_101548081 | 3300027805 | Freshwater And Sediment | VSYNWFYCENCGSEFEDPDNTIRDAFDEADLLKCPQCATLEEMTLVGLENK |
| Ga0209550_1000795329 | 3300027892 | Freshwater Lake | MEDPDNLIRDAFDEADLQKCPQCATIEEMTLIEMENK |
| Ga0209191_11941464 | 3300027969 | Freshwater Lake | SELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQ |
| Ga0209299_10356986 | 3300027974 | Freshwater Lake | DPNNTIRDAFDEQDLEKCPQCGTVEELKLVGVESPKNANL |
| (restricted) Ga0247835_11767851 | 3300028114 | Freshwater | KVDSPWYYCENCDTEWEDIDNLIRDKFQEHDLEKCPNCATIEEIRMMEMK |
| Ga0315900_103744251 | 3300031787 | Freshwater | IRVSYNWFYCENCSAEFEDPDNLIRDAFDEADLLKCPQCATIEEMTLVEMETNNG |
| Ga0315909_107128141 | 3300031857 | Freshwater | FCENCNAELEDPDNLIRDAFQEHDLEKCPECATLEEMTLVGMETK |
| Ga0334983_0201842_1078_1233 | 3300034060 | Freshwater | VGIPWYYCEACDSEWEDPDNLIRDAFQEQDLEKCPNCATLEEMTLVGLENK |
| Ga0335000_0274035_78_236 | 3300034063 | Freshwater | MVSEPCYFCETCDTEWDDPDNLIRDMFQEWDLDKCPNCATIEEIELVGWKAQ |
| Ga0335010_0183488_25_183 | 3300034092 | Freshwater | LVSHNWFYCENCSAEFEDPDNTIRDAFDEADLLKCPECATLKEITLVGLETK |
| Ga0335012_0015596_4381_4536 | 3300034093 | Freshwater | VPWYFCENCDSELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA |
| Ga0335030_0101333_1945_2097 | 3300034103 | Freshwater | NWFYCENCQAEFEDPDNTIRDAFDEQDLEKCPQCATIEELHLTGLETQNA |
| Ga0335031_0166920_2_121 | 3300034104 | Freshwater | EFEDPDNTIRDAFDEHDLYKCPQCATLEEMTLVGLDTKC |
| Ga0335036_0413944_753_860 | 3300034106 | Freshwater | DQDNIIRDAFQEQDLEKCPNCATIEELTLVGLETQ |
| Ga0335055_0164891_2_112 | 3300034110 | Freshwater | EDQDNIIRDAFQEQDLEKCPNCATIEELTLVGLETQ |
| Ga0335066_0073075_3_128 | 3300034112 | Freshwater | CDSEWEDQDNIIRDAFQEEDLEKCPNCATIEELTLVGLETQ |
| Ga0335068_0069573_1852_2019 | 3300034116 | Freshwater | RIGYNWYFCENCHAELEDPDNLIRDSFQDHDLEKCTECATLDEMTLVGLTIKETQ |
| Ga0335033_0259927_3_119 | 3300034117 | Freshwater | EWEDQDNIIRDAFQEQDLEKCPNCATIEELTLVGLETQ |
| Ga0335058_0083485_1711_1863 | 3300034121 | Freshwater | NWFYCENCQAEFEDPDNTIRDAFDEHDLEKCPNCATLKELTLVGLETQNA |
| Ga0335013_0549020_2_136 | 3300034284 | Freshwater | NCDSELEDPDNIIRDAFQEVDLEKCPNCATLEEMKLTGLETQNA |
| Ga0335048_0592615_370_513 | 3300034356 | Freshwater | WYYCEACDSEWEDPDNLIRDAFQEHDLEKCPNCATLDEMTLVGMENK |
| Ga0335064_0863054_435_548 | 3300034357 | Freshwater | EWEDPDNLIRDAFQEQDLEKCPNCATLEEMTLVGMEK |
| ⦗Top⦘ |