NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077198

Metagenome / Metatranscriptome Family F077198

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077198
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 91 residues
Representative Sequence MRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEY
Number of Associated Samples 97
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 6.03 %
% of genes near scaffold ends (potentially truncated) 27.35 %
% of genes from short scaffolds (< 2000 bps) 77.78 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (64.103 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(18.803 % of family members)
Environment Ontology (ENVO) Unclassified
(70.940 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(75.214 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.61%    β-sheet: 34.45%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00149Metallophos 4.27
PF00303Thymidylat_synt 3.42
PF01555N6_N4_Mtase 2.56
PF07661MORN_2 2.56
PF00403HMA 2.56
PF13328HD_4 1.71
PF07603DUF1566 0.85
PF00478IMPDH 0.85
PF14550Peptidase_S78_2 0.85
PF04851ResIII 0.85
PF01743PolyA_pol 0.85
PF04545Sigma70_r4 0.85
PF12799LRR_4 0.85
PF030614HBT 0.85
PF06067DUF932 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0207Thymidylate synthaseNucleotide transport and metabolism [F] 3.42
COG0863DNA modification methylaseReplication, recombination and repair [L] 2.56
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 2.56
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 2.56
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 2.56
COG2608Copper chaperone CopZInorganic ion transport and metabolism [P] 2.56
COG2849Antitoxin component YwqK of the YwqJK toxin-antitoxin moduleDefense mechanisms [V] 2.56
COG0617tRNA nucleotidyltransferase/poly(A) polymeraseTranslation, ribosomal structure and biogenesis [J] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.31 %
UnclassifiedrootN/A7.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10245277All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon567Open in IMG/M
3300000115|DelMOSum2011_c10193997All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon570Open in IMG/M
3300000116|DelMOSpr2010_c10006927Not Available6145Open in IMG/M
3300000116|DelMOSpr2010_c10038431All Organisms → Viruses → Predicted Viral2178Open in IMG/M
3300001460|JGI24003J15210_10037492All Organisms → Viruses → Predicted Viral1713Open in IMG/M
3300001947|GOS2218_1011513All Organisms → Viruses → Predicted Viral1444Open in IMG/M
3300001963|GOS2229_1020280All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1528Open in IMG/M
3300003462|SC02A_1489647All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon529Open in IMG/M
3300004097|Ga0055584_100238649All Organisms → Viruses → Predicted Viral1854Open in IMG/M
3300004273|Ga0066608_1069824All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon933Open in IMG/M
3300004277|Ga0066611_10304372All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon529Open in IMG/M
3300004280|Ga0066606_10027634All Organisms → Viruses → Predicted Viral2406Open in IMG/M
3300006734|Ga0098073_1006899All Organisms → Viruses → Predicted Viral2160Open in IMG/M
3300006735|Ga0098038_1147771All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon785Open in IMG/M
3300006789|Ga0098054_1117612All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon990Open in IMG/M
3300006790|Ga0098074_1020660All Organisms → Viruses → Predicted Viral1995Open in IMG/M
3300006790|Ga0098074_1111135All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon720Open in IMG/M
3300006802|Ga0070749_10025300All Organisms → Viruses → Predicted Viral3734Open in IMG/M
3300006802|Ga0070749_10424953All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon731Open in IMG/M
3300006916|Ga0070750_10101192All Organisms → Viruses → Predicted Viral1335Open in IMG/M
3300006919|Ga0070746_10404717All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon611Open in IMG/M
3300006922|Ga0098045_1086516All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon746Open in IMG/M
3300006990|Ga0098046_1053308All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon942Open in IMG/M
3300007344|Ga0070745_1239025All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon660Open in IMG/M
3300007510|Ga0105013_1257023All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon967Open in IMG/M
3300007538|Ga0099851_1150396All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon867Open in IMG/M
3300007539|Ga0099849_1002977Not Available7816Open in IMG/M
3300007540|Ga0099847_1048919All Organisms → Viruses → Predicted Viral1334Open in IMG/M
3300007540|Ga0099847_1128295All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon762Open in IMG/M
3300007960|Ga0099850_1195771All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon797Open in IMG/M
3300009420|Ga0114994_10864084All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon587Open in IMG/M
3300009428|Ga0114915_1061860All Organisms → Viruses → Predicted Viral1179Open in IMG/M
3300009488|Ga0114925_11186336All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon560Open in IMG/M
3300009550|Ga0115013_11314080All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon533Open in IMG/M
3300009599|Ga0115103_1138948All Organisms → Viruses → Predicted Viral3522Open in IMG/M
3300010149|Ga0098049_1146534All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon730Open in IMG/M
3300010300|Ga0129351_1092098All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1220Open in IMG/M
3300010368|Ga0129324_10083152All Organisms → Viruses → Predicted Viral1403Open in IMG/M
3300017721|Ga0181373_1048794All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon771Open in IMG/M
3300017728|Ga0181419_1151491All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon555Open in IMG/M
3300017730|Ga0181417_1026430All Organisms → Viruses → Predicted Viral1442Open in IMG/M
3300017752|Ga0181400_1054698All Organisms → Viruses → Predicted Viral1230Open in IMG/M
3300017781|Ga0181423_1358530All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon530Open in IMG/M
3300017782|Ga0181380_1192803All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon685Open in IMG/M
3300017949|Ga0181584_10395350All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon867Open in IMG/M
3300017952|Ga0181583_10388818All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon870Open in IMG/M
3300017956|Ga0181580_10872735All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon563Open in IMG/M
3300017967|Ga0181590_10188625All Organisms → Viruses → Predicted Viral1556Open in IMG/M
3300017969|Ga0181585_11049954All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon518Open in IMG/M
3300017986|Ga0181569_11101362All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon508Open in IMG/M
3300018049|Ga0181572_10426755All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon825Open in IMG/M
3300018418|Ga0181567_10140127All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1672Open in IMG/M
3300018426|Ga0181566_10417133All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon953Open in IMG/M
3300018428|Ga0181568_10758160All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon754Open in IMG/M
3300020055|Ga0181575_10093113All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1867Open in IMG/M
3300020392|Ga0211666_10098703All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1179Open in IMG/M
3300020396|Ga0211687_10009216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium5783Open in IMG/M
3300020469|Ga0211577_10728362All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon579Open in IMG/M
3300021379|Ga0213864_10371525All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon723Open in IMG/M
3300021961|Ga0222714_10284133All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon914Open in IMG/M
3300022053|Ga0212030_1008107All Organisms → Viruses → Predicted Viral1255Open in IMG/M
3300022308|Ga0224504_10072482All Organisms → Viruses → Predicted Viral1381Open in IMG/M
(restricted) 3300023085|Ga0233406_10017142All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon859Open in IMG/M
(restricted) 3300023112|Ga0233411_10000138Not Available24610Open in IMG/M
(restricted) 3300023112|Ga0233411_10112512All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon875Open in IMG/M
(restricted) 3300023210|Ga0233412_10001748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales10997Open in IMG/M
(restricted) 3300023210|Ga0233412_10003421Not Available7367Open in IMG/M
(restricted) 3300023210|Ga0233412_10007612All Organisms → Viruses → Predicted Viral4507Open in IMG/M
(restricted) 3300023210|Ga0233412_10044416All Organisms → Viruses → Predicted Viral1799Open in IMG/M
(restricted) 3300023210|Ga0233412_10068784All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1458Open in IMG/M
(restricted) 3300024059|Ga0255040_10120036All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1038Open in IMG/M
(restricted) 3300024059|Ga0255040_10239130All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon750Open in IMG/M
(restricted) 3300024062|Ga0255039_10110028All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1105Open in IMG/M
3300024191|Ga0228636_1005168All Organisms → Viruses → Predicted Viral3208Open in IMG/M
3300024223|Ga0228601_1002306All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon2045Open in IMG/M
3300024231|Ga0233399_1091096All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon716Open in IMG/M
3300024293|Ga0228651_1013843All Organisms → Viruses → Predicted Viral2068Open in IMG/M
3300024319|Ga0228670_1029572All Organisms → Viruses → Predicted Viral1352Open in IMG/M
3300024321|Ga0228626_1118972All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon557Open in IMG/M
(restricted) 3300024517|Ga0255049_10186254All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon948Open in IMG/M
(restricted) 3300024529|Ga0255044_10009747All Organisms → Viruses → Predicted Viral2527Open in IMG/M
3300025057|Ga0208018_124755All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon673Open in IMG/M
3300025083|Ga0208791_1077109All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon543Open in IMG/M
3300025093|Ga0208794_1007841All Organisms → Viruses → Predicted Viral2843Open in IMG/M
3300025093|Ga0208794_1038836All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon902Open in IMG/M
3300025093|Ga0208794_1065766All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon641Open in IMG/M
3300025108|Ga0208793_1105482All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon785Open in IMG/M
3300025120|Ga0209535_1000005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales171834Open in IMG/M
3300025137|Ga0209336_10136955All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon658Open in IMG/M
3300025276|Ga0208814_1000795Not Available16887Open in IMG/M
3300025674|Ga0208162_1002395Not Available9222Open in IMG/M
3300025676|Ga0209657_1040802Not Available1734Open in IMG/M
3300025681|Ga0209263_1071119All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1103Open in IMG/M
3300025727|Ga0209047_1076148All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1200Open in IMG/M
3300026505|Ga0228647_1020849All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1735Open in IMG/M
3300027413|Ga0208950_1017488All Organisms → Viruses → Predicted Viral2161Open in IMG/M
3300027813|Ga0209090_10265950All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon862Open in IMG/M
3300027859|Ga0209503_10385611All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon689Open in IMG/M
(restricted) 3300027861|Ga0233415_10027137All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon2306Open in IMG/M
(restricted) 3300027881|Ga0255055_10582665All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon599Open in IMG/M
(restricted) 3300027996|Ga0233413_10001708Not Available9471Open in IMG/M
(restricted) 3300027996|Ga0233413_10064213All Organisms → Viruses → Predicted Viral1435Open in IMG/M
(restricted) 3300027996|Ga0233413_10189770All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon861Open in IMG/M
(restricted) 3300028045|Ga0233414_10030645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2155Open in IMG/M
(restricted) 3300028045|Ga0233414_10433160All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon614Open in IMG/M
(restricted) 3300028045|Ga0233414_10545548All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon547Open in IMG/M
3300028416|Ga0228614_1031666All Organisms → Viruses → Predicted Viral1247Open in IMG/M
3300029293|Ga0135211_1040300All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon586Open in IMG/M
3300029345|Ga0135210_1007641All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon918Open in IMG/M
3300029753|Ga0135224_1023142All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon630Open in IMG/M
3300031519|Ga0307488_10006101All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9936Open in IMG/M
3300031519|Ga0307488_10125375All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1833Open in IMG/M
3300031519|Ga0307488_10153480All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1610Open in IMG/M
3300031519|Ga0307488_10612483All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon630Open in IMG/M
3300031519|Ga0307488_10728530All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon557Open in IMG/M
3300034418|Ga0348337_143378All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon689Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.80%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater14.53%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.97%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh9.40%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.69%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.69%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.84%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine4.27%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.27%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.42%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor2.56%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.71%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.71%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.85%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.85%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.85%
Marine SedimentEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment0.85%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001947Marine microbial communities from the Gulf of Maine, Canada - GS002EnvironmentalOpen in IMG/M
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300003462Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S13-SC02AEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004273Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_135mEnvironmentalOpen in IMG/M
3300004277Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200mEnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007510Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300023085 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024223Seawater microbial communities from Monterey Bay, California, United States - 1DEnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024293Seawater microbial communities from Monterey Bay, California, United States - 63DEnvironmentalOpen in IMG/M
3300024319Seawater microbial communities from Monterey Bay, California, United States - 85DEnvironmentalOpen in IMG/M
3300024321Seawater microbial communities from Monterey Bay, California, United States - 31DEnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025093Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025676Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025681Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025727Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026505Seawater microbial communities from Monterey Bay, California, United States - 59DEnvironmentalOpen in IMG/M
3300027413Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028416Seawater microbial communities from Monterey Bay, California, United States - 15DEnvironmentalOpen in IMG/M
3300029293Marine harbor viral communities from the Indian Ocean - SCH2EnvironmentalOpen in IMG/M
3300029345Marine harbor viral communities from the Indian Ocean - SCH1EnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1024527733300000101MarineMMSKRKYRIKEEKYEHTSHFYPQYKDENVAYYILGQDENGKDIKSEYQYFGKFEDCGLVGYQWKRDMFYELPMARHRIETDIGESKQKLIETIIHEYPKQR*
DelMOSum2011_1019399733300000115MarineMSKRKYRIKEEKYEHTSHFYPQYKDENVAYYILGQDENGKDIKSEYQYFGKFEDCGLVGYQWKRDMFYELPMARHRIETDIGESKQKLIETIIHEYPKQR*
DelMOSpr2010_1000692713300000116MarineTKTKMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYFGSWIQGYVWKRDMFYDLPMARHRIEMDIQQRTTEELKETIIHEY*
DelMOSpr2010_1003843143300000116MarineMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYFGSWIQGYVWKRDMFYDLPMARHRIEMDIQQRTTEELKETIIHEY*
JGI24003J15210_1003749273300001460MarineMRKYRIIEEKYEHVSYFYPQYKDESVVYYTLGQHENGNTIKSEYQYFQSWNEKGALKRDVYISLSEARKMYRNGY*
GOS2218_101151333300001947MarineMRKYRIIEEKYEHVSYFYPQYKIESDENGNTIKSEYQYFMSWNEKGALKRDVYISLSEARKRIEWDIKQRTPEELKETIIHEY*
GOS2229_102028053300001963MarineMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYRYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEY*
SC02A_148964723300003462Marine SedimentMSKRKYRIIEEKYEHVSHFYPQYKDENCAYYVLGQDKNGKDITSDYQYFGKFEDCGLVGNRQWKRDVYYSLPMARHYIENDIQVQEHTTEELKETIVHEY*
Ga0055584_10023864933300004097Pelagic MarineMRKYRIIEEKYEHVSHFYPQYRDENVAHYVLGQDENGKDIKSDYQYFGKFEECNLVGNKQWKKDVFYDMSNARHRIEMDIQQRKGDELKETIIHEY*
Ga0066608_106982413300004273MarineVANTNNKKMKNMRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKLEDCGLVGNRQWKRDVFYDMSNARLRIEMDIQEHTTEELKETIVHEY*
Ga0066611_1030437223300004277MarineEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKLEDCGLVGNRQWKRDVFYDMSNARLRIEMDIQEHTTEELKETIVHEY*
Ga0066606_1002763443300004280MarineVANTNNKKMKNMRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKFEACGLVGNRQWKRDMYYSLPMARHRIEMDIQEHTTEELKETIVHEY*
Ga0098073_100689953300006734MarineMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYFGSWIQGYVWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEY*
Ga0098038_114777113300006735MarineMSKRKYRIIEEKYEHVSHFYPQYKDEDVVYYVLGQDENGNDIKSEYQYFGSWDENSKWKRDIFYGLPQSRKRIEIDIKQRRIEELKQTIIHEY*
Ga0098054_111761233300006789MarineMSKRKYRIIEEKYEHFSHFYPQYKDEDKVYYVLGQDENGNDIKSEYQYFGSWNKNSKWKRDMFYGLSQSRKRIEIDIKHRRIEELKETIIHEY*
Ga0098074_102066033300006790MarineMRKYRIIEKKYEHVSHFYPQYRDEDIAYYVLGQDENGKDIKSDYQYFGSWKEYSPGASHWEKDLFYDLSNARHRIEMDIQQRKGRELKETIIHEY*
Ga0098074_111113523300006790MarineMREYRIIEEKYEHISHFYPQYKDENGNDIKSEYQYFGSWNKNSKFKRDMFYDLSNARHRIEIDIQQSKVEELKETIIHEYKETIIHEY*
Ga0070749_1002530043300006802AqueousMIKPKQRMRKYRIIEEKYEHISHFYPQYRDENVAYYVLGKDENGKVTKSDYQYFGKFKYCEIVGNRQWKKDVFYDISNARSFIELDIRHRKVEESKETIIHEY*
Ga0070749_1042495323300006802AqueousMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQCKGKELKETIIHEY*
Ga0070750_1010119243300006916AqueousMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEYQNQNKDE*
Ga0070746_1040471713300006919AqueousMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRHMFYGLPQSRKRIEMDIKQRRIEELKETIIHEYWT*
Ga0098045_108651623300006922MarineMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRDMFHGLPQSRKRIEIDINQRRIEELKETIIHEYWT*
Ga0098046_105330823300006990MarineMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRDMFHGLPQSRKRIEIDIRQRRIEELKETIIHEYWT*
Ga0070745_123902523300007344AqueousMPRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEYQNQNKDE*
Ga0105013_125702343300007510MarineMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWKEHGIGASHWEKDVFYDLSNARHRIEMDIQKRKGKELKETIIHEY*
Ga0099851_115039613300007538AqueousMSRRKYRIIEEKYEHISHFYPQYKDENGKDIKSDYQYLGSWNKNSKWKRDVFYGLPMARHRIEMDIQQRTTEELKETIIHEYQNQNKDE*
Ga0099849_1002977223300007539AqueousMSRRKYRIIEEKYEHISHFYPQYKDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEYQNQNKDE*
Ga0099847_104891913300007540AqueousMSKRKYRIIEEKYGHVSHFYPQYKDENVDYYVLGQDENGKDIKSEYQYFGKFEDCGLVGNRQWKRDMYYSLPMEDIE*
Ga0099847_112829513300007540AqueousMSKRKYRIKEEKYEHTSHFYPQYKDENVAYYILGQDENGKDIKSEYQYFGKFEDCGLVG
Ga0099850_119577133300007960AqueousMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRI
Ga0114994_1086408423300009420MarineMSKRKYRIIEENYGHVSHFYPQYKDETCVYYVLGRDENGKDIKSEYQYFGKFEDCGLVSGRWKRDRFYELSQARKRIEMDIQHTTEETIVHEY*
Ga0114915_106186023300009428Deep OceanMRKYRIIEEKYEHVSHFYPQYKDEDVAYYVLSHDGNGKDIKSEYQYFSSWNEKGILKRDVYISISEARKRIEMDIKQRTSEEFKETIIHEY*
Ga0114925_1118633633300009488Deep SubsurfaceMRKYRIIEEKYEHISHFYPQYRDENVAYYVLGQDENGKDIKSDYQYFGSWNLNHKWKRHVFYDISNARRLIELDIRNRKVE
Ga0115013_1131408013300009550MarineMRKYRIIEEKYEHVSYFYPQYKDEGVVYYTLGQDENGNAIKSEYQYFRSWNEKGALKRDVYISLSEARKSIEIDIKQRTPEELKETIIHEY*
Ga0115103_1138948143300009599MarineMGKRKYRIIEEKYEHVGCFYPQYKDENVAYYVLGQDENGKDIKSEYQYFGKFEDCGLGGYQWKRDMFYELPTARHRIETDIKESKQELIETIIHEYSN*
Ga0098049_114653413300010149MarineMRKYRIIEEKYENISHFYPQYRDENVAYYVLGQDENGKDIKSDYQYFGNFKYCEIAGNRQFRKYVFYGMSNARGFIELDNRNRKVEESKETIIHEY*
Ga0129351_109209853300010300Freshwater To Marine Saline GradientMSRRKYRIIEEKYEHISHFYPQYKDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHE
Ga0129324_1008315223300010368Freshwater To Marine Saline GradientMSKRKYRIIEEKYEHVSHFYPQYKDENCAYYVLGQDENGDDIKSEYQYFGKFEDCGLVGNRQWKRDMYYSLPMARHRIEMDIQEHTTEELKETIIHEY*
Ga0181373_104879413300017721MarineTKTKMGKRKYRIIEEKYEHFSHFYPQYKDEDKVHYILGQDENGNDIKSEYQYFGSWDENSKWKRDLFYGLPQSRKRIEIDIRQRRIEELKETIIHEY
Ga0181419_115149123300017728SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRHMFYGLPQSRKCIEMDIRQRRIEELKETIIHEYWT
Ga0181417_102643023300017730SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRDMFHGLPQSRKRIEMDIKQRRIEELKETIIHEYWT
Ga0181400_105469843300017752SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRHMFHGLPQSRKCIEMDIKQRRIEELKETIIHEYWT
Ga0181423_135853023300017781SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRDMFHGLPQSRKRIEIDIKQRRIEELKETIIHEYWT
Ga0181380_119280313300017782SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRHMFHGLPQSRKCI
Ga0181584_1039535013300017949Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENVAYYVLGKDENGKVIKSDYQYFGRWEDSELGIVRWKKDVFYNISKARHRIEMDIQQQTVEELKETIIHEY
Ga0181583_1038881813300017952Salt MarshMREYRIIEEKYEHVSHFYPQYRDENVAYYVLGKDENGKVIKSDYQYFGRWEDSELGIVRWKKDVFYNMSKARHRIEMDIQQQTVEELKETIIHEY
Ga0181580_1087273523300017956Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENVAYYVLGKDENGKDIKSDYQYFGRWEDSKLGIVRWKKDVFYNMSKARHRIEMDIQQQTVEELKETIIHEY
Ga0181590_1018862543300017967Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENVAYYVLGKDENGKVIKSDYQYFGRWEDSKLGNVRWKKDVFYNMSKARHRIEMDIQQQTVEELKETIIHEY
Ga0181585_1104995423300017969Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENGKDIKSDYQYFGSWIQGYVWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEY
Ga0181569_1110136223300017986Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEY
Ga0181572_1042675533300018049Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEYQ
Ga0181567_1014012763300018418Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEYQNQNKDE
Ga0181566_1041713343300018426Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRT
Ga0181568_1075816023300018428Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYFGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEYQNQNKDE
Ga0181575_1009311313300020055Salt MarshMRKYRIIEEKYEHVSHFYPQYRDENVAYYVLGKDENGKVIKSDYQYFGRWEDSELGIVRWKKDVFYNMSKARHRIE
Ga0211666_1009870353300020392MarineKRKYRIIEEKYEHVSHFYPQYKDEDVGHYILGQDENGNDIKSEYQYFGSWDENSKWKRDMFYGLPQSRKRIEIDIKQRRIEELKQTIIHEY
Ga0211687_10009216163300020396MarineMRKYRIIEEKYEHVSHFYPQYKDEDVAYYVLGRDGNGKDIKSEYQYFSGWNKKGALKRDVYISLSEARKSIEIDIKQRTPEELKETIIHEY
Ga0211577_1072836213300020469MarineMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRHMFYGLPQSRKRIEMDIKQRRIEELKETIIHEYWT
Ga0213864_1037152523300021379SeawaterMREYRIIEEKYEHVSHFYPQYRDENGKDIKSDYQYFGSWIQGYVWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEYQNQNKDE
Ga0222714_1028413333300021961Estuarine WaterMRKYRIIEEKYEHVSHFYPQYKDENCAYYILGKDENGNDIKSEYQYFGSWNKNSKWKRDMFYDLSNARHRIEIDIHHSKVEELKETIIHEY
Ga0212030_100810713300022053AqueousMSKRKYRIIEEKYGHVSHFYPQYKDENVDYYVLGQDENGKDIKSEYQYFGKFEDCGLVGNRQWKRDMYYSLPMARHRIEM
Ga0224504_1007248253300022308SedimentMIKPKQRMRKYRIIEEKYEHISHFYPQYRDENVAYYVLGKDENGKVTKSDYQYFGKFKYCEIVGNRQWKKDVFYDISNARSFIELDIRHRKVEVSKETIIHEY
(restricted) Ga0233406_1001714213300023085SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDENVAYYVLGENGKDIKSEYQYFGKLEDCGLVGNRQWKKDVFYDMSNA
(restricted) Ga0233411_1000013843300023112SeawaterVANTNNKKMKNMRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKLEDCGLVGNRQWKRDVFYDMSNARLRIEMDIQEHTTEELKETIVHEY
(restricted) Ga0233411_1011251213300023112SeawaterMSKRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKLEDCGLVGNRQWKKDVFYDMSN
(restricted) Ga0233412_10001748303300023210SeawaterMSKRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKLEDCGLVGNRQWKRDMFYSLPMARHRIEMDIQEHTTEELKETIVHEY
(restricted) Ga0233412_1000342123300023210SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDENCAYYVLGQDKNGKDITSDYQYFGSWKLTEISGVSFWQKDFFYDLSNARHYIENDIQVQEHTTEELKETIVHEY
(restricted) Ga0233412_10007612143300023210SeawaterMRKYRIIEEKYEHTSHFYPQYRDENVVRYVLGQDKNGKDITSDYQYFGSWKLTEISGVSFWQKDFFYDLSNARHYIENDIQVQERKGDGLKETIIHEY
(restricted) Ga0233412_1004441653300023210SeawaterMSKRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKFEDCGLVGNKQWKKDVFYDMSNARLRIEMDIQEHTTEELKETIVHEY
(restricted) Ga0233412_1006878443300023210SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDENVAYYVLGENGKDIKSEYQYFGKFEACGLVGNRQWKRDMYYSLPMARHRIEIDIQEHTTEELKETIVHEY
(restricted) Ga0255040_1012003623300024059SeawaterMGVILKNKTKMSKRKYRIIEEKYEHVSHFYPQYKDENVAYYVLGENGKDIKSEYQYFGKFEACGLVGNRQWKRDMYYSLPMARHRIEMDIQEHTT
(restricted) Ga0255040_1023913023300024059SeawaterMSKRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKLEDCGLVGNRQWKKDVFYDMSNARLRIEMDIQEHTTEELKETIVHEY
(restricted) Ga0255039_1011002813300024062SeawaterMGVILKNKTKMSKRKYRIIEEKYEHVSHFYPQYKDENVAYYVLGENGKDIKSEYQYFGKFEACGLVGNRQWKRDMYYSLPMARHRIEMDIQEHTTEELKETIVHEY
Ga0228636_100516863300024191SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRHMFHGLPQSRKCIEMDIRQRRIEELKETIIHEYWT
Ga0228601_100230613300024223SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRHMFHGLPQSRKCIEMDIRQRRIE
Ga0233399_109109613300024231SeawaterRIIEEKYEHISHFYPQYRDENVAYYVLGKDENGKVTKSDYQYFGKFKYCEIVGNRQWKKDVFYDISNARSFIELDIRHRKVEESKETIIHEY
Ga0228651_101384353300024293SeawaterMIKPKQRMRKYRIIEEKYEHISHFYPQYRDENVAYYVLGKDENGKVTKSDYQYFGKFKYCEIVGNRQWKKDVFYDISNARSFIELDIRHRKVEESKETIIHEY
Ga0228670_102957213300024319SeawaterMIKPKQRMRKYRIIEEKYEHISHFYPQYRDENVAYYVLGKDENGKVTKSDYQYFGKFKYCEIVGNRQWKKDVFYDISNARSFIELDI
Ga0228626_111897223300024321SeawaterMIKPKQRMRKYRIIEEKYEHISHFYPQYRDENVAYYVLGKDENGKVTKSDYQYFGKFKYCEIVGNRQWKKDVFYDISNARSFIELDIRHRKVEESKET
(restricted) Ga0255049_1018625433300024517SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDENVAYYVLGRDENGKDIKSEYQYFGSWNKKGSWKRDRFYELSQARKRIEIDIQQQTTESKETIVHEY
(restricted) Ga0255044_1000974723300024529SeawaterMSKRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKLEDCGLVGNRQWKRDMFYSLPMARHRIEMDIQEHTTEELKETIIHEY
Ga0208018_12475523300025057MarineMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYFGSWIQGYVWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEY
Ga0208791_107710913300025083MarineMSKRKYRIIEEKYEHVSHFYPQYKDEDVVHYILGQDENGNDIKSEYQYFGSWDENSKWKRDMFHGLPQSRKRIEIDINQRRIEELKETIIHEYWT
Ga0208794_100784153300025093MarineMRKYRIIEKKYEHVSHFYPQYRDEDIAYYVLGQDENGKDIKSDYQYFGSWKEYSPGASHWEKDLFYDLSNARHRIEMDIQQRKGRELKETIIHEY
Ga0208794_103883613300025093MarineHFYPQYRDENVSHYVLGSDENGKDIKSDYQYFGSWIQGYVWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEY
Ga0208794_106576623300025093MarineMREYRIIEEKYEHISHFYPQYKDENGNDIKSEYQYFGSWNKNSKFKRDMFYDLSNARHRIEIDIQQSKVEELKETIIHEYKETIIHEY
Ga0208793_110548223300025108MarineMSKRKYRIIEEKYEHFSHFYPQYKDEDKVYYVLGQDENGNDIKSEYQYFGSWNKNSKWKRDMFYRLSQSRKRIEIDIKHRRIEELKETIIHEY
Ga0209535_10000052113300025120MarineMRKYRIIEEKYEHVSYFYPQYKDESVVYYTLGQHENGNTIKSEYQYFQSWNEKGALKRDVYISLSEARKCIEMDIKQRTPEELKETIIHEY
Ga0209336_1013695513300025137MarineMRKYRIIEEKYEHVSYFYPQYKDESVVYYTLGQHENGNTIKSEYQYFQSWNEKGALKRDVYISLSEARKSIEMDIK
Ga0208814_100079593300025276Deep OceanMRKYRIIEEKYEHVSHFYPQYKDEDVAYYVLGRDGNGKDIKSEYQYFSSWNEKGILKRDVYISISEARKRIEMDIKQRTSEELKETIIHEY
Ga0208162_100239573300025674AqueousMSRRKYRIIEEKYEHISHFYPQYKDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEMDIQQRTTEELKETIIHEYQNQNKDE
Ga0209657_104080233300025676MarineMRKYRIIEEKYEHTSHFYPQYRDENVVRYVLGQDKNGKDITSDYQYFGSWKLTEISGVSFWQKDFFYDLSNARHYIENDIQVQEHTTEELKETIVHEY
Ga0209263_107111943300025681MarineVANTNNKKMKNMRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKLEDCGLVGNRQWKRDMYYSLPMARHRIEIDIQEHTTEELKETIVHEY
Ga0208019_113687913300025687AqueousMSRRKYRIIEEKYEHISHFYPQYKDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIE
Ga0209047_107614833300025727MarineMKNMRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKFEDCGLVGNKQWKKDVFYDMSNARLRIEMDIQEHTTEELKETIVHEY
Ga0228647_102084913300026505SeawaterMIKPKQRMRKYRIIEEKYEHISHFYPQYRDENVAYYVLGKDENGKVTKSDYQYFGKFKYCEIVGNRQWKKDVFYDISNARSF
Ga0208950_101748843300027413MarineMGKRKYRIIEEKYEHVGCFYPQYKDENVAYYVLGQDENGKDIKSEYQYFGKFEDCGLGGYQWKRDMFYELPTARHRIETDIKESKQELIETIIHEYSN
Ga0209090_1026595033300027813MarineMSKRKYRIIEENYGHVSHFYPQYKDETCVYYVLGRDENGKDIKSEYQYFGKFEDCGLVSGRWKRDRFYELSQARKRIEMDIQHTTEELKETIIHEY
Ga0209503_1038561123300027859MarineMRKYRIIEEKYEHVSYFYPQYKDEGVVYYTLGQDENGNAIKSEYQYFRSWNEKGALKRDVYISLSEARKSIEIDIKQRTPEELKETIIHEY
(restricted) Ga0233415_1002713763300027861SeawaterMRKYRIIEEKYEHVSHFYPQYRDENVAYYVLGQDENGKDIKSDYQYFGKFEDCSLVGNKQWKKDVFYGMSNARLRIEMDIQQFVTELKKETIIHEY
(restricted) Ga0255055_1058266523300027881SeawaterVANTNNKKMKNMRKYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKFEDCGLVGNKQWKKDVFYDMSNARLRIEMDIQEHTTEELKETIVHEY
(restricted) Ga0233413_10001708153300027996SeawaterYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKFEDCGLVGNKQWKKDVFYDMSNARLRIEMDIQEHTTEELKETIVHEY
(restricted) Ga0233413_1006421313300027996SeawaterYRIIEENYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKLEDCGLVGNRQWKRDVFYDMSNARLRIEMDIQEHTTEELKETIVHEY
(restricted) Ga0233413_1018977043300027996SeawaterMSKRKYRIIEENYEHVSHFYPQYKDENVAYYVLGENGKDIKSEYQYFGKFEACGLVGNRQWKRDMYYSLPMARHRIEMDIQEHTTEELKETIVHEY
(restricted) Ga0233414_1003064513300028045SeawaterMRKYRIIEEKYEHTSHFYPQYRDENVVRYVLGQDKNGKDITSDYQYFGSWKLTEISGVSFWQKDFFYDLS
(restricted) Ga0233414_1043316013300028045SeawaterMRKYRIIEEKYEHVSHFYPQYRDENVAYYVLGQDENGKDIKSDYQYFGKFEDCSLVGNKQWKKDVFYG
(restricted) Ga0233414_1054554833300028045SeawaterMSKRKYRIIEEKYEHVSHFYPQYKDENCAYYVLGQDKNGKDITSDYQYFGSWKLTEISGVSFWQKDFFYDLS
Ga0228614_103166613300028416SeawaterKPKQRMRKYRIIEEKYEHISHFYPQYRDENVAYYVLGKDENGKVTKSDYQYFGKFKYCEIVGNRQWKKDVFYDISNARSFIELDIRHRKVEESKETIIHEY
Ga0135211_104030013300029293Marine HarborMRKYRIIEEKYENISHFYPQYRDENVAYYVLGQDENGKDIKSDYQYFGSWNLNHKWKRYVFYDMSNARKFIELDIRNQKDRDWET
Ga0135210_100764113300029345Marine HarborMRKYRIIEEKYENISHFYPQYRDENVTYYVLGQDENGKDIKSDYQYFGSWNLNHKWKRYVFYDMSNARKFIEMDIRNRKVEESKETIIHEY
Ga0135224_102314233300029753Marine HarborMRKYRIIEEKYEHVSHFYPQYRDENVAYYVLGQDENGKDIKSDYQYFGRWEDSGLIGNKQWKKDVFYNMSKARHRIEMDTQQQTVEELKETIIHEY
Ga0307488_1000610113300031519Sackhole BrineKMSKIKYRIIEEKHEHVSHFYAQYLTPRNYILWEDIFGKNIESEYQYFGSFNKKGSWKRDRFYELSQARKRIEMDIQHTTEETIVHEY
Ga0307488_1012537553300031519Sackhole BrineMRKYRIIEEKYEHVSHFYPQYKDENVAYYVLGRDENGKDIKSEYQYFGKFEDCGLVGNRQWKRDMYYSLPMARHRIEMDIQEHTTEELKETIVHEY
Ga0307488_1015348073300031519Sackhole BrineMSKRKYRIIEEKYEHVSHFYPQYKDENCAYYVLGQDENGKDIKSEYQYFGKFEDCRFGEEQWKRDMSYSLPMARHRIEMDIQEHTTEELKETIIHEY
Ga0307488_1061248323300031519Sackhole BrineMMSKRKYRIKEEKYEHTSHFYPQYKDENVAHYILGQDENGKAITSDYQYFGSWKSEGSGFGGVWMKDVKYDLSNARHRIEMDIQQRKGDELKETIIHEY
Ga0307488_1072853013300031519Sackhole BrineMSKRKYRIIEEKYEHVSHFYPQYKDENCDYYVLGQDENGKDIKSEYQYFGKLENYFSEWERDMYYSLPMARHRIEMDIQEHTT
Ga0348337_143378_469_6873300034418AqueousMRKYRIIEEKYEHVSHFYPQYRDENVSHYVLGSDENGKDIKSDYQYLGSWNKNSRWKRDVFYDLPMARHRIEM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.