| Basic Information | |
|---|---|
| Family ID | F077269 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PCPGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.44 % |
| % of genes from short scaffolds (< 2000 bps) | 91.45 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.034 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (43.590 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.444 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.590 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 0.00% Coil/Unstructured: 87.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 11.97 |
| PF05016 | ParE_toxin | 11.97 |
| PF06718 | DUF1203 | 9.40 |
| PF00072 | Response_reg | 7.69 |
| PF00486 | Trans_reg_C | 5.13 |
| PF05973 | Gp49 | 4.27 |
| PF00196 | GerE | 1.71 |
| PF01177 | Asp_Glu_race | 1.71 |
| PF02311 | AraC_binding | 1.71 |
| PF00202 | Aminotran_3 | 1.71 |
| PF05960 | DUF885 | 1.71 |
| PF16640 | Big_3_5 | 0.85 |
| PF00498 | FHA | 0.85 |
| PF01547 | SBP_bac_1 | 0.85 |
| PF03704 | BTAD | 0.85 |
| PF11975 | Glyco_hydro_4C | 0.85 |
| PF13367 | PrsW-protease | 0.85 |
| PF04116 | FA_hydroxylase | 0.85 |
| PF14200 | RicinB_lectin_2 | 0.85 |
| PF01266 | DAO | 0.85 |
| PF10009 | DUF2252 | 0.85 |
| PF01425 | Amidase | 0.85 |
| PF00005 | ABC_tran | 0.85 |
| PF02129 | Peptidase_S15 | 0.85 |
| PF08327 | AHSA1 | 0.85 |
| PF13360 | PQQ_2 | 0.85 |
| PF02036 | SCP2 | 0.85 |
| PF05899 | Cupin_3 | 0.85 |
| PF04542 | Sigma70_r2 | 0.85 |
| PF13472 | Lipase_GDSL_2 | 0.85 |
| PF00583 | Acetyltransf_1 | 0.85 |
| PF00581 | Rhodanese | 0.85 |
| PF01925 | TauE | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 4.27 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 4.27 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.71 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.85 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.85 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.85 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.85 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.85 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.85 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.85 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.03 % |
| Unclassified | root | N/A | 11.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_108990148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 651 | Open in IMG/M |
| 3300005332|Ga0066388_107094528 | Not Available | 563 | Open in IMG/M |
| 3300005435|Ga0070714_100070024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3031 | Open in IMG/M |
| 3300005435|Ga0070714_100692731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus | 983 | Open in IMG/M |
| 3300005445|Ga0070708_101305430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
| 3300005610|Ga0070763_10493284 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005764|Ga0066903_102673585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 968 | Open in IMG/M |
| 3300005764|Ga0066903_102680765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 967 | Open in IMG/M |
| 3300005764|Ga0066903_102896273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 930 | Open in IMG/M |
| 3300005764|Ga0066903_103531362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300005764|Ga0066903_103894166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 801 | Open in IMG/M |
| 3300005901|Ga0075274_1054358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300006576|Ga0074047_11990301 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006804|Ga0079221_11802694 | Not Available | 501 | Open in IMG/M |
| 3300006806|Ga0079220_10671447 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006854|Ga0075425_100431557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1517 | Open in IMG/M |
| 3300006854|Ga0075425_102071124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 635 | Open in IMG/M |
| 3300007076|Ga0075435_101809930 | Not Available | 536 | Open in IMG/M |
| 3300010358|Ga0126370_12501603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 514 | Open in IMG/M |
| 3300010359|Ga0126376_11456571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 712 | Open in IMG/M |
| 3300010366|Ga0126379_10349507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1508 | Open in IMG/M |
| 3300010366|Ga0126379_11288242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 837 | Open in IMG/M |
| 3300010376|Ga0126381_102837691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 691 | Open in IMG/M |
| 3300010376|Ga0126381_103340876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 632 | Open in IMG/M |
| 3300010398|Ga0126383_12835480 | Not Available | 566 | Open in IMG/M |
| 3300010398|Ga0126383_13389427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300010937|Ga0137776_1112831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1210 | Open in IMG/M |
| 3300011271|Ga0137393_10064831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2895 | Open in IMG/M |
| 3300012211|Ga0137377_10039324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4330 | Open in IMG/M |
| 3300012285|Ga0137370_10194757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1187 | Open in IMG/M |
| 3300012285|Ga0137370_10391879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 840 | Open in IMG/M |
| 3300012363|Ga0137390_10137271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2426 | Open in IMG/M |
| 3300012363|Ga0137390_10310288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 1559 | Open in IMG/M |
| 3300012971|Ga0126369_11477585 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300012971|Ga0126369_11679954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 724 | Open in IMG/M |
| 3300012971|Ga0126369_12186503 | Not Available | 640 | Open in IMG/M |
| 3300013772|Ga0120158_10357069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 685 | Open in IMG/M |
| 3300016341|Ga0182035_10359094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
| 3300016357|Ga0182032_10053750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha | 2627 | Open in IMG/M |
| 3300016371|Ga0182034_11195322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 661 | Open in IMG/M |
| 3300016387|Ga0182040_10146737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha | 1675 | Open in IMG/M |
| 3300016445|Ga0182038_10302983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1307 | Open in IMG/M |
| 3300017926|Ga0187807_1178015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 685 | Open in IMG/M |
| 3300017955|Ga0187817_10505459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300018032|Ga0187788_10440485 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300020580|Ga0210403_10488626 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300020581|Ga0210399_10616231 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300020581|Ga0210399_11430393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
| 3300020582|Ga0210395_10934096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 644 | Open in IMG/M |
| 3300021374|Ga0213881_10109771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 1197 | Open in IMG/M |
| 3300021404|Ga0210389_10214022 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300021404|Ga0210389_10708774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 788 | Open in IMG/M |
| 3300021407|Ga0210383_10623742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 929 | Open in IMG/M |
| 3300021407|Ga0210383_11693651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300021479|Ga0210410_10809889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
| 3300021560|Ga0126371_11957839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 704 | Open in IMG/M |
| 3300021560|Ga0126371_12260871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 657 | Open in IMG/M |
| 3300021560|Ga0126371_12999164 | Not Available | 572 | Open in IMG/M |
| 3300021560|Ga0126371_13421734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300021860|Ga0213851_1448833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300025912|Ga0207707_10776634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 800 | Open in IMG/M |
| 3300025915|Ga0207693_10236428 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300025929|Ga0207664_10951915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 770 | Open in IMG/M |
| 3300025939|Ga0207665_10000276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 35590 | Open in IMG/M |
| 3300027908|Ga0209006_10851767 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300028803|Ga0307281_10404832 | Not Available | 523 | Open in IMG/M |
| 3300030511|Ga0268241_10196578 | Not Available | 511 | Open in IMG/M |
| 3300031474|Ga0170818_108431481 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300031544|Ga0318534_10625651 | Not Available | 611 | Open in IMG/M |
| 3300031546|Ga0318538_10201090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1064 | Open in IMG/M |
| 3300031546|Ga0318538_10458144 | Not Available | 691 | Open in IMG/M |
| 3300031549|Ga0318571_10180012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 746 | Open in IMG/M |
| 3300031573|Ga0310915_10013666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha | 4782 | Open in IMG/M |
| 3300031680|Ga0318574_10804649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 551 | Open in IMG/M |
| 3300031713|Ga0318496_10049771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2166 | Open in IMG/M |
| 3300031713|Ga0318496_10677131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 569 | Open in IMG/M |
| 3300031723|Ga0318493_10083340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1579 | Open in IMG/M |
| 3300031736|Ga0318501_10443444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
| 3300031744|Ga0306918_10159993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha | 1670 | Open in IMG/M |
| 3300031748|Ga0318492_10780907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300031751|Ga0318494_10439179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300031769|Ga0318526_10046674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1640 | Open in IMG/M |
| 3300031782|Ga0318552_10331184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 775 | Open in IMG/M |
| 3300031793|Ga0318548_10112159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1313 | Open in IMG/M |
| 3300031794|Ga0318503_10075234 | Not Available | 1055 | Open in IMG/M |
| 3300031796|Ga0318576_10475225 | Not Available | 590 | Open in IMG/M |
| 3300031796|Ga0318576_10539213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300031797|Ga0318550_10213629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 934 | Open in IMG/M |
| 3300031799|Ga0318565_10168249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300031821|Ga0318567_10052747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2106 | Open in IMG/M |
| 3300031832|Ga0318499_10187247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 807 | Open in IMG/M |
| 3300031835|Ga0318517_10063304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha | 1574 | Open in IMG/M |
| 3300031890|Ga0306925_11233290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300031896|Ga0318551_10678594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
| 3300031947|Ga0310909_10681339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 855 | Open in IMG/M |
| 3300031947|Ga0310909_11343662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300031954|Ga0306926_11741823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
| 3300032035|Ga0310911_10093449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1640 | Open in IMG/M |
| 3300032035|Ga0310911_10576837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
| 3300032055|Ga0318575_10279414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300032055|Ga0318575_10281571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300032059|Ga0318533_10820798 | Not Available | 682 | Open in IMG/M |
| 3300032064|Ga0318510_10337377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300032065|Ga0318513_10673413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300032066|Ga0318514_10105060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1436 | Open in IMG/M |
| 3300032068|Ga0318553_10246348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 933 | Open in IMG/M |
| 3300032068|Ga0318553_10348661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300032068|Ga0318553_10390106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300032076|Ga0306924_12566417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300032091|Ga0318577_10263174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 826 | Open in IMG/M |
| 3300032091|Ga0318577_10288509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 785 | Open in IMG/M |
| 3300032091|Ga0318577_10427732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300032174|Ga0307470_10727178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300032261|Ga0306920_103061774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300032261|Ga0306920_103266361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 605 | Open in IMG/M |
| 3300033290|Ga0318519_10943216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 43.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1089901481 | 3300000955 | Soil | SFAAFCRHVYSGPDGFAAVKFDVNLDGRVFLPCPRGR* |
| Ga0066388_1070945282 | 3300005332 | Tropical Forest Soil | QCPGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT* |
| Ga0070714_1000700241 | 3300005435 | Agricultural Soil | GQSCPPKRRFATFCRIVYAPPYGFAAVKFDVDLNGKMFYPCPRGT* |
| Ga0070714_1006927311 | 3300005435 | Agricultural Soil | CPRKRRFATFCRVVYAPSYGFAAVKFDVNLDGKTFYPCPHGT* |
| Ga0070708_1013054302 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DHYVCNPGQPCPGKRRFATFCRLVYAPSYGFAAVKFDVNLDGKIFYPCPRGT* |
| Ga0070763_104932841 | 3300005610 | Soil | SYAAFCRALYDPPLGFAAVKFDVDLDGRVFYPCPRGT* |
| Ga0066903_1026735853 | 3300005764 | Tropical Forest Soil | TFCRVVYAPSYGFTAIKFDVNLDGKYFYPCPRGT* |
| Ga0066903_1026807652 | 3300005764 | Tropical Forest Soil | ATFCARVYAPPGGFAAVKFDVDLDGKVFYPCPTGT* |
| Ga0066903_1028962731 | 3300005764 | Tropical Forest Soil | KRRFATFCRVVYAPSYGFTAVKFDVNLDGKTFYPCPHGT* |
| Ga0066903_1035313621 | 3300005764 | Tropical Forest Soil | KNFSTFCRIVYAPSYGYSAVKFNVNLDGSMFHPCPRGT* |
| Ga0066903_1038941661 | 3300005764 | Tropical Forest Soil | RRFATFCRIVYAPPGGFAAVKFDVDLNGKVFYPCPRGT* |
| Ga0075274_10543582 | 3300005901 | Rice Paddy Soil | QHRFSSFCHIVYAPADGFAAVKLNVNLDGTMFYPCPRGG* |
| Ga0074047_119903011 | 3300006576 | Soil | FATFCARVYAPPDGFAAVKFDVNLDGKVFEPCPAGT* |
| Ga0079221_118026942 | 3300006804 | Agricultural Soil | GQSCPPKRRFATFCRIIYAPPGGFSAVKFDVDLNGKMFYPCPRGT* |
| Ga0079220_106714472 | 3300006806 | Agricultural Soil | GRRCPPQREFSTFCHTVYSPPRGFAAVKLDVNLDGKTFFPCP* |
| Ga0075425_1004315575 | 3300006854 | Populus Rhizosphere | DHYVCNPGQPCQGKRSFATFCRLVWGAPGGFSAVKFDVNLDGKVFYPCPRGT* |
| Ga0075425_1020711243 | 3300006854 | Populus Rhizosphere | DHYVCNPGQPCQGKRSFATFCRLVWGAPGGFSAVKFDVNLNGKVFYPCPRGT* |
| Ga0075435_1018099302 | 3300007076 | Populus Rhizosphere | AYCRRIYDGKNGFAAVKFDVNLDGRTFYPCPRGR* |
| Ga0126370_125016031 | 3300010358 | Tropical Forest Soil | CTGGRSFAVFCRKIWAPAYGFAAVKFDVNLDGKVFFPCPRGV* |
| Ga0126376_114565712 | 3300010359 | Tropical Forest Soil | FATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT* |
| Ga0126379_103495073 | 3300010366 | Tropical Forest Soil | PHRFATFCRAIYAPADGFAAVKFDVNLDGKMFYPCPRGI* |
| Ga0126379_112882423 | 3300010366 | Tropical Forest Soil | NPGQPCQGKRSFATFCRLVWGRAGGFSAIKFDVNLDGKVFYPCPRGT* |
| Ga0126381_1028376911 | 3300010376 | Tropical Forest Soil | PGQPCPPKRRFATFCRVVYAPPPYGFSAVKFDVNLNGKIFYPCPRGT* |
| Ga0126381_1033408761 | 3300010376 | Tropical Forest Soil | GADHYVCNPGQNCPRKRRFATFCRLVYAPSYGFAAVKFDVNLDGKTFYPCPRGT* |
| Ga0126383_128354802 | 3300010398 | Tropical Forest Soil | FATFCRAIYAPADGFSAVKFDVNLDGKMFYPCPRGI* |
| Ga0126383_133894273 | 3300010398 | Tropical Forest Soil | CPGKRRFATFCRLVWGRPGGFSAVKFDVDLNGKVFYPCPRGT* |
| Ga0137776_11128311 | 3300010937 | Sediment | VCNPGQSCPPKRRFATFCRLVYAPPYGFTAIKFDVNLDAKTFYPCPNGT* |
| Ga0137393_100648313 | 3300011271 | Vadose Zone Soil | VSGQTSFATFCRLVYGSPGGFSAVKFDVNLDGKVFYPCPRGT* |
| Ga0137377_100393245 | 3300012211 | Vadose Zone Soil | CPHGRKTFAAFCRAVYAGPQGYAAVKFGVNLDGKVFLPCPRGR* |
| Ga0137370_101947572 | 3300012285 | Vadose Zone Soil | CNPGQSCPPKRRFATFCRVVYAPPGGFSAVKFDVDLNGKMFYPCPRGT* |
| Ga0137370_103918793 | 3300012285 | Vadose Zone Soil | KRSFATFCRLVWGAPGGFSAVKFDVDLNGKVFYPCPRGT* |
| Ga0137390_101372713 | 3300012363 | Vadose Zone Soil | AKCTGKHSFAAFCRAVYAPPLGFAAVKFDVNLDGKVFYPCPRGT* |
| Ga0137390_103102881 | 3300012363 | Vadose Zone Soil | NPGRSCPPKRRFATFCRVVYAPPGGFSAVKFDVDLNGKMFYPCPRGT* |
| Ga0126369_114775851 | 3300012971 | Tropical Forest Soil | FATFCRIIYAPPGGFSAVKFDVDLNGKVFYPCPRGT* |
| Ga0126369_116799542 | 3300012971 | Tropical Forest Soil | ATFCRVVYAPSYGFAAVKFDVNLDGRTFHPCPHGT* |
| Ga0126369_121865032 | 3300012971 | Tropical Forest Soil | TFCARVYAPPGGFAAVKFDVDLDGKVFYPCPTGT* |
| Ga0120158_103570691 | 3300013772 | Permafrost | HQRAFATFCAANYAPSYGFSAVKFDVNLDGKTFFPCPKGA* |
| Ga0182035_103590941 | 3300016341 | Soil | SCPPKRRFATFCAVVYAPPGGFSAVKFDVNLNGKLFYPCPRGT |
| Ga0182032_100537506 | 3300016357 | Soil | NPGQPCPGPRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0182034_111953221 | 3300016371 | Soil | QSCPPKRRFATFCRIVYAPPGGFSAVKFDVDLNGKMFFPCPRGT |
| Ga0182040_101467375 | 3300016387 | Soil | RRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0182038_103029834 | 3300016445 | Soil | YVCNPGQQCQGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT |
| Ga0187807_11780152 | 3300017926 | Freshwater Sediment | DGYVCNPGQSCAGRRSFSAFCRAVYAPSYGFAAVKFDVNLDGAMFYPCPKGV |
| Ga0187817_105054591 | 3300017955 | Freshwater Sediment | KFATFCRSIYAPSYGFAAVKLDVNLDGSLFYPCPSGI |
| Ga0187788_104404852 | 3300018032 | Tropical Peatland | STYCSIVYGRVSGFAAVKFDVNLDGSLFYPCPNGT |
| Ga0210403_104886261 | 3300020580 | Soil | DHYVCNPGQTGQKCTGRRSFAAFCASVYQPSYGFAAVKFDVNLDGKMFFPCPHGS |
| Ga0210399_106162312 | 3300020581 | Soil | TGQKCTGRRSFAAFCASVYQPSYGFAAVKFDVNLDGKMFFPYPHGS |
| Ga0210399_114303931 | 3300020581 | Soil | RRFATFCRLVWGPSGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0210395_109340962 | 3300020582 | Soil | CPAKRRFATFCRIVYAPPYGFSAVKFDVNLDGKMFYPCPRGT |
| Ga0210388_104005632 | 3300021181 | Soil | CNPGQTSKKCAGRRSFAAFCAAVYQPSYGFSAVKFDVDLDGKMFFPCPRGT |
| Ga0213881_101097713 | 3300021374 | Exposed Rock | YVCDPGQRCGYSHRFSTFCRIVYGSPGGFSAVKFNVNLDGSVFYPCPTGR |
| Ga0210389_102140221 | 3300021404 | Soil | CDPGQACSGRRSFAAFCRAVYSPSYGFAAVKFDVDLDGGKFYPCPTGT |
| Ga0210389_107087742 | 3300021404 | Soil | YVCNPGQRCPVPRRFATFCQRVWAPAYGFAAVKFDVDLDGRMFFPCPRGR |
| Ga0210383_106237421 | 3300021407 | Soil | NPGQPCPAKRRFATFCRIVYAPPYGFSAVKFDVNLDGKMFYPCPRGT |
| Ga0210383_116936511 | 3300021407 | Soil | NPGQHCSHKKNFSTFCHTVYAPPYGYSAVKFNVNLDGTMFYPCPKGT |
| Ga0210410_108098891 | 3300021479 | Soil | FSTFCRIVYAPPYGYSAVKFNVNLDGTMFYPCPKGT |
| Ga0126371_119578393 | 3300021560 | Tropical Forest Soil | FATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0126371_122608712 | 3300021560 | Tropical Forest Soil | PCPGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0126371_129991641 | 3300021560 | Tropical Forest Soil | FAAFCRAVYAGPLGFSAVKFDVNLDGKVFFPCPRGR |
| Ga0126371_134217343 | 3300021560 | Tropical Forest Soil | GKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPAGT |
| Ga0213851_14488331 | 3300021860 | Watersheds | GQSCPPKRRFATFCRVVYAPPYGFSAVKFDVNLDGKMFYPCPRGT |
| Ga0207707_107766341 | 3300025912 | Corn Rhizosphere | GRTFRAYCRRIYDGKNGFAAVKFDVNLDGRTFYPCPRGI |
| Ga0207693_102364281 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FATFCRLVWGAPGGFSAVKFDVNLNGKVFYPCPRGA |
| Ga0207664_109519151 | 3300025929 | Agricultural Soil | CPRKRRFATFCRVVYAPSYGFAAVKFDVNLDGKTFYPCPHGT |
| Ga0207665_1000027636 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | NPGQSCPPKRRYATFCRIVYAPPYGFAAVKFDVDLNGKMFYPCPRGT |
| Ga0209006_108517671 | 3300027908 | Forest Soil | LPPPKRRFATFCRVVYAPPDGFSAVKFDVDLNGKMFYPCPRGT |
| Ga0307281_104048321 | 3300028803 | Soil | VCSHKKSFATYCNVIYGQSYGFAGVKFDVNLDGKTFFPCPSGT |
| Ga0268241_101965781 | 3300030511 | Soil | KRTFKAFCQAVYAPANGFAAVKFDVNLDGKLFYPCPRGS |
| Ga0170818_1084314813 | 3300031474 | Forest Soil | GKPCKPGRSFAAYCRRIYGGKNGFAAVKFDVNLDGRVFYPCPRGR |
| Ga0318534_106256512 | 3300031544 | Soil | ADHYVCNPGQPCPAKRRFATFCRVVYAPSSGFSAVKFDVNLNGKIFYPCPRGT |
| Ga0318538_102010901 | 3300031546 | Soil | HYVCDPGQPCPAKRRFATFCRLVYAPSYGFTAVKFDVNLDGKIFYPCPRGT |
| Ga0318538_104581443 | 3300031546 | Soil | ATFCRLVWRPPGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0318571_101800121 | 3300031549 | Soil | GQPCPPKRRFATFCRVVYAPPGGFSAVKFDVNLDGKMFFPCPRGS |
| Ga0310915_100136661 | 3300031573 | Soil | FATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318574_108046492 | 3300031680 | Soil | CNPGQPCPPKRRFATFCRVVYASPGGFSAVKFDVDLNGKMFYPCPRGT |
| Ga0318496_100497716 | 3300031713 | Soil | ADHYVCNPGQQCQGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT |
| Ga0318496_106771311 | 3300031713 | Soil | DHYVCDPGQPCPAKRRFATFCRLVYAPSYGFTAVKFDVNLDGRIFYPCPRGT |
| Ga0318493_100833401 | 3300031723 | Soil | CQGKRRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318501_104434441 | 3300031736 | Soil | QGKRRFATFCRLVWKAPGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0306918_101599931 | 3300031744 | Soil | RSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318492_107809071 | 3300031748 | Soil | ADHYVCNPGQPCPGKRRFSTFCRVVYAPSYGFTAVKFDVNLDGRTFYPCPHGT |
| Ga0318494_104391791 | 3300031751 | Soil | GQQCQGKRRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318526_100466741 | 3300031769 | Soil | RFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318552_103311841 | 3300031782 | Soil | KRRFATFCRVVYAPSYGFAAVKFDVNLDGKTFYPCPHGT |
| Ga0318548_101121591 | 3300031793 | Soil | GADGYVCNPGQPCQGKRSFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0318503_100752343 | 3300031794 | Soil | TTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA |
| Ga0318576_104752252 | 3300031796 | Soil | PKRRFTTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA |
| Ga0318576_105392131 | 3300031796 | Soil | FATFCRVVYAPPGGFSAVKFDVNLDGKMFFPCPRGS |
| Ga0318550_102136291 | 3300031797 | Soil | HYVCNPGQPCRGRRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318565_101682493 | 3300031799 | Soil | CRGRRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318567_100527471 | 3300031821 | Soil | VCNPGQQCRGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT |
| Ga0318499_101872471 | 3300031832 | Soil | GQPCQGKRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318517_100633041 | 3300031835 | Soil | GADHYVCNPGQPCTGKRRFVTFCRLVWGPPGGFSAVKFDVNLDGTVFYPCPRGT |
| Ga0306925_112332903 | 3300031890 | Soil | GKRRFATFCRLVWGAPGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0318551_106785941 | 3300031896 | Soil | ADGYVCNPGQQCRGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT |
| Ga0310909_106813392 | 3300031947 | Soil | TCPPKRRFTTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA |
| Ga0310909_113436621 | 3300031947 | Soil | GADHYVCNPGQQCPGKRSFATFCRLVWGPPGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0306926_117418233 | 3300031954 | Soil | NPGQQCQGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT |
| Ga0310911_100934494 | 3300032035 | Soil | GKRSFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0310911_105768372 | 3300032035 | Soil | YGADGYVCNPGQQCQGKRRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318575_102794141 | 3300032055 | Soil | EDAYVCNPGQPCPGSRSFGAFCRSVYAVPHGFAAVKFDVNLDGRMFDPCP |
| Ga0318575_102815713 | 3300032055 | Soil | ATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318533_108207982 | 3300032059 | Soil | CDPGKTCPPKRRFTTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA |
| Ga0318510_103373771 | 3300032064 | Soil | CNPGQPCTGKRRFVTFCRLVWGPPGGFSAVKFDVNLDGTVFYPCPRGT |
| Ga0318513_106734131 | 3300032065 | Soil | PGKRRFSTFCRVVYAPSYGFTAVKFDVNLDGRTFYPCPHGT |
| Ga0318514_101050601 | 3300032066 | Soil | GKRRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318553_102463481 | 3300032068 | Soil | EYGADHYVCNPGQPCQGKRRFATFCRLVWKAPGGFSAVKFDVNLDGKVFYPCPRGT |
| Ga0318553_103486612 | 3300032068 | Soil | YGADHYVCNPGQPCPRKRRFTTFCRVVYAPPYGFAAVKFDVNLDGKTFYPCPHGT |
| Ga0318553_103901061 | 3300032068 | Soil | RRFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0306924_125664172 | 3300032076 | Soil | PGQPCPPKRRFATFCRVVYAPPGGFSAVKFDVNLDGKMFFPCPRGS |
| Ga0318577_102631741 | 3300032091 | Soil | RRFTTFCRVVYAPSYGFAAVKFDVNLDGRFFYPCPHGA |
| Ga0318577_102885093 | 3300032091 | Soil | SFATFCRLVWGPPGGFSAIKFDVNLDGKVFYPCPRGT |
| Ga0318577_104277321 | 3300032091 | Soil | VCNPGQQCQGKRRFATFCRLVWGPPGGFSAVKFDVNLDGKVFNPCPRGT |
| Ga0307470_107271782 | 3300032174 | Hardwood Forest Soil | SFAAFCRNVYSPAWGFAAVKFDVNLDGRMFYPCPSGI |
| Ga0306920_1030617741 | 3300032261 | Soil | NPGQPCPRKRRFTTFCRVVYAPPYGFAAVKFDVNLDGKTFYPCPHGT |
| Ga0306920_1032663612 | 3300032261 | Soil | CPAKRRFATFCRVVYAPSSGFSAVKFDVNLNGKIFYPCPRGT |
| Ga0318519_109432162 | 3300033290 | Soil | AYVCNPGQPCPGSRSFGAFCRSVYAVPHGFAAVKFDVNLDGRMFDPCP |
| ⦗Top⦘ |