NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077276

Metagenome / Metatranscriptome Family F077276

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077276
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 36 residues
Representative Sequence VGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS
Number of Associated Samples 96
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.20 %
% of genes near scaffold ends (potentially truncated) 16.24 %
% of genes from short scaffolds (< 2000 bps) 73.50 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.675 % of family members)
Environment Ontology (ENVO) Unclassified
(29.915 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.043 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 34.92%    β-sheet: 0.00%    Coil/Unstructured: 65.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF04075F420H2_quin_red 51.28
PF02803Thiolase_C 11.11
PF01037AsnC_trans_reg 8.55
PF00230MIP 5.13
PF02885Glycos_trans_3N 2.56
PF00266Aminotran_5 1.71
PF13242Hydrolase_like 1.71
PF00027cNMP_binding 0.85
PF09969DUF2203 0.85
PF02467Whib 0.85
PF02151UVR 0.85
PF00583Acetyltransf_1 0.85
PF02775TPP_enzyme_C 0.85
PF13358DDE_3 0.85
PF02770Acyl-CoA_dh_M 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 11.11
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 5.13
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig127098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1031Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig506332All Organisms → cellular organisms → Bacteria1144Open in IMG/M
2199352025|deepsgr__Contig_174799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1580Open in IMG/M
3300000443|F12B_11147518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300000858|JGI10213J12805_10106341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1815Open in IMG/M
3300000956|JGI10216J12902_100915218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1435Open in IMG/M
3300001976|JGI24752J21851_1008692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1326Open in IMG/M
3300005543|Ga0070672_100833948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium812Open in IMG/M
3300005577|Ga0068857_100139363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2192Open in IMG/M
3300005577|Ga0068857_100312948All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300005598|Ga0066706_11200263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300005713|Ga0066905_100033899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2937Open in IMG/M
3300005713|Ga0066905_100809884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium813Open in IMG/M
3300005719|Ga0068861_100031756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3882Open in IMG/M
3300005719|Ga0068861_101437136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium675Open in IMG/M
3300005843|Ga0068860_100444795All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300005937|Ga0081455_10010758All Organisms → cellular organisms → Bacteria9250Open in IMG/M
3300005937|Ga0081455_10018245All Organisms → cellular organisms → Bacteria6693Open in IMG/M
3300005937|Ga0081455_10022313All Organisms → cellular organisms → Bacteria5919Open in IMG/M
3300005937|Ga0081455_10107635All Organisms → cellular organisms → Bacteria2222Open in IMG/M
3300006049|Ga0075417_10118447All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300006049|Ga0075417_10152678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1075Open in IMG/M
3300006049|Ga0075417_10318935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300006572|Ga0074051_10016789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1377Open in IMG/M
3300006576|Ga0074047_10028857All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300006580|Ga0074049_12776245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300006581|Ga0074048_13398733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300006844|Ga0075428_100049345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4618Open in IMG/M
3300006844|Ga0075428_100736067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1050Open in IMG/M
3300006853|Ga0075420_100378940All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300006865|Ga0073934_10124832All Organisms → cellular organisms → Bacteria1890Open in IMG/M
3300006871|Ga0075434_101380758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M
3300007790|Ga0105679_10325431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1872Open in IMG/M
3300009081|Ga0105098_10024638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2328Open in IMG/M
3300009088|Ga0099830_10314001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1254Open in IMG/M
3300009100|Ga0075418_10094099All Organisms → cellular organisms → Bacteria3184Open in IMG/M
3300009137|Ga0066709_100339633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2059Open in IMG/M
3300009137|Ga0066709_104057451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300009147|Ga0114129_12597887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300009148|Ga0105243_10022188All Organisms → cellular organisms → Bacteria4823Open in IMG/M
3300009609|Ga0105347_1134441All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300009789|Ga0126307_10000729All Organisms → cellular organisms → Bacteria21611Open in IMG/M
3300009810|Ga0105088_1068143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300009811|Ga0105084_1072797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300009812|Ga0105067_1025551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium842Open in IMG/M
3300009817|Ga0105062_1004890All Organisms → cellular organisms → Bacteria1927Open in IMG/M
3300009818|Ga0105072_1074896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300009822|Ga0105066_1092879All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300009836|Ga0105068_1131197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300010362|Ga0126377_10009523All Organisms → cellular organisms → Bacteria7497Open in IMG/M
3300010362|Ga0126377_12147461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300010403|Ga0134123_10002758All Organisms → cellular organisms → Bacteria11467Open in IMG/M
3300011440|Ga0137433_1173098All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300012204|Ga0137374_10302171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1312Open in IMG/M
3300012206|Ga0137380_10000465All Organisms → cellular organisms → Bacteria29173Open in IMG/M
3300012360|Ga0137375_10226929All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300012911|Ga0157301_10392645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300014745|Ga0157377_10201586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1263Open in IMG/M
3300017965|Ga0190266_10637411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300017965|Ga0190266_10964744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300017997|Ga0184610_1082743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria997Open in IMG/M
3300018028|Ga0184608_10092011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1257Open in IMG/M
3300018031|Ga0184634_10272228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300018052|Ga0184638_1189463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300018054|Ga0184621_10133358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium891Open in IMG/M
3300018072|Ga0184635_10165796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium882Open in IMG/M
3300018072|Ga0184635_10405702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300018074|Ga0184640_10171807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria973Open in IMG/M
3300018075|Ga0184632_10151718All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300018077|Ga0184633_10096780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1524Open in IMG/M
3300018078|Ga0184612_10050843All Organisms → cellular organisms → Bacteria2159Open in IMG/M
3300018078|Ga0184612_10403991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300018081|Ga0184625_10484562All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300018082|Ga0184639_10093937All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300018465|Ga0190269_11540474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300018469|Ga0190270_10078165All Organisms → cellular organisms → Bacteria2440Open in IMG/M
3300018469|Ga0190270_10449995All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300018481|Ga0190271_10980496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium970Open in IMG/M
3300018482|Ga0066669_10291161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1319Open in IMG/M
3300019233|Ga0184645_1080766All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300019255|Ga0184643_1131043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300019259|Ga0184646_1355524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300019361|Ga0173482_10733368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300019458|Ga0187892_10068294All Organisms → cellular organisms → Bacteria2287Open in IMG/M
3300021073|Ga0210378_10011885All Organisms → cellular organisms → Bacteria3655Open in IMG/M
3300021073|Ga0210378_10019537All Organisms → cellular organisms → Bacteria2747Open in IMG/M
3300022694|Ga0222623_10004887All Organisms → cellular organisms → Bacteria4705Open in IMG/M
3300025904|Ga0207647_10048528All Organisms → cellular organisms → Bacteria2636Open in IMG/M
3300025926|Ga0207659_10263459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1403Open in IMG/M
3300025961|Ga0207712_10692308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium889Open in IMG/M
3300026118|Ga0207675_100493529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1218Open in IMG/M
3300026318|Ga0209471_1023822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3059Open in IMG/M
3300027056|Ga0209879_1024232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1007Open in IMG/M
3300027056|Ga0209879_1031626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium877Open in IMG/M
3300027163|Ga0209878_1000553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5215Open in IMG/M
3300027577|Ga0209874_1010395All Organisms → cellular organisms → Bacteria2740Open in IMG/M
3300027873|Ga0209814_10139111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1039Open in IMG/M
3300027880|Ga0209481_10059002All Organisms → cellular organisms → Bacteria1792Open in IMG/M
3300027907|Ga0207428_10061803All Organisms → cellular organisms → Bacteria2964Open in IMG/M
3300027909|Ga0209382_10001181All Organisms → cellular organisms → Bacteria41726Open in IMG/M
3300027909|Ga0209382_10207727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2241Open in IMG/M
3300027952|Ga0209889_1050945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium866Open in IMG/M
3300028592|Ga0247822_11001317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300028796|Ga0307287_10218626All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300028814|Ga0307302_10040732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2152Open in IMG/M
3300028814|Ga0307302_10621140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300028828|Ga0307312_11015321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300028875|Ga0307289_10077327All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300028878|Ga0307278_10042222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2074Open in IMG/M
3300028884|Ga0307308_10332838All Organisms → cellular organisms → Bacteria → Terrabacteria group727Open in IMG/M
3300030336|Ga0247826_10217879All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300030336|Ga0247826_11349081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300031226|Ga0307497_10083970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1205Open in IMG/M
3300031740|Ga0307468_101753942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300032003|Ga0310897_10197947All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300033811|Ga0364924_046019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium923Open in IMG/M
3300034151|Ga0364935_0162796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium709Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment11.97%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.97%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand10.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.13%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.27%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.42%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere3.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.56%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.56%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.71%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.85%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.85%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.85%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_164477302124908045SoilVGFNAMQPGRLKRADLLFFLIGVVVIVALIVWAVW
KansclcFeb2_041574602124908045SoilVGFNAMQPGRLKRGDLIFFVVGVAVIVALIVWAVS
deepsgr_029598102199352025SoilVGFNAMQPGKLKRGDLIFFAIGVAVIVALIVWAVS
F12B_1114751823300000443SoilVGFNAMQPGKLKRGDLIFFAIGVAVIVALIEWAVS*
JGI10213J12805_1010634133300000858SoilMGFNAMQPGKIKRGDLVFFLVGLAVIVALVVWAVW*
JGI10216J12902_10091521843300000956SoilVGFNAMQPGRLKRADLLFFLIGVVVIVALIVWAVW*
JGI24752J21851_100869233300001976Corn, Switchgrass And Miscanthus RhizosphereVGFNAMQPGKLKRGDLIFFAIGVAVIVVLIVWAVS*
Ga0070672_10083394823300005543Miscanthus RhizosphereLGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS*
Ga0068857_10013936353300005577Corn RhizosphereVGFNAMQPGRLKRGDLIFFVVGVVVIVALVVWAIS*
Ga0068857_10031294813300005577Corn RhizosphereGSPRGRDVGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS*
Ga0066706_1120026323300005598SoilVGFNSMQPGRVKRSDLVLFGVGMVVIAALVLWALYG*
Ga0066905_10003389943300005713Tropical Forest SoilVGFNAMQPGRLKRPDLWFFLIGVAVIVALIVWAVW*
Ga0066905_10080988423300005713Tropical Forest SoilMGFNAMQPGRLKRSDLLFFLIGVAVIVALIVWAVW*
Ga0068861_10003175643300005719Switchgrass RhizosphereVTLGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS*
Ga0068861_10143713633300005719Switchgrass RhizosphereMGFNAMQPGKLKRGDLIFFAIGVAVIVALIVWAVS*
Ga0068860_10044479533300005843Switchgrass RhizosphereLGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS*
Ga0081455_1001075863300005937Tabebuia Heterophylla RhizosphereVTLGFNAMQPGRLKRGDLIFFVVGVAVIVALIVWAIS*
Ga0081455_1001824543300005937Tabebuia Heterophylla RhizosphereVGFNAMQPGRLKRADLLFFVIGIVVIVALVVWAVW*
Ga0081455_1002231373300005937Tabebuia Heterophylla RhizosphereVGFNAMQPGRLNRADLWFFLIGVVVIIALIAWAVW*
Ga0081455_1010763523300005937Tabebuia Heterophylla RhizosphereVGAADVGFNAMQPGRLKRSDLLFFLIGVAVIVALIVWAVW*
Ga0075417_1011844713300006049Populus RhizosphereVTLGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS*
Ga0075417_1015267823300006049Populus RhizosphereMGFNAMQPGRLKPADLWFFLIGVVVIVALIAWAVW*
Ga0075417_1031893533300006049Populus RhizosphereVPDVGFNAMQPGRLKRADLWFFLIGVVVIVALIVWAVW*
Ga0074051_1001678943300006572SoilVGFNAMQPGRLKRGDLIFFVVGVVVIVALIVWAVS*
Ga0074047_1002885723300006576SoilVGFNAMQPGRLKRGDLIFFMVGVVVIVALIVWAVS*
Ga0074049_1277624513300006580SoilVTLGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS*
Ga0074048_1339873323300006581SoilLGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS*
Ga0075428_10004934573300006844Populus RhizosphereVGFNAMQPGRIKRGDLLFLLLGIAAIVALVVWAVW*
Ga0075428_10073606733300006844Populus RhizosphereMGFNTMQPGKVKRGDLVFLLVGVAVIVALIVWAVS*
Ga0075420_10037894023300006853Populus RhizosphereMGFNTMQPGKVKRGDLVFFLVGVAVIVALIVWAVS*
Ga0073934_1012483243300006865Hot Spring SedimentMGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVS*
Ga0075434_10138075823300006871Populus RhizosphereVGFNAMQPGRLKRADLWFFLIGVVVIVALIVWAVW*
Ga0105679_1032543133300007790SoilMGFNAMQPGRIKRGDLLYLLAAIVVIVALIVWAVG*
Ga0105098_1002463833300009081Freshwater SedimentMGFNTMQPGKIKRGDLVFLLVGIAVIVALIVWAVS*
Ga0099830_1031400133300009088Vadose Zone SoilMGFNSMQPGKVRRSDLVLFGVGMAVIVALVLWAVYG*
Ga0075418_1009409943300009100Populus RhizosphereMGFNTMQPGKVKRGNLVFLLVGVAVIVALIVWAVS*
Ga0066709_10033963323300009137Grasslands SoilMGFNAMQPGKIKRGDLIMLVSGIAVIVALIVWAVR*
Ga0066709_10405745113300009137Grasslands SoilMGFNAMQPGKIKRGDIIMLVSGLAVIVALIVWAVR*
Ga0114129_1259788723300009147Populus RhizosphereVGFNAMQPGRLKRGDLLFFVVGVVVIVALVVWAIS*
Ga0105243_1002218813300009148Miscanthus RhizosphereRRGGVTLGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS*
Ga0105347_113444143300009609SoilVGFNAMQPGKLKRGDLLFFVIGVAVIVALIVWAVS*
Ga0126307_10000729183300009789Serpentine SoilVGFNAMQPGRLKRGDLIFFVVGVIVIVALIVWAVS*
Ga0105088_106814313300009810Groundwater SandMGFNTMQPGKVKRSDLVFFLVGVAVIVALIAWAVS*
Ga0105084_107279723300009811Groundwater SandMGFNTMQPGKVKRGDLVFLLVGIAVIVALIVWAIS*
Ga0105067_102555133300009812Groundwater SandMGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS*
Ga0105062_100489033300009817Groundwater SandMGFNTMQPGKVKRGDLLFLLVGVAVIVALIVWAVS*
Ga0105072_107489633300009818Groundwater SandVTLGFNAMQPGRLKRGDLIFFVVGVVVIVALVVWAIS*
Ga0105066_109287913300009822Groundwater SandSPKGHDMGFNTMQPGKVKRGDLVFLLVGVAVIVALIVWSVS*
Ga0105068_113119723300009836Groundwater SandQRGRDVGFNAMQPGRLKRGDLIFFVVGVVVIVALIVWAVS*
Ga0126377_1000952363300010362Tropical Forest SoilVGFNAMQPGRLKRADLWFFLIGVVVIAALVAWAVW*
Ga0126377_1214746133300010362Tropical Forest SoilPAAGGCVMGFNALQPGKLKRSDLLFFLIGVVVIVALIVWAVW*
Ga0134123_10002758153300010403Terrestrial SoilVTLGFNAMQPGRLKRGDLIFFLVGVLVIIALIVWAVS*
Ga0137433_117309813300011440SoilHDMGFNTMQPGKVKRGDLVFFLVGVAVIVGLIVWAVS*
Ga0137374_1030217133300012204Vadose Zone SoilVGFNAMQPGRLKRGDLIFFVVGVIVIVALVVWAIS*
Ga0137380_1000046543300012206Vadose Zone SoilMGFNAMQPGKIKRGDIIMLVSGLVVIVALIVWAVR*
Ga0137375_1022692943300012360Vadose Zone SoilVGFNAMQPSRLKRGDLIFFVVGVVVIVALVVWAIS*
Ga0157301_1039264513300012911SoilDVGFNAMQPGRLKRSDLLFFLIGVIVIVALIVWAAS*
Ga0157377_1020158643300014745Miscanthus RhizosphereVTLGFNVMQPGRLKRGDLIFFLVGVVVIVALIVWAVS*
Ga0190266_1063741123300017965SoilVGFNAMQPGRLKRGDLIFFVVGVVVIVALVVWAIS
Ga0190266_1096474423300017965SoilMGFNTMQPGKVKRGDLVFFLVGVAVIVALIVWAIS
Ga0184610_108274323300017997Groundwater SedimentMGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVS
Ga0184608_1009201133300018028Groundwater SedimentLGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS
Ga0184634_1027222823300018031Groundwater SedimentVTVGFNAMQPGRIKRGDLAFLLIGLAVIVALVVWAVW
Ga0184638_118946323300018052Groundwater SedimentMGFNTMQPGKVKRGDLVFLLVGVAVIVALIVWAVS
Ga0184621_1013335823300018054Groundwater SedimentVGFNAMQPGRLKRGDLIFFVVGVVVIVALILWAVS
Ga0184635_1016579643300018072Groundwater SedimentKGHDMGFNTMQPGKVKRGDLLFLLVGVAVIVALIVWAVS
Ga0184635_1040570223300018072Groundwater SedimentGRDVGFNAMQPGKLKRGDLIFFAIGVAVIVALIVWAVS
Ga0184640_1017180723300018074Groundwater SedimentMGFNAMQPGRIKRGDLLFLLIGLAVIAALVVWAVW
Ga0184632_1015171813300018075Groundwater SedimentHDMGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVS
Ga0184633_1009678033300018077Groundwater SedimentVGFNAMQPGRIKRGDLVFLLIGLAVIVALVVWAVW
Ga0184612_1005084353300018078Groundwater SedimentMTVGFNAMQPGRIKRGDLAFLLIGLAVIVALVVWAVW
Ga0184612_1040399123300018078Groundwater SedimentVGFNAMQPGRLKRGDLIFFVVGVVVIVALIVWAVS
Ga0184625_1048456213300018081Groundwater SedimentHDMGFNTMQPGKVKRGDLLFLLVGVAVIVALIVWAVS
Ga0184639_1009393753300018082Groundwater SedimentVGFNAMQPGRIKRGDLAFLLIGLAVIVALVVWAVW
Ga0190269_1154047423300018465SoilVTLGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS
Ga0190270_1007816553300018469SoilMGFNTMQPGKVKRGDLVFFLVGVAVIVALIVWAVS
Ga0190270_1044999523300018469SoilVGFNAMQPGRLKRGDLVFFVVGVVVIVALIVWAAS
Ga0190271_1098049643300018481SoilMGFNTMQPGKVKRGDLVFLLVGVVVIVALIVWAVS
Ga0066669_1029116123300018482Grasslands SoilMGFNAMQPGKIKRGDLIMLVSGIAVIVALIVWAVR
Ga0184645_108076633300019233Groundwater SedimentMGFNTMQPGKVKRSDLVFFLLGVAVIVALIVWAVS
Ga0184643_113104313300019255Groundwater SedimentVGFNAMQPGQLKRGDLIFFAVGVAVIVALIVWAVS
Ga0184646_135552423300019259Groundwater SedimentPARRGGVTLGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS
Ga0173482_1073336813300019361SoilVGFNAMQPGRLKRSDLLFFLIGVIVIVALIVWAAS
Ga0187892_1006829453300019458Bio-OozeVGFNAMQPGRIKGADLAFLIVGLVVIAALVAWAVW
Ga0210378_1001188573300021073Groundwater SedimentMGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVW
Ga0210378_1001953753300021073Groundwater SedimentTGSPKGYDMGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVS
Ga0222623_1000488743300022694Groundwater SedimentVTLGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS
Ga0207647_1004852833300025904Corn RhizosphereVTLGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS
Ga0207659_1026345923300025926Miscanthus RhizosphereLGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS
Ga0207712_1069230823300025961Switchgrass RhizosphereVGFNAMQPGRLKRGDLIFFVVGMVVIVALVVWAIS
Ga0207675_10049352943300026118Switchgrass RhizosphereMGFNAMQPGKLKRGDLIFFAIGVAVIVALIVWAVS
Ga0209471_102382253300026318SoilMGFNSMQPGKVKRSDLVLFGVGVVVIVALVLWALYG
Ga0209879_102423233300027056Groundwater SandLGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAIS
Ga0209879_103162633300027056Groundwater SandMGFNTMQPGKVKRGDLVFLLVGIAVIVALIVWAIS
Ga0209878_100055373300027163Groundwater SandVRLGFNAMQPGRLKRGDLIFFMVGVVVIVALILWAVS
Ga0209874_101039543300027577Groundwater SandVGFNAMQPGRLKRGDLIFFVVGVAVIVALVVWAIS
Ga0209814_1013911123300027873Populus RhizosphereMGFNAMQPGRLKPADLWFFLIGVVVIVALIAWAVW
Ga0209481_1005900243300027880Populus RhizosphereLGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS
Ga0207428_1006180353300027907Populus RhizosphereVPDVGFNAMQPGRLKRADLWFFLIGVVVIVALIVWAVW
Ga0209382_10001181303300027909Populus RhizosphereVGFNAMQPGRIKRGDLLFLLLGIAAIVALVVWAVW
Ga0209382_1020772753300027909Populus RhizosphereDVGFNAMQPGRLKRADLWFFLIGVVVIVALIVWAVW
Ga0209889_105094533300027952Groundwater SandMGFNTMQPGKVKRGDLVFLLVGVAVIVALIVWAIS
Ga0247822_1100131723300028592SoilVGFNAMQPGKLKRGDLLFFAIGVAVIVALIVWAAS
Ga0307287_1021862613300028796SoilDVGFNAMQPGRLKRGDLIFFVVWVVVIVALVVWAIS
Ga0307302_1004073223300028814SoilVGFNAMQPGKLKRGDLVFFAIGVAVIVALIVWAVS
Ga0307302_1062114013300028814SoilVGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS
Ga0307312_1101532133300028828SoilVGFNAMQPGRLKRGDLIFFVVGVVVIVALVVWAVS
Ga0307289_1007732713300028875SoilRDVGFNAMQPGKLKRGDLVFFAIGVAVIVALIVWAVS
Ga0307278_1004222243300028878SoilVGFNAMQPGKTKRGDIIMLVSGILVIVALIVWAVH
Ga0307308_1033283823300028884SoilVGFNSMQPGKVKRVDVALFAAGIAVIVALFLWAMFG
Ga0247826_1021787943300030336SoilGGHDVGFNAMQPGKLKRGDLIFFAIGVAVIVALVVWAVS
Ga0247826_1134908123300030336SoilVGFNAMQPGKLKRGDLIFFAIGMAVIVALIVWAVS
Ga0307497_1008397023300031226SoilVGFNAMQPGKLKRGDLIFFAIGVAVIAALIVWAVS
Ga0307468_10175394223300031740Hardwood Forest SoilVGFNAMQPGKLKRGDLLFFAIGVAVIVALIVWAVS
Ga0310897_1019794733300032003SoilEVGFNAMQPGKLKRGDLLFFAIGVAVIVALIVWAAS
Ga0364924_046019_316_4293300033811SedimentMTVGFNAMQPGRIKRGDLAFLLIGLAVIVALVVWAVS
Ga0364935_0162796_225_3323300034151SedimentMGFNTMQPGKAKRSDLVFFLVGVAVIVALIVWAVS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.