| Basic Information | |
|---|---|
| Family ID | F077276 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 36 residues |
| Representative Sequence | VGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.20 % |
| % of genes near scaffold ends (potentially truncated) | 16.24 % |
| % of genes from short scaffolds (< 2000 bps) | 73.50 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.675 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.915 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.92% β-sheet: 0.00% Coil/Unstructured: 65.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF04075 | F420H2_quin_red | 51.28 |
| PF02803 | Thiolase_C | 11.11 |
| PF01037 | AsnC_trans_reg | 8.55 |
| PF00230 | MIP | 5.13 |
| PF02885 | Glycos_trans_3N | 2.56 |
| PF00266 | Aminotran_5 | 1.71 |
| PF13242 | Hydrolase_like | 1.71 |
| PF00027 | cNMP_binding | 0.85 |
| PF09969 | DUF2203 | 0.85 |
| PF02467 | Whib | 0.85 |
| PF02151 | UVR | 0.85 |
| PF00583 | Acetyltransf_1 | 0.85 |
| PF02775 | TPP_enzyme_C | 0.85 |
| PF13358 | DDE_3 | 0.85 |
| PF02770 | Acyl-CoA_dh_M | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 11.11 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 5.13 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig127098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig506332 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 2199352025|deepsgr__Contig_174799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1580 | Open in IMG/M |
| 3300000443|F12B_11147518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300000858|JGI10213J12805_10106341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1815 | Open in IMG/M |
| 3300000956|JGI10216J12902_100915218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1435 | Open in IMG/M |
| 3300001976|JGI24752J21851_1008692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1326 | Open in IMG/M |
| 3300005543|Ga0070672_100833948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300005577|Ga0068857_100139363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2192 | Open in IMG/M |
| 3300005577|Ga0068857_100312948 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300005598|Ga0066706_11200263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300005713|Ga0066905_100033899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2937 | Open in IMG/M |
| 3300005713|Ga0066905_100809884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300005719|Ga0068861_100031756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3882 | Open in IMG/M |
| 3300005719|Ga0068861_101437136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
| 3300005843|Ga0068860_100444795 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300005937|Ga0081455_10010758 | All Organisms → cellular organisms → Bacteria | 9250 | Open in IMG/M |
| 3300005937|Ga0081455_10018245 | All Organisms → cellular organisms → Bacteria | 6693 | Open in IMG/M |
| 3300005937|Ga0081455_10022313 | All Organisms → cellular organisms → Bacteria | 5919 | Open in IMG/M |
| 3300005937|Ga0081455_10107635 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300006049|Ga0075417_10118447 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300006049|Ga0075417_10152678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1075 | Open in IMG/M |
| 3300006049|Ga0075417_10318935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300006572|Ga0074051_10016789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1377 | Open in IMG/M |
| 3300006576|Ga0074047_10028857 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300006580|Ga0074049_12776245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300006581|Ga0074048_13398733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300006844|Ga0075428_100049345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4618 | Open in IMG/M |
| 3300006844|Ga0075428_100736067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1050 | Open in IMG/M |
| 3300006853|Ga0075420_100378940 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300006865|Ga0073934_10124832 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300006871|Ga0075434_101380758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300007790|Ga0105679_10325431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1872 | Open in IMG/M |
| 3300009081|Ga0105098_10024638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2328 | Open in IMG/M |
| 3300009088|Ga0099830_10314001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1254 | Open in IMG/M |
| 3300009100|Ga0075418_10094099 | All Organisms → cellular organisms → Bacteria | 3184 | Open in IMG/M |
| 3300009137|Ga0066709_100339633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2059 | Open in IMG/M |
| 3300009137|Ga0066709_104057451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300009147|Ga0114129_12597887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300009148|Ga0105243_10022188 | All Organisms → cellular organisms → Bacteria | 4823 | Open in IMG/M |
| 3300009609|Ga0105347_1134441 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300009789|Ga0126307_10000729 | All Organisms → cellular organisms → Bacteria | 21611 | Open in IMG/M |
| 3300009810|Ga0105088_1068143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300009811|Ga0105084_1072797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300009812|Ga0105067_1025551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 842 | Open in IMG/M |
| 3300009817|Ga0105062_1004890 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300009818|Ga0105072_1074896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
| 3300009822|Ga0105066_1092879 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300009836|Ga0105068_1131197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300010362|Ga0126377_10009523 | All Organisms → cellular organisms → Bacteria | 7497 | Open in IMG/M |
| 3300010362|Ga0126377_12147461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300010403|Ga0134123_10002758 | All Organisms → cellular organisms → Bacteria | 11467 | Open in IMG/M |
| 3300011440|Ga0137433_1173098 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012204|Ga0137374_10302171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1312 | Open in IMG/M |
| 3300012206|Ga0137380_10000465 | All Organisms → cellular organisms → Bacteria | 29173 | Open in IMG/M |
| 3300012360|Ga0137375_10226929 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300012911|Ga0157301_10392645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300014745|Ga0157377_10201586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1263 | Open in IMG/M |
| 3300017965|Ga0190266_10637411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300017965|Ga0190266_10964744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300017997|Ga0184610_1082743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
| 3300018028|Ga0184608_10092011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1257 | Open in IMG/M |
| 3300018031|Ga0184634_10272228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
| 3300018052|Ga0184638_1189463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 727 | Open in IMG/M |
| 3300018054|Ga0184621_10133358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
| 3300018072|Ga0184635_10165796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 882 | Open in IMG/M |
| 3300018072|Ga0184635_10405702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300018074|Ga0184640_10171807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300018075|Ga0184632_10151718 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300018077|Ga0184633_10096780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1524 | Open in IMG/M |
| 3300018078|Ga0184612_10050843 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
| 3300018078|Ga0184612_10403991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
| 3300018081|Ga0184625_10484562 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300018082|Ga0184639_10093937 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300018465|Ga0190269_11540474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300018469|Ga0190270_10078165 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
| 3300018469|Ga0190270_10449995 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300018481|Ga0190271_10980496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 970 | Open in IMG/M |
| 3300018482|Ga0066669_10291161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1319 | Open in IMG/M |
| 3300019233|Ga0184645_1080766 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300019255|Ga0184643_1131043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300019259|Ga0184646_1355524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300019361|Ga0173482_10733368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300019458|Ga0187892_10068294 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
| 3300021073|Ga0210378_10011885 | All Organisms → cellular organisms → Bacteria | 3655 | Open in IMG/M |
| 3300021073|Ga0210378_10019537 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
| 3300022694|Ga0222623_10004887 | All Organisms → cellular organisms → Bacteria | 4705 | Open in IMG/M |
| 3300025904|Ga0207647_10048528 | All Organisms → cellular organisms → Bacteria | 2636 | Open in IMG/M |
| 3300025926|Ga0207659_10263459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1403 | Open in IMG/M |
| 3300025961|Ga0207712_10692308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 889 | Open in IMG/M |
| 3300026118|Ga0207675_100493529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
| 3300026318|Ga0209471_1023822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3059 | Open in IMG/M |
| 3300027056|Ga0209879_1024232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
| 3300027056|Ga0209879_1031626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 877 | Open in IMG/M |
| 3300027163|Ga0209878_1000553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5215 | Open in IMG/M |
| 3300027577|Ga0209874_1010395 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
| 3300027873|Ga0209814_10139111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1039 | Open in IMG/M |
| 3300027880|Ga0209481_10059002 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300027907|Ga0207428_10061803 | All Organisms → cellular organisms → Bacteria | 2964 | Open in IMG/M |
| 3300027909|Ga0209382_10001181 | All Organisms → cellular organisms → Bacteria | 41726 | Open in IMG/M |
| 3300027909|Ga0209382_10207727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2241 | Open in IMG/M |
| 3300027952|Ga0209889_1050945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 866 | Open in IMG/M |
| 3300028592|Ga0247822_11001317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300028796|Ga0307287_10218626 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300028814|Ga0307302_10040732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2152 | Open in IMG/M |
| 3300028814|Ga0307302_10621140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300028828|Ga0307312_11015321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300028875|Ga0307289_10077327 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300028878|Ga0307278_10042222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2074 | Open in IMG/M |
| 3300028884|Ga0307308_10332838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 727 | Open in IMG/M |
| 3300030336|Ga0247826_10217879 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300030336|Ga0247826_11349081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300031226|Ga0307497_10083970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300031740|Ga0307468_101753942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300032003|Ga0310897_10197947 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300033811|Ga0364924_046019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 923 | Open in IMG/M |
| 3300034151|Ga0364935_0162796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 11.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 10.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.13% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.42% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.56% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.71% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.85% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.85% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_16447730 | 2124908045 | Soil | VGFNAMQPGRLKRADLLFFLIGVVVIVALIVWAVW |
| KansclcFeb2_04157460 | 2124908045 | Soil | VGFNAMQPGRLKRGDLIFFVVGVAVIVALIVWAVS |
| deepsgr_02959810 | 2199352025 | Soil | VGFNAMQPGKLKRGDLIFFAIGVAVIVALIVWAVS |
| F12B_111475182 | 3300000443 | Soil | VGFNAMQPGKLKRGDLIFFAIGVAVIVALIEWAVS* |
| JGI10213J12805_101063413 | 3300000858 | Soil | MGFNAMQPGKIKRGDLVFFLVGLAVIVALVVWAVW* |
| JGI10216J12902_1009152184 | 3300000956 | Soil | VGFNAMQPGRLKRADLLFFLIGVVVIVALIVWAVW* |
| JGI24752J21851_10086923 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | VGFNAMQPGKLKRGDLIFFAIGVAVIVVLIVWAVS* |
| Ga0070672_1008339482 | 3300005543 | Miscanthus Rhizosphere | LGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS* |
| Ga0068857_1001393635 | 3300005577 | Corn Rhizosphere | VGFNAMQPGRLKRGDLIFFVVGVVVIVALVVWAIS* |
| Ga0068857_1003129481 | 3300005577 | Corn Rhizosphere | GSPRGRDVGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS* |
| Ga0066706_112002632 | 3300005598 | Soil | VGFNSMQPGRVKRSDLVLFGVGMVVIAALVLWALYG* |
| Ga0066905_1000338994 | 3300005713 | Tropical Forest Soil | VGFNAMQPGRLKRPDLWFFLIGVAVIVALIVWAVW* |
| Ga0066905_1008098842 | 3300005713 | Tropical Forest Soil | MGFNAMQPGRLKRSDLLFFLIGVAVIVALIVWAVW* |
| Ga0068861_1000317564 | 3300005719 | Switchgrass Rhizosphere | VTLGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS* |
| Ga0068861_1014371363 | 3300005719 | Switchgrass Rhizosphere | MGFNAMQPGKLKRGDLIFFAIGVAVIVALIVWAVS* |
| Ga0068860_1004447953 | 3300005843 | Switchgrass Rhizosphere | LGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS* |
| Ga0081455_100107586 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VTLGFNAMQPGRLKRGDLIFFVVGVAVIVALIVWAIS* |
| Ga0081455_100182454 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VGFNAMQPGRLKRADLLFFVIGIVVIVALVVWAVW* |
| Ga0081455_100223137 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VGFNAMQPGRLNRADLWFFLIGVVVIIALIAWAVW* |
| Ga0081455_101076352 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VGAADVGFNAMQPGRLKRSDLLFFLIGVAVIVALIVWAVW* |
| Ga0075417_101184471 | 3300006049 | Populus Rhizosphere | VTLGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS* |
| Ga0075417_101526782 | 3300006049 | Populus Rhizosphere | MGFNAMQPGRLKPADLWFFLIGVVVIVALIAWAVW* |
| Ga0075417_103189353 | 3300006049 | Populus Rhizosphere | VPDVGFNAMQPGRLKRADLWFFLIGVVVIVALIVWAVW* |
| Ga0074051_100167894 | 3300006572 | Soil | VGFNAMQPGRLKRGDLIFFVVGVVVIVALIVWAVS* |
| Ga0074047_100288572 | 3300006576 | Soil | VGFNAMQPGRLKRGDLIFFMVGVVVIVALIVWAVS* |
| Ga0074049_127762451 | 3300006580 | Soil | VTLGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS* |
| Ga0074048_133987332 | 3300006581 | Soil | LGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS* |
| Ga0075428_1000493457 | 3300006844 | Populus Rhizosphere | VGFNAMQPGRIKRGDLLFLLLGIAAIVALVVWAVW* |
| Ga0075428_1007360673 | 3300006844 | Populus Rhizosphere | MGFNTMQPGKVKRGDLVFLLVGVAVIVALIVWAVS* |
| Ga0075420_1003789402 | 3300006853 | Populus Rhizosphere | MGFNTMQPGKVKRGDLVFFLVGVAVIVALIVWAVS* |
| Ga0073934_101248324 | 3300006865 | Hot Spring Sediment | MGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVS* |
| Ga0075434_1013807582 | 3300006871 | Populus Rhizosphere | VGFNAMQPGRLKRADLWFFLIGVVVIVALIVWAVW* |
| Ga0105679_103254313 | 3300007790 | Soil | MGFNAMQPGRIKRGDLLYLLAAIVVIVALIVWAVG* |
| Ga0105098_100246383 | 3300009081 | Freshwater Sediment | MGFNTMQPGKIKRGDLVFLLVGIAVIVALIVWAVS* |
| Ga0099830_103140013 | 3300009088 | Vadose Zone Soil | MGFNSMQPGKVRRSDLVLFGVGMAVIVALVLWAVYG* |
| Ga0075418_100940994 | 3300009100 | Populus Rhizosphere | MGFNTMQPGKVKRGNLVFLLVGVAVIVALIVWAVS* |
| Ga0066709_1003396332 | 3300009137 | Grasslands Soil | MGFNAMQPGKIKRGDLIMLVSGIAVIVALIVWAVR* |
| Ga0066709_1040574511 | 3300009137 | Grasslands Soil | MGFNAMQPGKIKRGDIIMLVSGLAVIVALIVWAVR* |
| Ga0114129_125978872 | 3300009147 | Populus Rhizosphere | VGFNAMQPGRLKRGDLLFFVVGVVVIVALVVWAIS* |
| Ga0105243_100221881 | 3300009148 | Miscanthus Rhizosphere | RRGGVTLGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS* |
| Ga0105347_11344414 | 3300009609 | Soil | VGFNAMQPGKLKRGDLLFFVIGVAVIVALIVWAVS* |
| Ga0126307_1000072918 | 3300009789 | Serpentine Soil | VGFNAMQPGRLKRGDLIFFVVGVIVIVALIVWAVS* |
| Ga0105088_10681431 | 3300009810 | Groundwater Sand | MGFNTMQPGKVKRSDLVFFLVGVAVIVALIAWAVS* |
| Ga0105084_10727972 | 3300009811 | Groundwater Sand | MGFNTMQPGKVKRGDLVFLLVGIAVIVALIVWAIS* |
| Ga0105067_10255513 | 3300009812 | Groundwater Sand | MGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS* |
| Ga0105062_10048903 | 3300009817 | Groundwater Sand | MGFNTMQPGKVKRGDLLFLLVGVAVIVALIVWAVS* |
| Ga0105072_10748963 | 3300009818 | Groundwater Sand | VTLGFNAMQPGRLKRGDLIFFVVGVVVIVALVVWAIS* |
| Ga0105066_10928791 | 3300009822 | Groundwater Sand | SPKGHDMGFNTMQPGKVKRGDLVFLLVGVAVIVALIVWSVS* |
| Ga0105068_11311972 | 3300009836 | Groundwater Sand | QRGRDVGFNAMQPGRLKRGDLIFFVVGVVVIVALIVWAVS* |
| Ga0126377_100095236 | 3300010362 | Tropical Forest Soil | VGFNAMQPGRLKRADLWFFLIGVVVIAALVAWAVW* |
| Ga0126377_121474613 | 3300010362 | Tropical Forest Soil | PAAGGCVMGFNALQPGKLKRSDLLFFLIGVVVIVALIVWAVW* |
| Ga0134123_1000275815 | 3300010403 | Terrestrial Soil | VTLGFNAMQPGRLKRGDLIFFLVGVLVIIALIVWAVS* |
| Ga0137433_11730981 | 3300011440 | Soil | HDMGFNTMQPGKVKRGDLVFFLVGVAVIVGLIVWAVS* |
| Ga0137374_103021713 | 3300012204 | Vadose Zone Soil | VGFNAMQPGRLKRGDLIFFVVGVIVIVALVVWAIS* |
| Ga0137380_100004654 | 3300012206 | Vadose Zone Soil | MGFNAMQPGKIKRGDIIMLVSGLVVIVALIVWAVR* |
| Ga0137375_102269294 | 3300012360 | Vadose Zone Soil | VGFNAMQPSRLKRGDLIFFVVGVVVIVALVVWAIS* |
| Ga0157301_103926451 | 3300012911 | Soil | DVGFNAMQPGRLKRSDLLFFLIGVIVIVALIVWAAS* |
| Ga0157377_102015864 | 3300014745 | Miscanthus Rhizosphere | VTLGFNVMQPGRLKRGDLIFFLVGVVVIVALIVWAVS* |
| Ga0190266_106374112 | 3300017965 | Soil | VGFNAMQPGRLKRGDLIFFVVGVVVIVALVVWAIS |
| Ga0190266_109647442 | 3300017965 | Soil | MGFNTMQPGKVKRGDLVFFLVGVAVIVALIVWAIS |
| Ga0184610_10827432 | 3300017997 | Groundwater Sediment | MGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVS |
| Ga0184608_100920113 | 3300018028 | Groundwater Sediment | LGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS |
| Ga0184634_102722282 | 3300018031 | Groundwater Sediment | VTVGFNAMQPGRIKRGDLAFLLIGLAVIVALVVWAVW |
| Ga0184638_11894632 | 3300018052 | Groundwater Sediment | MGFNTMQPGKVKRGDLVFLLVGVAVIVALIVWAVS |
| Ga0184621_101333582 | 3300018054 | Groundwater Sediment | VGFNAMQPGRLKRGDLIFFVVGVVVIVALILWAVS |
| Ga0184635_101657964 | 3300018072 | Groundwater Sediment | KGHDMGFNTMQPGKVKRGDLLFLLVGVAVIVALIVWAVS |
| Ga0184635_104057022 | 3300018072 | Groundwater Sediment | GRDVGFNAMQPGKLKRGDLIFFAIGVAVIVALIVWAVS |
| Ga0184640_101718072 | 3300018074 | Groundwater Sediment | MGFNAMQPGRIKRGDLLFLLIGLAVIAALVVWAVW |
| Ga0184632_101517181 | 3300018075 | Groundwater Sediment | HDMGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVS |
| Ga0184633_100967803 | 3300018077 | Groundwater Sediment | VGFNAMQPGRIKRGDLVFLLIGLAVIVALVVWAVW |
| Ga0184612_100508435 | 3300018078 | Groundwater Sediment | MTVGFNAMQPGRIKRGDLAFLLIGLAVIVALVVWAVW |
| Ga0184612_104039912 | 3300018078 | Groundwater Sediment | VGFNAMQPGRLKRGDLIFFVVGVVVIVALIVWAVS |
| Ga0184625_104845621 | 3300018081 | Groundwater Sediment | HDMGFNTMQPGKVKRGDLLFLLVGVAVIVALIVWAVS |
| Ga0184639_100939375 | 3300018082 | Groundwater Sediment | VGFNAMQPGRIKRGDLAFLLIGLAVIVALVVWAVW |
| Ga0190269_115404742 | 3300018465 | Soil | VTLGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS |
| Ga0190270_100781655 | 3300018469 | Soil | MGFNTMQPGKVKRGDLVFFLVGVAVIVALIVWAVS |
| Ga0190270_104499952 | 3300018469 | Soil | VGFNAMQPGRLKRGDLVFFVVGVVVIVALIVWAAS |
| Ga0190271_109804964 | 3300018481 | Soil | MGFNTMQPGKVKRGDLVFLLVGVVVIVALIVWAVS |
| Ga0066669_102911612 | 3300018482 | Grasslands Soil | MGFNAMQPGKIKRGDLIMLVSGIAVIVALIVWAVR |
| Ga0184645_10807663 | 3300019233 | Groundwater Sediment | MGFNTMQPGKVKRSDLVFFLLGVAVIVALIVWAVS |
| Ga0184643_11310431 | 3300019255 | Groundwater Sediment | VGFNAMQPGQLKRGDLIFFAVGVAVIVALIVWAVS |
| Ga0184646_13555242 | 3300019259 | Groundwater Sediment | PARRGGVTLGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS |
| Ga0173482_107333681 | 3300019361 | Soil | VGFNAMQPGRLKRSDLLFFLIGVIVIVALIVWAAS |
| Ga0187892_100682945 | 3300019458 | Bio-Ooze | VGFNAMQPGRIKGADLAFLIVGLVVIAALVAWAVW |
| Ga0210378_100118857 | 3300021073 | Groundwater Sediment | MGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVW |
| Ga0210378_100195375 | 3300021073 | Groundwater Sediment | TGSPKGYDMGFNTMQPGKVKRSDLVFFLVGVAVIVALIVWAVS |
| Ga0222623_100048874 | 3300022694 | Groundwater Sediment | VTLGFNAMQPGRLKRGDLIFFLVGVVVIVALILWAVS |
| Ga0207647_100485283 | 3300025904 | Corn Rhizosphere | VTLGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS |
| Ga0207659_102634592 | 3300025926 | Miscanthus Rhizosphere | LGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS |
| Ga0207712_106923082 | 3300025961 | Switchgrass Rhizosphere | VGFNAMQPGRLKRGDLIFFVVGMVVIVALVVWAIS |
| Ga0207675_1004935294 | 3300026118 | Switchgrass Rhizosphere | MGFNAMQPGKLKRGDLIFFAIGVAVIVALIVWAVS |
| Ga0209471_10238225 | 3300026318 | Soil | MGFNSMQPGKVKRSDLVLFGVGVVVIVALVLWALYG |
| Ga0209879_10242323 | 3300027056 | Groundwater Sand | LGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAIS |
| Ga0209879_10316263 | 3300027056 | Groundwater Sand | MGFNTMQPGKVKRGDLVFLLVGIAVIVALIVWAIS |
| Ga0209878_10005537 | 3300027163 | Groundwater Sand | VRLGFNAMQPGRLKRGDLIFFMVGVVVIVALILWAVS |
| Ga0209874_10103954 | 3300027577 | Groundwater Sand | VGFNAMQPGRLKRGDLIFFVVGVAVIVALVVWAIS |
| Ga0209814_101391112 | 3300027873 | Populus Rhizosphere | MGFNAMQPGRLKPADLWFFLIGVVVIVALIAWAVW |
| Ga0209481_100590024 | 3300027880 | Populus Rhizosphere | LGFNAMQPGRLKRGDLIFFLVGVLVIVALIVWAVS |
| Ga0207428_100618035 | 3300027907 | Populus Rhizosphere | VPDVGFNAMQPGRLKRADLWFFLIGVVVIVALIVWAVW |
| Ga0209382_1000118130 | 3300027909 | Populus Rhizosphere | VGFNAMQPGRIKRGDLLFLLLGIAAIVALVVWAVW |
| Ga0209382_102077275 | 3300027909 | Populus Rhizosphere | DVGFNAMQPGRLKRADLWFFLIGVVVIVALIVWAVW |
| Ga0209889_10509453 | 3300027952 | Groundwater Sand | MGFNTMQPGKVKRGDLVFLLVGVAVIVALIVWAIS |
| Ga0247822_110013172 | 3300028592 | Soil | VGFNAMQPGKLKRGDLLFFAIGVAVIVALIVWAAS |
| Ga0307287_102186261 | 3300028796 | Soil | DVGFNAMQPGRLKRGDLIFFVVWVVVIVALVVWAIS |
| Ga0307302_100407322 | 3300028814 | Soil | VGFNAMQPGKLKRGDLVFFAIGVAVIVALIVWAVS |
| Ga0307302_106211401 | 3300028814 | Soil | VGFNAMQPGRLKRGDLIFFLVGVVVIVALIVWAVS |
| Ga0307312_110153213 | 3300028828 | Soil | VGFNAMQPGRLKRGDLIFFVVGVVVIVALVVWAVS |
| Ga0307289_100773271 | 3300028875 | Soil | RDVGFNAMQPGKLKRGDLVFFAIGVAVIVALIVWAVS |
| Ga0307278_100422224 | 3300028878 | Soil | VGFNAMQPGKTKRGDIIMLVSGILVIVALIVWAVH |
| Ga0307308_103328382 | 3300028884 | Soil | VGFNSMQPGKVKRVDVALFAAGIAVIVALFLWAMFG |
| Ga0247826_102178794 | 3300030336 | Soil | GGHDVGFNAMQPGKLKRGDLIFFAIGVAVIVALVVWAVS |
| Ga0247826_113490812 | 3300030336 | Soil | VGFNAMQPGKLKRGDLIFFAIGMAVIVALIVWAVS |
| Ga0307497_100839702 | 3300031226 | Soil | VGFNAMQPGKLKRGDLIFFAIGVAVIAALIVWAVS |
| Ga0307468_1017539422 | 3300031740 | Hardwood Forest Soil | VGFNAMQPGKLKRGDLLFFAIGVAVIVALIVWAVS |
| Ga0310897_101979473 | 3300032003 | Soil | EVGFNAMQPGKLKRGDLLFFAIGVAVIVALIVWAAS |
| Ga0364924_046019_316_429 | 3300033811 | Sediment | MTVGFNAMQPGRIKRGDLAFLLIGLAVIVALVVWAVS |
| Ga0364935_0162796_225_332 | 3300034151 | Sediment | MGFNTMQPGKAKRSDLVFFLVGVAVIVALIVWAVS |
| ⦗Top⦘ |