NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077163

Metagenome / Metatranscriptome Family F077163

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077163
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 80 residues
Representative Sequence MTQEEVYTKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLNKKLV
Number of Associated Samples 99
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 89.57 %
% of genes near scaffold ends (potentially truncated) 95.73 %
% of genes from short scaffolds (< 2000 bps) 87.18 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.017 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(29.060 % of family members)
Environment Ontology (ENVO) Unclassified
(75.214 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.017 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.48%    β-sheet: 15.53%    Coil/Unstructured: 66.99%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF04308RNaseH_like 47.01
PF00462Glutaredoxin 4.27
PF01464SLT 2.56
PF00149Metallophos 0.85



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.29 %
UnclassifiedrootN/A1.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10140013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64731Open in IMG/M
3300000115|DelMOSum2011_c10174216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64618Open in IMG/M
3300002488|JGI25128J35275_1057642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64830Open in IMG/M
3300002488|JGI25128J35275_1104411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64570Open in IMG/M
3300005430|Ga0066849_10405375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64513Open in IMG/M
3300005604|Ga0066852_10283691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64558Open in IMG/M
3300006752|Ga0098048_1131333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64750Open in IMG/M
3300006754|Ga0098044_1312049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64600Open in IMG/M
3300006789|Ga0098054_1014027All Organisms → cellular organisms → Bacteria3262Open in IMG/M
3300006793|Ga0098055_1408992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64502Open in IMG/M
3300006924|Ga0098051_1153297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64609Open in IMG/M
3300006927|Ga0098034_1000452All Organisms → cellular organisms → Bacteria17630Open in IMG/M
3300008050|Ga0098052_1056051All Organisms → Viruses → Predicted Viral1683Open in IMG/M
3300008219|Ga0114905_1160517All Organisms → cellular organisms → Bacteria → Proteobacteria744Open in IMG/M
3300009110|Ga0117925_1048420All Organisms → Viruses → Predicted Viral1787Open in IMG/M
3300009130|Ga0118729_1242802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64622Open in IMG/M
3300009426|Ga0115547_1164579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64706Open in IMG/M
3300009433|Ga0115545_1212358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64657Open in IMG/M
3300009435|Ga0115546_1088552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641135Open in IMG/M
3300009435|Ga0115546_1276012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64574Open in IMG/M
3300009435|Ga0115546_1318077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64530Open in IMG/M
3300009472|Ga0115554_1386224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64548Open in IMG/M
3300009481|Ga0114932_10196521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641228Open in IMG/M
3300009496|Ga0115570_10326592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64661Open in IMG/M
3300009593|Ga0115011_10036253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED643333Open in IMG/M
3300009593|Ga0115011_11626502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64576Open in IMG/M
3300009706|Ga0115002_11160472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64524Open in IMG/M
3300009790|Ga0115012_12111221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64502Open in IMG/M
3300010296|Ga0129348_1262940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64579Open in IMG/M
3300012928|Ga0163110_11372834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64571Open in IMG/M
3300012936|Ga0163109_10310056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641156Open in IMG/M
3300012952|Ga0163180_11548731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64556Open in IMG/M
3300012953|Ga0163179_11338004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64638Open in IMG/M
3300016771|Ga0182082_1072196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64595Open in IMG/M
3300017704|Ga0181371_1009812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641640Open in IMG/M
3300017705|Ga0181372_1038243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64811Open in IMG/M
3300017709|Ga0181387_1073161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64690Open in IMG/M
3300017713|Ga0181391_1112554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64612Open in IMG/M
3300017720|Ga0181383_1110738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64737Open in IMG/M
3300017720|Ga0181383_1214711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64509Open in IMG/M
3300017727|Ga0181401_1136409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64606Open in IMG/M
3300017727|Ga0181401_1168550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64527Open in IMG/M
3300017728|Ga0181419_1032885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641406Open in IMG/M
3300017730|Ga0181417_1010829All Organisms → cellular organisms → Bacteria → Proteobacteria2347Open in IMG/M
3300017740|Ga0181418_1011941All Organisms → cellular organisms → Bacteria → Proteobacteria2352Open in IMG/M
3300017741|Ga0181421_1065540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64956Open in IMG/M
3300017745|Ga0181427_1167125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64531Open in IMG/M
3300017749|Ga0181392_1082050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64971Open in IMG/M
3300017749|Ga0181392_1195953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64582Open in IMG/M
3300017750|Ga0181405_1169967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64534Open in IMG/M
3300017750|Ga0181405_1183014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64511Open in IMG/M
3300017755|Ga0181411_1197677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64565Open in IMG/M
3300017760|Ga0181408_1055451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641056Open in IMG/M
3300017760|Ga0181408_1193880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64517Open in IMG/M
3300017763|Ga0181410_1218771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64518Open in IMG/M
3300017765|Ga0181413_1204987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64588Open in IMG/M
3300017768|Ga0187220_1188513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64622Open in IMG/M
3300017771|Ga0181425_1117791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64848Open in IMG/M
3300017776|Ga0181394_1104648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64902Open in IMG/M
3300017781|Ga0181423_1090925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641200Open in IMG/M
3300017781|Ga0181423_1188438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64785Open in IMG/M
3300017949|Ga0181584_10059647All Organisms → Viruses → Predicted Viral2676Open in IMG/M
3300017952|Ga0181583_10321288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64980Open in IMG/M
3300017957|Ga0181571_10875792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64529Open in IMG/M
3300017964|Ga0181589_10661636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64658Open in IMG/M
3300017967|Ga0181590_10966959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64557Open in IMG/M
3300017968|Ga0181587_10808183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64585Open in IMG/M
3300017969|Ga0181585_10024295All Organisms → cellular organisms → Bacteria → Proteobacteria4925Open in IMG/M
3300017969|Ga0181585_10251718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641245Open in IMG/M
3300017985|Ga0181576_10862397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64533Open in IMG/M
3300018421|Ga0181592_10784386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64629Open in IMG/M
3300018423|Ga0181593_11057598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64554Open in IMG/M
3300020187|Ga0206130_10313227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64671Open in IMG/M
3300020189|Ga0181578_10446966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64550Open in IMG/M
3300020280|Ga0211591_1008408All Organisms → cellular organisms → Bacteria → Proteobacteria2333Open in IMG/M
3300020404|Ga0211659_10114104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641238Open in IMG/M
3300020410|Ga0211699_10308514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64617Open in IMG/M
3300020436|Ga0211708_10087478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641213Open in IMG/M
3300020471|Ga0211614_10385633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64618Open in IMG/M
3300020472|Ga0211579_10632900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64598Open in IMG/M
3300020478|Ga0211503_10146247All Organisms → Viruses → Predicted Viral1361Open in IMG/M
3300022063|Ga0212029_1003533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641618Open in IMG/M
3300022065|Ga0212024_1001465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED642438Open in IMG/M
3300022065|Ga0212024_1027779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64951Open in IMG/M
(restricted) 3300022916|Ga0233431_1046289All Organisms → cellular organisms → Bacteria → Proteobacteria2393Open in IMG/M
3300022934|Ga0255781_10252919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64827Open in IMG/M
3300022935|Ga0255780_10489177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64521Open in IMG/M
3300023170|Ga0255761_10144903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641412Open in IMG/M
3300023180|Ga0255768_10134330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641593Open in IMG/M
3300025096|Ga0208011_1017295All Organisms → Viruses → Predicted Viral1895Open in IMG/M
3300025109|Ga0208553_1116329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64608Open in IMG/M
3300025112|Ga0209349_1052817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641263Open in IMG/M
3300025112|Ga0209349_1176344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64559Open in IMG/M
3300025122|Ga0209434_1147358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64641Open in IMG/M
3300025127|Ga0209348_1006829All Organisms → cellular organisms → Bacteria → Proteobacteria4793Open in IMG/M
3300025127|Ga0209348_1218658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64522Open in IMG/M
3300025127|Ga0209348_1229027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64504Open in IMG/M
3300025132|Ga0209232_1105138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64948Open in IMG/M
3300025137|Ga0209336_10091182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64875Open in IMG/M
3300025141|Ga0209756_1096529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641286Open in IMG/M
3300025141|Ga0209756_1119097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641107Open in IMG/M
3300025168|Ga0209337_1186231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64859Open in IMG/M
3300025282|Ga0208030_1033289All Organisms → cellular organisms → Bacteria → Proteobacteria1574Open in IMG/M
3300025696|Ga0209532_1134019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64791Open in IMG/M
3300025816|Ga0209193_1016667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED642398Open in IMG/M
3300025889|Ga0208644_1380813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64526Open in IMG/M
3300026263|Ga0207992_1087608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64836Open in IMG/M
3300027788|Ga0209711_10152466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641108Open in IMG/M
3300027906|Ga0209404_10173492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641324Open in IMG/M
3300028197|Ga0257110_1041862All Organisms → cellular organisms → Bacteria → Proteobacteria2009Open in IMG/M
3300031605|Ga0302132_10531998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64513Open in IMG/M
3300032032|Ga0315327_10954566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64513Open in IMG/M
3300032047|Ga0315330_10163599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED641453Open in IMG/M
3300032073|Ga0315315_11066991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64721Open in IMG/M
3300034695|Ga0372840_267237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64504Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine29.06%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater23.08%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh14.53%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.84%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.98%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.42%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.56%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.71%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.71%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.71%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.71%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.71%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.85%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.85%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.85%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.85%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.85%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300005430Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69EnvironmentalOpen in IMG/M
3300005604Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006927Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaGEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300009110Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 198m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017704Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020280Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX556044-ERR599114)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300020478Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022916 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_200_MGEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300022935Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaGEnvironmentalOpen in IMG/M
3300023170Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025109Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025112Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025282Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026263Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300032032Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300034695Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1014001313300000115MarineVTEEERSIKHINTFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLHK
DelMOSum2011_1017421613300000115MarineMTQEEVFEKQITTFKTFCKNNRLRLKEDGDGLPVARAIGKFNEDRFFCNFKDGTIGVYVTRETQRQFTYLNKKLVK
JGI25128J35275_105764213300002488MarineMSKANKYVEDFKIFCRNNRLRLREAGDGLPIARAIGKFAEDSFYCNFKSGSIGVYVTRETQRQFTYLNRKLQKLGCEPNQIGDFEGTYDIEWMN
JGI25128J35275_110441113300002488MarineMSEEKYMKQIDTFKTFCKNNRLRLKEDGDGLPVARAIGKFKDDQFFCNFKNGTIGVYVTRETQRQFTYLNKKLVKMGCIPTQLGDFEASY
Ga0066849_1040537523300005430MarineMVEKTANKHISTFKTFCKNNRLRLRESGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLHKKLTKLGC
Ga0066852_1028369113300005604MarineMKGKQMTQEEVFAKQIETFKTFCKNNRLRLKEDGDGLPIARAIGKFKDDQFFCNFKDGTIGVYVTRETQRQFTYLNKKLVKMGCIPTQLGDFEAAYD
Ga0098048_113133333300006752MarineMSKQEVFDKQIETFKTFCKNNRLRLKEDGDGLPVATAIGKFKADQFFCNFRDGTIGVYVTRETQRQFT
Ga0098044_131204933300006754MarineMSKDAVFDKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKGDQFFCNFRDGTIGVYVSRETTRQFTYLNK
Ga0098054_1014027113300006789MarineMKGKQMTQEEVFAKQIETFKTFCKNNRLRLKEDGDGLPIARAIGKFKDDQFFCNFKDGTIGVYV
Ga0098055_140899223300006793MarineMTDAKLNKHIDTFKTFCKNNRLRLREDGDGLPVARAIGKFKEDQFFCNFKDGTIGVYVTRESQRQFTYL
Ga0098051_115329713300006924MarineVTEEEVAVKHINTFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKNGTIGVYVTRETQRQFTYLHKKLTK
Ga0098034_1000452403300006927MarineMLTDEEINKHIDIFKTFCKNNRLRLREAGDGMPIARAIGKFNEDQFFCNFRTGTIGVFVTRETQRQFTYL
Ga0098052_105605153300008050MarineMKGKQMTQEEVFAKQIETFKTFCKNNRLRLKEDGDGLPIARAIGKFKADQFFCNFKDGTIGVYVTRETQRQFTYLNKKLVKMGCIPTQLG
Ga0114905_116051723300008219Deep OceanMLTNEEINKHIETFKTFCKNNRLRLKESEDGLPIASAIGKFKEDEFFCNFKDGSIGVYATRE
Ga0117925_104842013300009110MarineVTEEEKSTKHINTFKTFCKNNRLRLKEDGDGLPVARAIGKFKADQFFCNFRDGTIGVYVCRETQRQFTYLNKKLVKMGCVPTQLGDFEASYDLEWMNIPP
Ga0118729_124280213300009130MarineMTDSKHIENFKVFCKNNRLRLREAGDFLPIAKAIGKFSEDHFFCNFKEGTIGVYVTRESQRQFTYLNKKLVKLG
Ga0115547_116457913300009426Pelagic MarineMTQEEKFTKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFNGDQFFCNFKDGSIGVYVTRETQRQFTYLNKKLVKLGCTPSQLGD
Ga0115545_121235833300009433Pelagic MarineLKGNKMDFQKQTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFAEDHFFCNFKDGTIGVYVTRESQRQFTYLN
Ga0115546_108855213300009435Pelagic MarineLKGNKMDFQKQTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFAEDHFFCNFKDGTIGVYVTRESQRQFTYLNKKL
Ga0115546_127601223300009435Pelagic MarineMSEEQLFEKQIETFKTFCKNNRLRLREAGDGLPVARAIGKFKEDQFFCNFRNGTIGVYVTRE
Ga0115546_131807723300009435Pelagic MarineLDHLTSNNLTSLGNTKGKTVTEEEKSTKHINTFKTFCKNNRLRLKEDGDGLPVARAIGKFKSDQFFCNFRDGTIGVYVTRETTRQFTYLN
Ga0115554_138622413300009472Pelagic MarineVTEEEKSTKHINTFKTFCKNNRLRLKEDGDGLPVARAIGKFSRDQFFCNFRNGTIGVYVTRET
Ga0114932_1019652133300009481Deep SubsurfaceVIEEEVFAKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKEDQFFCNFRDGTIGVYVTRETQRQFTYLNKKLIKMGCVP
Ga0115570_1032659213300009496Pelagic MarineLKGNKMDFQKQTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFAEDHFFCNFKDGTIGVYVTRESQRQF
Ga0115011_1003625353300009593MarineVTAEELESKHINTFKTFCKNNRLRLREDGDGLPVARAIGKFKQDQFFCNFRDGTIGVYVTRESQRQFTYLHKKLTKLGCVATQLGDLKRLMTLSG*
Ga0115011_1162650213300009593MarineMTNSKHIENFKLFCKNNRLRLKEAGDFLPIAKAIGKFSEDHFFCNFKEGTIGVYVTRDTQRQFTYLNRKLMKLGCAPTQTGDFEG
Ga0115002_1116047213300009706MarineLKGNKMNEEKLLKHISTFKTFCKNNRLRLKEDGDGLPVARAIGKFSDDQFFCNFQSGTIGVYVTRETPRQFTYLHRKLTKLGCVATQLGDFEASYDLEWMNI
Ga0115012_1211122113300009790MarineMTQETVYEKQIETFKTFCKNNRLRLKEDGDGLPIARGIGKFRADQFFCKFKDGTI*VYVNRETQRQFTYLNKK
Ga0129348_126294023300010296Freshwater To Marine Saline GradientLKGDKMDFQKHTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQVGDFEGCYDLEWM
Ga0163110_1137283413300012928Surface SeawaterLKGDTMSEEEVFSKQIETFKTFCKNNRLRLREDEDGLPVARAIGKFKKDQFFCNFKSGSIGVYVTRETQRQFTYLNKKLVKLGCVPTQLGDFEASY
Ga0163109_1031005613300012936Surface SeawaterMTDAKHIENFKLFCRNNRLRLREAGDFLPIAKAIGKFSEDHFFCNFRQGTIGVYVTRESQRQFTYLNKKLVKL
Ga0163180_1154873123300012952SeawaterLKGDVMGEEEILTKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKNDQFFCNFKDGTIGVYVTRETQRQFTYLNK
Ga0163179_1133800413300012953SeawaterMTQEEKLTKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKNDQFFCNFKDGTIGVYVTRETQRQFTYLNKKLTKMGCVATQLGDFEASYDLEWMN
Ga0182082_107219613300016771Salt MarshMDFQKHTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFSDDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQVGDFE
Ga0181371_100981253300017704MarineMKGKQMTQEEVFAKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKNDQFFCNFKDGTIGVYV
Ga0181372_103824333300017705MarineMKGKQMTQEEVFAKQIETFKTFCKNNRLRLKEDGDGLPIARAIGKFKADQFFCNFKDGTIGVYV
Ga0181387_107316113300017709SeawaterMQASQKYIDNFKIFCRNNRLRLRESGDGLPVARAIGKFSEDQFYCNFKSGSIGVYVTRETSRQFTYLNRKLQKLGC
Ga0181391_111255413300017713SeawaterMTDTKHIDNFKLFCKNNRLRLKEAGDFLPIAKAIGKFADDHFFCNFKQGTIGVYVTRESQRQFTYLNKKLIKLGCVP
Ga0181383_111073833300017720SeawaterMTEEELFTKQIETFKTFCKNNRLRLKEAGDGLPVARAIGKFKTDQFFCNFKDGTIGVYVTRE
Ga0181383_121471113300017720SeawaterMTQEEVFEKQIITFKTFCKNNRLRLKEDGDGLPVARAIGKFNEDRFFCNFKDGTIGVYVTRETQRQFT
Ga0181401_113640923300017727SeawaterVTEEERSTKHINTFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFRDGTIGVYVTRETQRQFTYLHK
Ga0181401_116855023300017727SeawaterMTHTKHIENFKLFCKNNRLRLREAGDFLPIAKAIGKFSEDHFYCNFKQGTIGVYVTRESQRQFTYLNKKLVKLGCSPTQLGDFEACYDLEWMN
Ga0181419_103288553300017728SeawaterVTEEEVEVKHINTFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLHKKLTKLGCVATQLGDFEGAYDLEWMNI
Ga0181417_101082993300017730SeawaterMNEEQTFSKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKSDQFFCNFKDGTIGVYVTRETPRQFTYLNKKL
Ga0181417_101362473300017730SeawaterVTEEEVDVKHINTFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVT
Ga0187218_117156123300017737SeawaterMDFQKQTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFAEDHFFCNFKDGTIGVYVTRE
Ga0181418_101194113300017740SeawaterVTEEEVEVKHINTFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFRDGTIGVYVTRETQRQFTYLHKKLTKLGCVATQLGDFEGAYDLEWMNIPP
Ga0181421_106554023300017741SeawaterVTEEEVEVKHINTFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLHKKLTKLGCVATQLGDFEGSYDLEWM
Ga0181427_116712523300017745SeawaterMDFQKQTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFADDHFFCNFKDGTIGVYVTRESQRQFTYLNKKLIKLGCVPTQTGDFEGC
Ga0181392_108205053300017749SeawaterMNEEQTFSKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKSDQFFCNVKDVTIGVYVTRETPRQFTYLNK
Ga0181392_119595313300017749SeawaterMDFQKQTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFAEDHFFCNFKDGTIGVYVTRESQRQFTYLNKKLV
Ga0181405_116996723300017750SeawaterVTEEEVEVKHINSFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLHK
Ga0181405_118301423300017750SeawaterMDFQKQTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFADDHFFCNFKDGTIGVYVTRESQRQFTYLNKKLIKLGCVPTQTGDFEGCYDLEWMNIPP
Ga0181411_119767713300017755SeawaterMNEEQTFSKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKSDQFFCNFKDGTIGVYVTRETPRQFTYLNKKLTKMG
Ga0181408_105545113300017760SeawaterMTEEELFTKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKSDQFFCNFKNGTIGVYVSRETPRQFTYLNKKL
Ga0181408_119388013300017760SeawaterMTETALSKQVETFKTFCKNNRLRLKEDDDGLPVARAIGKFKQDQFFCNFKEGTIGVYVTRETQRQFTYLNKKLIKMGCVPTQLGDFEASYDL
Ga0181410_121877113300017763SeawaterVTEEEVEVKHINSFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLHKKLTKLGCVATKLGDFEGAYDLEWMN
Ga0181413_120498723300017765SeawaterVTEEEKSTKHINTFKTFCKNNRLRLKEDGDGLPVARAIGKFKGDQFFCNFRDGTIGVYVTRETTRQFTYLNKKLVKMGCVPT
Ga0187220_118851323300017768SeawaterMTQEEVFEKQITTFKTFCKNNRLRLKEDGDGLPVARAIGKFNEDRFFCNFKDGTIGVYVTRETQRQFTYLNKKLVKMGCIPTQLGDFEAAYDLEWMNI
Ga0181425_111779133300017771SeawaterVTEEEVDVKHINTFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLHKKLTKLGCVATQLGDFEGAYDLEWMN
Ga0181394_110464813300017776SeawaterMDFQKQTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFADDHFFCNFKDGTIGVYVTRESQRQFTYLN
Ga0181423_109092533300017781SeawaterMQASQKYIDNFKIFCRNNRLRLRESGDGLPVARAIGKFSEDQFYCNFKSGSIGVYVTRETSRQFTYLNRKLQKLGCEPNQIGDFEG
Ga0181423_118843833300017781SeawaterVTEEEKSTKHINTFKTFCKNNRLRLKEDGDGLPVARAIGKFKGDQFFCNFRDGTIGVYVTRETTRQFTYLNKK
Ga0181584_1005964783300017949Salt MarshMTFQKHTENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQVGDFEGCYDLEWM
Ga0181583_1032128833300017952Salt MarshMDFQKHTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFSDDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIK
Ga0181571_1087579213300017957Salt MarshLKGNKLTEKKLNKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFRDDQFFCNFKDGTIGVYVTRETQRQFTYLNKKLIKMGCIPTQLGDFEA
Ga0181589_1066163633300017964Salt MarshMNFDKYIENFKTFCRNNRLRLQEADDGLPVAKAIGKFSEDHFYCNFKEGSIGVYVERETGRQLTYLNRKLEKLGCELTQLADQEACYDVEWM
Ga0181590_1096695923300017967Salt MarshMDFQKHTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFSDDHFYCNFREGTIGVYVTRESQRQFTYLNKKL
Ga0181587_1080818323300017968Salt MarshLTEKKLNKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFRDDQFFCNFKDGTIGVYVTRETQ
Ga0181585_10024295143300017969Salt MarshMNFDKYIENFKTFCRNNRLRLKEADDGLPIAKAIGKFSEDHFYCNFKEGSIGVYVERETGRQLTYLNRKL
Ga0181585_1025171843300017969Salt MarshMTFQKHTENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQVGDFEGCYDLEWMNIPPVA
Ga0181576_1086239723300017985Salt MarshMTFQKHTENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRDSQRQFTYLNKKLIKLGCEPTQV
Ga0181592_1078438623300018421Salt MarshMTFQKHTENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQVGDFEGCYDLEWMNIPP
Ga0181593_1105759813300018423Salt MarshMTFQKHTENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRDSQRQFTYLNKKLIKLGCEPTQVG
Ga0206130_1031322723300020187SeawaterMLGLLILQICTPDKSSKGKKMSEEQLFEKQIETFKTFCKNNRLRLREAGDGLPVARAIGKFKEDQFFCNFRNGTIGVYVTRETQRQFTYLNKKLIKMGCIPTQLG
Ga0181578_1044696613300020189Salt MarshLTEKKLNKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFRDDQFFCNFKDGTIGVYVTRETQRQF
Ga0211591_100840893300020280MarineMSEEEMFSKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKADQFFCNFKDGTIGVYVTRDTQR
Ga0211659_1011410413300020404MarineMNYQKHAENFKTFCRNNRLRLKESGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQV
Ga0211699_1030851413300020410MarineMTEEEVFTKQIETFKTFCKNNRLRLREDGDGLPVARAIGKFKSDQFFCNFKDGTIGVYVTRETQRQFTYLNKKLVKMGCI
Ga0211708_1008747813300020436MarineMTEEESFAKQIETFKTFCKNNRLRLKEDGDGLPIARAIGKFKGDQFFCNFKNGTIGVYVTRETQRQFT
Ga0211614_1038563333300020471MarineMSEEEVFSKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKDDQFFCNFRDGTIGVYVTRDTQRQ
Ga0211579_1063290013300020472MarineMSEEEVFAKQVETFKTFCKNNRLRLKEDGDGLPVARAIGKFKADQFFCNFRDGTIGVYVTRD
Ga0211503_1014624743300020478MarineVTEEETFAKQIETFKTFCRNNRLRLKEDGDGLPVARAIGKFKDDQFFCNFKDGTIGVYVTRETQRQFTYLNKKLIKMGCVPTQLGDFEAS
Ga0212029_100353353300022063AqueousMDFQKHTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQVGDFEGCY
Ga0212024_100146513300022065AqueousMDFQKHTENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQVGDFEGC
Ga0212024_102777933300022065AqueousMDFQKHTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLI
(restricted) Ga0233431_104628913300022916SeawaterMLSTEQITKHITTFKTFCKNNRLRLKEDDDGLPVARAIGKFNTDQFFCNFKDGTIGVYVTRETPRQFTYLNKKLERLGC
Ga0255781_1025291933300022934Salt MarshMTFQKHTENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQVGDFEGCYDLEWMNIPPV
Ga0255780_1048917713300022935Salt MarshMDFQKHTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLN
Ga0255761_1014490313300023170Salt MarshMTFQKHTENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLN
Ga0255768_1013433063300023180Salt MarshMTFQKHTENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPT
Ga0208011_101729513300025096MarineMTQEEVFAKQIETFKTFCKNNRLRLKEDGDGLPIARAIGKFKADQFFCNFKDGTIGVYVTRETQRQFTYLNKKLVKM
Ga0208553_111632913300025109MarineMLTDEEINKHIDIFKTFCKNNRLRLREAGDGMPIARAIGKFNEDQFFCNFRTGTIGVFVTRETQRQFTYLHKKLTKLGCVA
Ga0209349_105281713300025112MarineMLTDEEINKHIDIFKTFCKNNRLRLREAGDGMPIARAIGKFNEDQFFCNFRTGTIGVFVTRETQRQFTYLHKKLTKLGCVATQLGDFEAAYDLEWMN
Ga0209349_117634423300025112MarineMEDSQKYIDDFKIFCRNNRLRLREAGDGLPIAKAIGKFSNDRFYCNFETGSIGLYVTRETQRQFTYLDRKLRKLGCHPHQIGDAEG
Ga0209434_114735823300025122MarineMTEEALSKHIETFKTFCKNNRLRLKEAGDGLPVARAIGKFNTDEFFCNFKDGSIGVYAGRETQRQFTYLHKKLMKLGCIPHQIGDFEGSYDLEWMNIP
Ga0209348_100682913300025127MarineMTEEEVFTKQIETFKTFCKNNRLRLREDGDGLPVARAIGKFKSDQFFCNFKDGTIGVYVTRETQRQFTYLNKKLVKMGCIPTQLGDFEASYD
Ga0209348_121865823300025127MarineMNFDKLADDFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFFCNFKNGTIGVYVTRESQRQFTYLNKKLIKLGCVPT
Ga0209348_122902723300025127MarineMSQDEIFNKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKSDQFFCNFKDGTIGVYVT
Ga0209232_110513813300025132MarineMSNNKLTKHIEVFKTFCKNNRLRLKEDGDGLPVARAIGKHSQDQFFCNFREGTIGVYVTR
Ga0209336_1009118233300025137MarineMTQEETFDKQIMTFKTFCKNNRLRLREDGDGLPVARAIGKHNEDQFFCNFKDGTIGVYVTRETQRQFTYLNKKLV
Ga0209756_109652933300025141MarineMTQEEVFAKQIETFKTFCKNNRLRLKEDGDGLPIARAIGKFKADQFFCNFKDGTIGVYVTRETQRQFTYLNKKLVKMGCIPTQLGDFEAAYDLEW
Ga0209756_111909713300025141MarineMRNAQKYIEDFKIFCRNNRLRLREAGDGLPIARAIGKFAEDQFYCNFKSGSIGVYVTRETQRQFTYLNRKLQKLGCQPHQIGDFEGTYDIEWMNI
Ga0209337_118623123300025168MarineMTQEAVYDKQIETFKTFCKNNRLRLKEDGDGLPIARAIGKFRGDQFFCNFKDGTIGVYVTRETPRQF
Ga0208030_103328953300025282Deep OceanMLTNEEINKHIETFKTFCKNNRLRLKESEDGLPIASAIGKFKEDEFFCNFKDGSIGVYATRETPRQFTYLHKK
Ga0209532_113401913300025696Pelagic MarineMTQEEKFTKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFNGDQFFCNFKDGSIGVYVTRETQRQFTYLNKKLVKLGC
Ga0209193_101666713300025816Pelagic MarineMNFEKYIENFKTFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFFCNFKDGTIGVYVERETGRQFTYLNRKLIGMGCAPSQLGDQEGCYDVE
Ga0208644_138081313300025889AqueousMDFQKHTENFKIFCRNNRLRLKEAGDGLPIAKAIGKFSEDHFYCNFREGTIGVYVTRESQRQFTYLNKKLIKLGCEPTQVGDQEGCYDL
Ga0207992_108760833300026263MarineMKGKQMTQEEVFAKQIETFKTFCKNNRLRLKEDGDGLPIARAIGKFKDDQFFCNFKDGTIGVYVTRETQRQFTYLNKK
Ga0209711_1015246613300027788MarineMNEEKLLKHISTFKTFCKNNRLRLKEDGDGLPVARAIGKFSADQFFCNFQSGTIGVYVTRETPRQFTYLHRTLTKLGCVATQLGDFEA
Ga0209404_1017349223300027906MarineVTAEELESKHINTFKTFCKNNRLRLREDGDGLPVARAIGKFKQDQFFCNFRDGTIGVYVTRESQRQFTYLHKKLTKLGCVATQLGDLKRLMTLSG
Ga0257110_104186263300028197MarineVTEEEVEVKHINSFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLHKKLTKLGCVATQLGDFE
Ga0302132_1053199813300031605MarineVTEEEVEVKHINSFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLHKKLTKLGCVATQLGDFEGAYDLEWMN
Ga0315327_1095456613300032032SeawaterMTQEEVYTKQIETFKTFCKNNRLRLKEDGDGLPVARAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLNKKLV
Ga0315330_1016359913300032047SeawaterVTEEEVEVKHINTFKTFCKNNRLRLREAGDGLPVAKAIGKFKEDQFFCNFKDGTIGVYVTRETQRQFTYLH
Ga0315315_1106699113300032073SeawaterMSEEEMFSKQVETFKTFCKNNRLRLKEDGDGLPVARAIGKFKADQFFCNFKDGTIGVYVTRDTQRQFTYLNKKLIKMGCVPTQLGDF
Ga0372840_267237_256_5043300034695SeawaterMTEEEKSTKHINTFKTFCKNNRLRLKEDGDGLPVARAIGKFKSDQFFCNFRDGTIGVYVTRETTRQFTYLNKKLVKMGCVPTQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.