| Basic Information | |
|---|---|
| Family ID | F077158 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 48 residues |
| Representative Sequence | TLAERRAELDRLLRAELERQGIVVSGRDVARVVGVAVGKGIEWAG |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 90.60 % |
| % of genes from short scaffolds (< 2000 bps) | 81.20 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.726 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.367 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.880 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.137 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.10% β-sheet: 0.00% Coil/Unstructured: 58.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF04286 | DUF445 | 7.69 |
| PF13485 | Peptidase_MA_2 | 6.84 |
| PF02881 | SRP54_N | 5.13 |
| PF06114 | Peptidase_M78 | 2.56 |
| PF02978 | SRP_SPB | 2.56 |
| PF01245 | Ribosomal_L19 | 1.71 |
| PF01351 | RNase_HII | 1.71 |
| PF14792 | DNA_pol_B_palm | 0.85 |
| PF01556 | DnaJ_C | 0.85 |
| PF00512 | HisKA | 0.85 |
| PF13193 | AMP-binding_C | 0.85 |
| PF01746 | tRNA_m1G_MT | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 7.69 |
| COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 7.69 |
| COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 2.56 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 1.71 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 1.71 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 1.71 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.73 % |
| Unclassified | root | N/A | 4.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001086|JGI12709J13192_1017805 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
| 3300002558|JGI25385J37094_10053737 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300002560|JGI25383J37093_10184998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 549 | Open in IMG/M |
| 3300002562|JGI25382J37095_10090219 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300002562|JGI25382J37095_10157110 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 732 | Open in IMG/M |
| 3300002911|JGI25390J43892_10084573 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300002916|JGI25389J43894_1047368 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300002916|JGI25389J43894_1054213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 677 | Open in IMG/M |
| 3300004463|Ga0063356_102265593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 828 | Open in IMG/M |
| 3300005166|Ga0066674_10301782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 753 | Open in IMG/M |
| 3300005167|Ga0066672_10572745 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005181|Ga0066678_10032247 | All Organisms → cellular organisms → Bacteria | 2864 | Open in IMG/M |
| 3300005186|Ga0066676_10138880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1517 | Open in IMG/M |
| 3300005186|Ga0066676_10344100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 996 | Open in IMG/M |
| 3300005434|Ga0070709_10007482 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5988 | Open in IMG/M |
| 3300005435|Ga0070714_100360890 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300005445|Ga0070708_100412532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1274 | Open in IMG/M |
| 3300005445|Ga0070708_100426942 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300005445|Ga0070708_101687538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 589 | Open in IMG/M |
| 3300005446|Ga0066686_10176993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1421 | Open in IMG/M |
| 3300005518|Ga0070699_100195802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1796 | Open in IMG/M |
| 3300005536|Ga0070697_100799773 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005552|Ga0066701_10924567 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 516 | Open in IMG/M |
| 3300005554|Ga0066661_10637425 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005568|Ga0066703_10361341 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005569|Ga0066705_10172171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1342 | Open in IMG/M |
| 3300005576|Ga0066708_10898212 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006031|Ga0066651_10776484 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 518 | Open in IMG/M |
| 3300006755|Ga0079222_10117602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1439 | Open in IMG/M |
| 3300006755|Ga0079222_11363323 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 653 | Open in IMG/M |
| 3300006791|Ga0066653_10678085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 530 | Open in IMG/M |
| 3300006794|Ga0066658_10023219 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2444 | Open in IMG/M |
| 3300006797|Ga0066659_10042318 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2821 | Open in IMG/M |
| 3300006806|Ga0079220_12009566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300006914|Ga0075436_100272225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1210 | Open in IMG/M |
| 3300007258|Ga0099793_10326530 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300009088|Ga0099830_10029417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3692 | Open in IMG/M |
| 3300009089|Ga0099828_11220241 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300009090|Ga0099827_11162542 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010304|Ga0134088_10087141 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300010304|Ga0134088_10480168 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300010322|Ga0134084_10048244 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1246 | Open in IMG/M |
| 3300010329|Ga0134111_10068898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1316 | Open in IMG/M |
| 3300010396|Ga0134126_10412618 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300010398|Ga0126383_12499946 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300010400|Ga0134122_10121312 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2094 | Open in IMG/M |
| 3300011270|Ga0137391_11569282 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300011420|Ga0137314_1071838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 841 | Open in IMG/M |
| 3300011421|Ga0137462_1015256 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300012040|Ga0137461_1020545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1659 | Open in IMG/M |
| 3300012199|Ga0137383_11064074 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012202|Ga0137363_10379218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1175 | Open in IMG/M |
| 3300012202|Ga0137363_10745091 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 830 | Open in IMG/M |
| 3300012208|Ga0137376_10049705 | All Organisms → cellular organisms → Bacteria | 3425 | Open in IMG/M |
| 3300012211|Ga0137377_11459347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 611 | Open in IMG/M |
| 3300012285|Ga0137370_10005473 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5769 | Open in IMG/M |
| 3300012285|Ga0137370_10261260 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300012351|Ga0137386_10433479 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300012353|Ga0137367_10015554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6024 | Open in IMG/M |
| 3300012354|Ga0137366_10412188 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300012363|Ga0137390_10053775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3911 | Open in IMG/M |
| 3300012925|Ga0137419_11751812 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012927|Ga0137416_10376617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1197 | Open in IMG/M |
| 3300012927|Ga0137416_10972276 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012929|Ga0137404_10141276 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1992 | Open in IMG/M |
| 3300012977|Ga0134087_10063636 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300014154|Ga0134075_10151179 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300014157|Ga0134078_10619454 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300014166|Ga0134079_10011436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2709 | Open in IMG/M |
| 3300014877|Ga0180074_1121250 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300015242|Ga0137412_11103345 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300015264|Ga0137403_11487222 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300015359|Ga0134085_10365849 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300017654|Ga0134069_1391999 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300017659|Ga0134083_10230741 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 770 | Open in IMG/M |
| 3300018059|Ga0184615_10647847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 544 | Open in IMG/M |
| 3300018063|Ga0184637_10617731 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300018071|Ga0184618_10246425 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300018433|Ga0066667_10051004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2498 | Open in IMG/M |
| 3300020003|Ga0193739_1090348 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 776 | Open in IMG/M |
| 3300020199|Ga0179592_10078582 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300021073|Ga0210378_10102843 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300021178|Ga0210408_11265788 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300024330|Ga0137417_1474998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2273 | Open in IMG/M |
| 3300025324|Ga0209640_10273839 | Not Available | 1417 | Open in IMG/M |
| 3300025324|Ga0209640_10469436 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300025324|Ga0209640_10931678 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300025922|Ga0207646_10285254 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300026295|Ga0209234_1003150 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6276 | Open in IMG/M |
| 3300026295|Ga0209234_1316402 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300026296|Ga0209235_1073544 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1549 | Open in IMG/M |
| 3300026296|Ga0209235_1187364 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 753 | Open in IMG/M |
| 3300026306|Ga0209468_1182251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 531 | Open in IMG/M |
| 3300026314|Ga0209268_1181873 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026323|Ga0209472_1249406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
| 3300026324|Ga0209470_1130790 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300026523|Ga0209808_1269537 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300026527|Ga0209059_1279233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 563 | Open in IMG/M |
| 3300026530|Ga0209807_1035749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2366 | Open in IMG/M |
| 3300026540|Ga0209376_1417635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300026547|Ga0209156_10001961 | All Organisms → cellular organisms → Bacteria | 16455 | Open in IMG/M |
| 3300027388|Ga0208995_1032225 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300027646|Ga0209466_1052541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 823 | Open in IMG/M |
| 3300027725|Ga0209178_1077318 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300028771|Ga0307320_10401734 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031576|Ga0247727_10502298 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300031576|Ga0247727_10718974 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300031962|Ga0307479_11031320 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031965|Ga0326597_10208629 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2284 | Open in IMG/M |
| 3300032180|Ga0307471_100708548 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300032180|Ga0307471_101653488 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 795 | Open in IMG/M |
| 3300032180|Ga0307471_102966892 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300033158|Ga0335077_10163218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2542 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.37% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.98% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.71% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.71% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12709J13192_10178052 | 3300001086 | Forest Soil | PLEEQRAELDRLLRAELERQGIVVTGKDVARVVAVAVGKGIEWAG* |
| JGI25385J37094_100537372 | 3300002558 | Grasslands Soil | PSGPPAVRPSLEEQRVDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG* |
| JGI25383J37093_101849981 | 3300002560 | Grasslands Soil | EQRVDLDGRLRAELERQGIVVTGKEVARVVGVAVGKGIEWAD* |
| JGI25382J37095_100902191 | 3300002562 | Grasslands Soil | RRNELDRLLREELERQGIVVTGKDIARVVSTAVGKGLEWAG* |
| JGI25382J37095_101571101 | 3300002562 | Grasslands Soil | PPPLEEQRVDLDGRLRAELERQGIVVTGKEVARVVGVAVGKGIEWAD* |
| JGI25390J43892_100845732 | 3300002911 | Grasslands Soil | RPSPSLSDRRNELDRLLREELERQGIVVTGKDIARVVSTAVGKGLEWAG* |
| JGI25389J43894_10473682 | 3300002916 | Grasslands Soil | EEPPPTSGDLRRPSALEQQRAELDRRLRAELERQGMVVTGKEVARVVGVAVGKGIEWAG* |
| JGI25389J43894_10542131 | 3300002916 | Grasslands Soil | SLEEQRVDLDGRLRAELERQGIVVTGKEVARVVGFAVGKGIEWAG* |
| Ga0063356_1022655931 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PLEEQRAELDRRLREELERQGIVVSGKDVARVVGVSVGKGIEWAG* |
| Ga0066674_103017821 | 3300005166 | Soil | HRPPPSLADRRAELDQLLRAELEHQGIVVSGQDIARVVGAAVGKGIEWQP* |
| Ga0066672_105727451 | 3300005167 | Soil | PSLSDRRNELDRLLRQELERQGIDVTGKDIARVVSTAVGKGLEWAG* |
| Ga0066678_100322471 | 3300005181 | Soil | PPTSTDIHRPPPTLSDRHAELDRLLREELEHQGIVVTGQDIARVVGSAVGKGIEWQA* |
| Ga0066676_101388803 | 3300005186 | Soil | SLEEQRVDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG* |
| Ga0066676_103441002 | 3300005186 | Soil | PTFQDRRAELDALLRAELESQGIVVSGHDVARVVSSAAGQRIAWAG* |
| Ga0070709_100074821 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RSAPSPSPTSTNLHQPPPTLSERRAELDRLLRQELERQGIVVTGRDIARVVGSAVGKGIEWQA* |
| Ga0070714_1003608901 | 3300005435 | Agricultural Soil | ERRAELDRLLRQELERQGIVVTGRDIARVVGSAVGKGIEWQA* |
| Ga0070708_1004125321 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GRSVDVQPSPTSPTSTNLHPPPATLAERRAELDRLLREELERQGIIVSGQEVARVVGSAVGKGIEWQA* |
| Ga0070708_1004269421 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PQTSSNLPQPPRTLADRRSELDRLLREELEHQGIVVTGSDIARVVGSAVGKGIEWQA* |
| Ga0070708_1016875382 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PPSPAVDRPPPSSLEQQRDELDRKLRAELERQGLVVTGKEVARVVEQAVGKGIEWAG* |
| Ga0066686_101769932 | 3300005446 | Soil | HRPPPSLADRRAELDQLLRAELEHQGIVVGGQEVARVVGAAVGKGIEWQP* |
| Ga0070699_1001958021 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GDVRRPSALEDQRADLDGRLRAELERQGIVVTGKEVARVVGVAIGKGIEWAG* |
| Ga0070697_1007997732 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PARPMTNAERRAELDRRLREELERQGIVVTGKDIARAVGSAVGKEIQWAG* |
| Ga0066701_109245671 | 3300005552 | Soil | TSSNLPKPPPTLSDRREELDRLLRQELENQGIVVGGQEVARVVGVAVGKGIEWQA* |
| Ga0066661_106374252 | 3300005554 | Soil | ELDRRLRTELERQGIVVTGKEVARVVGVAVGKGIEWAG* |
| Ga0066703_103613412 | 3300005568 | Soil | LDRLLRQELERQGIVVAGKDIARVVSTAVGKGLEWAG* |
| Ga0066705_101721711 | 3300005569 | Soil | RAELDALLRAELESQGIVVSGHDVARVVGSAAGQRIEWAG* |
| Ga0066708_108982122 | 3300005576 | Soil | DLDRRLRAELERQGLVVTGKEVARVVGQSVGKGIEWAG* |
| Ga0066706_102386193 | 3300005598 | Soil | RLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG* |
| Ga0066651_107764842 | 3300006031 | Soil | PTSSNLPKPPPTLSDRREELDRLLRQELENQGIVVGGQEVARVVGVAVGKGIEWQA* |
| Ga0079222_101176021 | 3300006755 | Agricultural Soil | LPQPPRTLADRRSELDRLLRQELERQGIVVTGRDIARVVGSAVGKGIEWQA* |
| Ga0079222_113633231 | 3300006755 | Agricultural Soil | RIDLDRRLRAELERQGLVVTGKEVARVVGMAAGKGIEWAGWFRWAAWS* |
| Ga0066653_106780852 | 3300006791 | Soil | LDGRLRAELERQGIVVDGKDIARVVGVAVGKGIEWAG* |
| Ga0066658_100232192 | 3300006794 | Soil | LSERREDLDRLLRQELESQGIVVGGQAVARVVGAAVGKGIEWQA* |
| Ga0066659_100423181 | 3300006797 | Soil | PQPPPTLAVRRAELDQLLRAELEHQGIIVRGQDIARVVGTAVGKGIEWRA* |
| Ga0079220_120095661 | 3300006806 | Agricultural Soil | QRADLDGRLRAELERQGIVVTGKEVARVVGVAIGKGIEWAG* |
| Ga0075436_1002722252 | 3300006914 | Populus Rhizosphere | LDRRLRAELERQGLVVTGKEVARVVGMSAGKGIEWAG* |
| Ga0099793_103265301 | 3300007258 | Vadose Zone Soil | PITADSRPLPPSLAGRRAELDRLLRQELERQGIVVAGKDIARVVSTAVGKGLEWAG* |
| Ga0099830_100294174 | 3300009088 | Vadose Zone Soil | QRAELDRRLRAELERQGMVVTGKEVARVVGVAVGKGIEWAG* |
| Ga0099828_112202411 | 3300009089 | Vadose Zone Soil | LSRPAATLAARRAELDRLLRAELERQGIVVTGRDVARVVGAAVGKGIEWQA* |
| Ga0099827_111625421 | 3300009090 | Vadose Zone Soil | LTLADRRDELDRLLRAELESHGIVVTGADIARVVSIAVGKGIEWAG* |
| Ga0134088_100871413 | 3300010304 | Grasslands Soil | ERRAELDALLRAELESQGIVVSGHDVARVVGSAAGQRIEWAG* |
| Ga0134088_104801681 | 3300010304 | Grasslands Soil | ALLRAELESQGIVVSGHDVARVVSSAAGQRIAWAG* |
| Ga0134084_100482442 | 3300010322 | Grasslands Soil | PPRPSLEEQRADLDRRLRAELERQGLVVTGKEVARVVGMAAGKGIEWAG* |
| Ga0134111_100688981 | 3300010329 | Grasslands Soil | TATLDEQREDLDARLRAELERQGIVVTGKEVARVVGSAVGKGIEWAG* |
| Ga0134126_104126183 | 3300010396 | Terrestrial Soil | AAPSRPVPPLAERRAELDQLLRAELEHQGIIVGGQEVARVVGVAVGKGIEWQA* |
| Ga0126383_124999462 | 3300010398 | Tropical Forest Soil | SRPSPTLSERRDELDRLLRAELESHGVVVTGHDVARVVSTAVGKGIEWAG* |
| Ga0134122_101213121 | 3300010400 | Terrestrial Soil | VAAPSRPVPPLAERRAELDQLLRAELEHQGIIVGGQEVARVVGVAVGKGIEWQA* |
| Ga0137391_115692822 | 3300011270 | Vadose Zone Soil | AHSRPLPSLSERRAELDQLLRAELEHQGIVVGGQEVARVVGVAVGKGIEWQA* |
| Ga0137314_10718382 | 3300011420 | Soil | PSADVRRPAPLEEQRADLDRRLRDALERQGLVVTGKEVARVVGVAVGKGIEWAG* |
| Ga0137462_10152563 | 3300011421 | Soil | RPVTVAEQRAELDRRLREELERQGLVVAGREIARVVASAVGKDIQWAG* |
| Ga0137461_10205451 | 3300012040 | Soil | AAVAQPRAPTLAERRAEFDRLLHEELERQGIVVSGRDVARVVGLAVGKGIEWAG* |
| Ga0137383_110640741 | 3300012199 | Vadose Zone Soil | PPTLEERRAELDALLRAELESQGIVVSGHDVARVVGSAAGQRIEWAG* |
| Ga0137363_103792181 | 3300012202 | Vadose Zone Soil | PSDRPTAQPSLEEQRVDLDRRLRAELERQGLVVTGKEIARVVGMAAGKGIEWAG* |
| Ga0137363_107450912 | 3300012202 | Vadose Zone Soil | EDRPSLEDQRIDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG* |
| Ga0137376_100497056 | 3300012208 | Vadose Zone Soil | AELDALLRAELESQGIVVSGHDVARVVGSAVGQRIEWAG* |
| Ga0137377_114593472 | 3300012211 | Vadose Zone Soil | EEQRADLDRRLRDELERQGLVVTGKEVARVVASSVGKGIEWAG* |
| Ga0137370_100054739 | 3300012285 | Vadose Zone Soil | DLDRRLRAELERQGIVVTGKEIARVVAVAVGKGMEWTG* |
| Ga0137370_102612602 | 3300012285 | Vadose Zone Soil | ALLRAELESQGIVVSGHDVARVVGSAVGQRIEWAG* |
| Ga0137386_104334791 | 3300012351 | Vadose Zone Soil | RPRPLEDQRVDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG* |
| Ga0137367_100155541 | 3300012353 | Vadose Zone Soil | PSAAPRRPAPLEEQRADLDRRLRAELERQGLVVTGKEVARVVASSVGKGIEWAG* |
| Ga0137366_104121881 | 3300012354 | Vadose Zone Soil | LEERRSELDALLRAELESQGIVVTGHDVARVVGVAAGQRIAWAG* |
| Ga0137390_100537754 | 3300012363 | Vadose Zone Soil | RAELDRRLRAELERQGMVVTGKEVARVVGVAVSKGIEWAG* |
| Ga0137419_117518122 | 3300012925 | Vadose Zone Soil | VRPSLEEQRVDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG* |
| Ga0137416_103766171 | 3300012927 | Vadose Zone Soil | EEQRIDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG* |
| Ga0137416_109722762 | 3300012927 | Vadose Zone Soil | QPTARPPDRPTATLAARRAELDDLLRRELEHQGIIVGGQEVARVVGAAVGKGIEWQA* |
| Ga0137404_101412761 | 3300012929 | Vadose Zone Soil | HQPPATLAERRAELDRLLREELEHQGIVVTGQAVARVVGVAVGKGIEWQA* |
| Ga0134087_100636362 | 3300012977 | Grasslands Soil | PPPSSTALHRPPPSLADRRAELDQLLRAELEHQGIVVGGQEVARVVGAAVGKGIEWQP* |
| Ga0134075_101511792 | 3300014154 | Grasslands Soil | QTVRPSLEEQRVDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG* |
| Ga0134078_106194541 | 3300014157 | Grasslands Soil | LEERRAELDALLRAELESQGIVVTGHDVARVVGVAAGQRIAWAG* |
| Ga0134079_100114361 | 3300014166 | Grasslands Soil | IALHRPPPSLADRRAELDQLLRAELEHQGIVVGGQEVARVVGAAVGKGIEWQP* |
| Ga0180074_11212502 | 3300014877 | Soil | AERRAELDRLLHEELERQGIVVSGRDVARVVGSAVGKGIEWAG* |
| Ga0137412_111033451 | 3300015242 | Vadose Zone Soil | PTSTTLPKPPATLSERREDLDRLLRQELESQGIVVGGQAVARVVGAAVGKGIEWQG* |
| Ga0137403_114872222 | 3300015264 | Vadose Zone Soil | TTLPKPPATLSERRDDLDRLLRQELESQGIVVGGQAVARVVGAAVGKGIEWQG* |
| Ga0134085_100982522 | 3300015359 | Grasslands Soil | LLLRHELERQGIVVTGRDVARVVGVAVGKGIEWAG* |
| Ga0134085_103658492 | 3300015359 | Grasslands Soil | SGPPAVRPSLEEQRVDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG* |
| Ga0134069_13919992 | 3300017654 | Grasslands Soil | VPPVAAPSRPLPPLAERRAELDQLLRAELEHQGIVVGGQAVARVVGVAVGKGIEWQA |
| Ga0134083_102307412 | 3300017659 | Grasslands Soil | DLDGRLRAELERQGIVVTGKEVARVVASAVGKGIEWTG |
| Ga0184615_106478472 | 3300018059 | Groundwater Sediment | ASADVHRPATLADRRAELDRLLRAELERQGIVVSGRDVARVVGVAVGKGIEWAG |
| Ga0184637_106177311 | 3300018063 | Groundwater Sediment | ATKPPRPRTLAERRAELDRRLREELERQGLVVTGRDVARVVAVAVGKEIQWAG |
| Ga0184618_102464251 | 3300018071 | Groundwater Sediment | TLAERRAELDRLLRAELERQGIVVSGRDVARVVGVAVGKGIEWAG |
| Ga0066667_100510041 | 3300018433 | Grasslands Soil | QRVDLDRRLRAELERQGLVVTGKEVARVVGVAVGKGIEWTA |
| Ga0193739_10903481 | 3300020003 | Soil | EERRAELDRGLRAELERQGLVVTGADIARVVSAAAGKNITWAG |
| Ga0179592_100785821 | 3300020199 | Vadose Zone Soil | RPPTLAERRAELDRLLREELERQGIIVSGQEVARVVGSAVGKGIEWQA |
| Ga0210378_101028431 | 3300021073 | Groundwater Sediment | VAQPRPPTLADRRAELDRLLHEELERQGIVVSGRDVARVVGSAVGKGIEWAG |
| Ga0210408_112657882 | 3300021178 | Soil | VDVQPSPTSTNLHQPPATLAERRAELDRLLREELERQGIIVSGQEVARVVGSAVGKGIEWQA |
| Ga0137417_14749985 | 3300024330 | Vadose Zone Soil | PSPPPAAGSPRRPSLEEQRIDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG |
| Ga0209640_102738393 | 3300025324 | Soil | PAAAPPRPLDEQRAELDRLLRAELERQGIVVTGKEVARVVGVAVGKGIEWAG |
| Ga0209640_104694362 | 3300025324 | Soil | TLADRRAELDRLLRAELERQGIVVSGRDVARVVGVAVGKGIEWAG |
| Ga0209640_109316782 | 3300025324 | Soil | AAVRPEDRRAELDRLLRIELETQGIVVGGPEVARVVSAATGKSIEWSA |
| Ga0207646_102852542 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PSPTSPTSTNLHPPAATLAERRAELDRLLREELERQGIIVSGQEVARVVGSAVGKGIEWQ |
| Ga0207664_105014681 | 3300025929 | Agricultural Soil | ERRAELDRLLRQELERQGIVVTGRDIARVVGSAVGKGIEWQA |
| Ga0209234_10031501 | 3300026295 | Grasslands Soil | VEEQRAELDRRLRAELERQGIVVTGKEVARVVGVAVGKGIEWAG |
| Ga0209234_13164022 | 3300026295 | Grasslands Soil | DRLLRQELQRQGIVVAGKDIARVVSTAVGKGLEWAG |
| Ga0209235_10735443 | 3300026296 | Grasslands Soil | ITADSRPLPPSLAGRRAELDRLLRQELERQGIVVAGKDIARVVSTAVGKGLEWAG |
| Ga0209235_11873641 | 3300026296 | Grasslands Soil | LPLEEQRVDLDGRLRAELERQGIVVTGKEVARVVGVAVGKGIEWAD |
| Ga0209468_11822511 | 3300026306 | Soil | LDGRLRAELERQGIVVDGKDIARVVGVAVGKGIEWAG |
| Ga0209268_11818731 | 3300026314 | Soil | DRPTPSLAERRAELDELLRRELEHQGIVVKGQDIGRVVGVAAGKGIEWQE |
| Ga0209472_12494061 | 3300026323 | Soil | SLDEQRADLDGRLRAELERQGIVVDGKDIARVVGVAVGKGIEWAG |
| Ga0209470_11307902 | 3300026324 | Soil | SLEEQRVDLDRRLRAELERQGLVVTGKEVARVVGQAVGKGIEWAG |
| Ga0209808_12695371 | 3300026523 | Soil | PAPDRPRPPLEEERIDLDRRLRAELERQGLVVTGKEVARVVGQSVGKGIEWAG |
| Ga0209059_12792332 | 3300026527 | Soil | LEEQRVDLDRRLRAELERQGLVVTGKEVARVVGQSVGKGIEWAG |
| Ga0209807_10357491 | 3300026530 | Soil | PPRPLSTLAERRAELDQLLRAELEHQGIVVGGQEVARVVGVAVGKGIEWQA |
| Ga0209376_14176352 | 3300026540 | Soil | LEERRAELDALLRAELESQGIVVTGHDVARVVGVAAGQRIAWAG |
| Ga0209156_1000196118 | 3300026547 | Soil | PPPTLSDRRAELDGLLRAELEHQGIIVRGQDIARVVGTAVGKGIEWQA |
| Ga0208995_10322252 | 3300027388 | Forest Soil | PPLAERRAELDQLLRRELEHQGIIVGGQAVARVVGAAVGKGIEWQA |
| Ga0208454_11115502 | 3300027573 | Soil | WGGGESPLPSPAPDRPRPPSLEEQQSDLDQKLRDALERQGIVVTGKEVARVVGVAVGKGIEWAG |
| Ga0209466_10525412 | 3300027646 | Tropical Forest Soil | LEEQRDELDRKLRQELERQGIVVTGKEIARVVAASVGKGIEWAG |
| Ga0209178_10773182 | 3300027725 | Agricultural Soil | SPNLPQPPPTLADRRAELDRLLRQELERQGIVVTGRDIARVVGSAVGKGIEWQA |
| Ga0307320_104017341 | 3300028771 | Soil | PATLAERRAELDRLLHEELERQGIVVSGRDVARVVGSAVGKGIEWAG |
| Ga0247727_105022981 | 3300031576 | Biofilm | PSLAERRAELDGLLRAELERQGIVVSGRDVARVVAAAVGKGIEWAG |
| Ga0247727_107189741 | 3300031576 | Biofilm | SERRAELDGMLRAELERQGIVVSGRDVARVVAAAVGKGIEWAD |
| Ga0307479_110313201 | 3300031962 | Hardwood Forest Soil | ERPTGTPERPSVSLAERRAELDELLRRELEGQGLVVTGHEVARVVAAAVGKGIQWMG |
| Ga0326597_102086293 | 3300031965 | Soil | AELDRLLRAELESQGVTVTGNDIARVVSAAVGKGIEWAG |
| Ga0307471_1007085482 | 3300032180 | Hardwood Forest Soil | HPPPPTLSERRAELDRLLRQELERQGIVVTGRDIARVVGSAVGKGIEWQA |
| Ga0307471_1016534881 | 3300032180 | Hardwood Forest Soil | SGDVRRPSALEDQRADLDGRLRAELERQGIVVTGKEVARVVGVAIGKGIEWAG |
| Ga0307471_1029668922 | 3300032180 | Hardwood Forest Soil | SSNLPQPPRTLADRRSELDRLLREELEHQGIVVTGHEIARVVGAAVGKGIEWQA |
| Ga0335077_101632183 | 3300033158 | Soil | DRLLRAELEQQGIVVGGDQVARTVGAAVGKTIEWTP |
| ⦗Top⦘ |