| Basic Information | |
|---|---|
| Family ID | F077152 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKSILYSVCIGSLALALTAGGAQAAKDKRSERAKPQQRSAKVQ |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.46 % |
| % of genes near scaffold ends (potentially truncated) | 96.58 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.325 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.026 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01471 | PG_binding_1 | 22.22 |
| PF10543 | ORF6N | 6.84 |
| PF08031 | BBE | 2.56 |
| PF09957 | VapB_antitoxin | 1.71 |
| PF15937 | PrlF_antitoxin | 1.71 |
| PF02661 | Fic | 1.71 |
| PF01565 | FAD_binding_4 | 1.71 |
| PF01850 | PIN | 1.71 |
| PF12867 | DinB_2 | 0.85 |
| PF08734 | GYD | 0.85 |
| PF07883 | Cupin_2 | 0.85 |
| PF01192 | RNA_pol_Rpb6 | 0.85 |
| PF13371 | TPR_9 | 0.85 |
| PF02452 | PemK_toxin | 0.85 |
| PF00701 | DHDPS | 0.85 |
| PF00248 | Aldo_ket_red | 0.85 |
| PF09900 | DUF2127 | 0.85 |
| PF15919 | HicB_lk_antitox | 0.85 |
| PF14237 | GYF_2 | 0.85 |
| PF03681 | Obsolete Pfam Family | 0.85 |
| PF05016 | ParE_toxin | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 2.56 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.71 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.85 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.85 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.32 % |
| Unclassified | root | N/A | 13.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02IFH0H | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 556 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig933372 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
| 2189573004|GZGWRS401EQCYZ | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1074303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 598 | Open in IMG/M |
| 3300000955|JGI1027J12803_109531979 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 597 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10005280 | Not Available | 2093 | Open in IMG/M |
| 3300004114|Ga0062593_101656704 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 697 | Open in IMG/M |
| 3300004479|Ga0062595_101968292 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300004643|Ga0062591_101260996 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 724 | Open in IMG/M |
| 3300004643|Ga0062591_102687282 | Not Available | 526 | Open in IMG/M |
| 3300005171|Ga0066677_10655710 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005187|Ga0066675_10400941 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1013 | Open in IMG/M |
| 3300005290|Ga0065712_10266933 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_3_54_17 | 924 | Open in IMG/M |
| 3300005295|Ga0065707_10538828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 729 | Open in IMG/M |
| 3300005329|Ga0070683_100278352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1592 | Open in IMG/M |
| 3300005338|Ga0068868_102239427 | Not Available | 521 | Open in IMG/M |
| 3300005354|Ga0070675_100340790 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1328 | Open in IMG/M |
| 3300005367|Ga0070667_100468916 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1152 | Open in IMG/M |
| 3300005554|Ga0066661_10063256 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300005586|Ga0066691_10085771 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1750 | Open in IMG/M |
| 3300005586|Ga0066691_10339965 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 888 | Open in IMG/M |
| 3300005719|Ga0068861_100495107 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300005841|Ga0068863_100432154 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1291 | Open in IMG/M |
| 3300006755|Ga0079222_11015956 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 715 | Open in IMG/M |
| 3300006806|Ga0079220_11937561 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 524 | Open in IMG/M |
| 3300006854|Ga0075425_102752755 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300006880|Ga0075429_101844229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
| 3300006904|Ga0075424_101951410 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 620 | Open in IMG/M |
| 3300007788|Ga0099795_10373356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 642 | Open in IMG/M |
| 3300009038|Ga0099829_10470640 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300009137|Ga0066709_104481788 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300009177|Ga0105248_11092968 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 901 | Open in IMG/M |
| 3300009553|Ga0105249_13210773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 3300010040|Ga0126308_10192483 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1308 | Open in IMG/M |
| 3300010325|Ga0134064_10246154 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 660 | Open in IMG/M |
| 3300010326|Ga0134065_10433931 | Not Available | 534 | Open in IMG/M |
| 3300010333|Ga0134080_10163228 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300010335|Ga0134063_10277502 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 802 | Open in IMG/M |
| 3300010359|Ga0126376_12865218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
| 3300010362|Ga0126377_10637925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1113 | Open in IMG/M |
| 3300010371|Ga0134125_12077225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 618 | Open in IMG/M |
| 3300010398|Ga0126383_10158335 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2122 | Open in IMG/M |
| 3300011000|Ga0138513_100029589 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012203|Ga0137399_10337027 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1251 | Open in IMG/M |
| 3300012210|Ga0137378_11183248 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012353|Ga0137367_10506844 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300012362|Ga0137361_10455737 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1174 | Open in IMG/M |
| 3300012925|Ga0137419_11643528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300012948|Ga0126375_11520282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300012958|Ga0164299_10410261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 873 | Open in IMG/M |
| 3300012971|Ga0126369_12547015 | Not Available | 597 | Open in IMG/M |
| 3300012988|Ga0164306_10605550 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 859 | Open in IMG/M |
| 3300012988|Ga0164306_12033808 | Not Available | 500 | Open in IMG/M |
| 3300014325|Ga0163163_12911469 | Not Available | 534 | Open in IMG/M |
| 3300015054|Ga0137420_1066163 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 594 | Open in IMG/M |
| 3300015357|Ga0134072_10042325 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1237 | Open in IMG/M |
| 3300015371|Ga0132258_11655375 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300015372|Ga0132256_101402535 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 810 | Open in IMG/M |
| 3300015373|Ga0132257_104627588 | Not Available | 501 | Open in IMG/M |
| 3300016404|Ga0182037_10181474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1616 | Open in IMG/M |
| 3300016445|Ga0182038_10064290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2516 | Open in IMG/M |
| 3300017656|Ga0134112_10353982 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 599 | Open in IMG/M |
| 3300018056|Ga0184623_10215533 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300018071|Ga0184618_10410192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300018074|Ga0184640_10532740 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300018482|Ga0066669_12057751 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 3300019865|Ga0193748_1009175 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300019874|Ga0193744_1036340 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300019878|Ga0193715_1037345 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1050 | Open in IMG/M |
| 3300019879|Ga0193723_1078092 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 951 | Open in IMG/M |
| 3300019881|Ga0193707_1128882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 729 | Open in IMG/M |
| 3300019996|Ga0193693_1003311 | All Organisms → cellular organisms → Bacteria | 3656 | Open in IMG/M |
| 3300020004|Ga0193755_1075774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1083 | Open in IMG/M |
| 3300020062|Ga0193724_1114391 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300021560|Ga0126371_10497272 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300022534|Ga0224452_1081520 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 981 | Open in IMG/M |
| 3300022756|Ga0222622_11313254 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300025921|Ga0207652_10758980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 863 | Open in IMG/M |
| 3300025927|Ga0207687_10957711 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 733 | Open in IMG/M |
| 3300025930|Ga0207701_10280281 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1450 | Open in IMG/M |
| 3300025930|Ga0207701_11598745 | Not Available | 525 | Open in IMG/M |
| 3300025933|Ga0207706_11357777 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300025939|Ga0207665_11464649 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300025972|Ga0207668_11803498 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
| 3300025981|Ga0207640_10877122 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 782 | Open in IMG/M |
| 3300026023|Ga0207677_12304031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300026088|Ga0207641_10636698 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 1046 | Open in IMG/M |
| 3300026116|Ga0207674_10594195 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1069 | Open in IMG/M |
| 3300026306|Ga0209468_1178867 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300026330|Ga0209473_1213417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 718 | Open in IMG/M |
| 3300026530|Ga0209807_1326828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 521 | Open in IMG/M |
| 3300026540|Ga0209376_1218947 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300026542|Ga0209805_1204520 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 846 | Open in IMG/M |
| 3300026547|Ga0209156_10415417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 560 | Open in IMG/M |
| 3300027050|Ga0209325_1044530 | Not Available | 537 | Open in IMG/M |
| 3300028379|Ga0268266_11786068 | Not Available | 590 | Open in IMG/M |
| 3300028380|Ga0268265_12143777 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 566 | Open in IMG/M |
| 3300028793|Ga0307299_10374783 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300030945|Ga0075373_10053635 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1957 | Open in IMG/M |
| 3300031057|Ga0170834_102832823 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 648 | Open in IMG/M |
| 3300031122|Ga0170822_14046079 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 640 | Open in IMG/M |
| 3300031231|Ga0170824_114588386 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300031446|Ga0170820_12688492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 893 | Open in IMG/M |
| 3300031446|Ga0170820_17450636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 586 | Open in IMG/M |
| 3300031446|Ga0170820_17451711 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 936 | Open in IMG/M |
| 3300031474|Ga0170818_100290499 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 881 | Open in IMG/M |
| 3300031474|Ga0170818_111619076 | Not Available | 715 | Open in IMG/M |
| 3300031716|Ga0310813_11922116 | Not Available | 557 | Open in IMG/M |
| 3300031854|Ga0310904_11321536 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300031939|Ga0308174_10843376 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 772 | Open in IMG/M |
| 3300031946|Ga0310910_10235996 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300032180|Ga0307471_101812829 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300032205|Ga0307472_100082932 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300034354|Ga0364943_0082599 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 8.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_04368580 | 2065487018 | Soil | MGKGKTMEGKNMKSILYSVCIGILALALTAGGAQAAKDKRPERAKPQQRSAKVQAARPANTGRT |
| KansclcFeb2_04808810 | 2124908045 | Soil | MKRILYSVCIGSLALALTASAAQDNKRKSERTRPQHRTATVQTARP |
| FG2_07450440 | 2189573004 | Grass Soil | MKSILYSVCIGSLALALTAGGAQAATQKRTERAKPQQ |
| AF_2010_repII_A100DRAFT_10743031 | 3300000655 | Forest Soil | MKSILYSALVGTLALALASGGAQAAKDNNKRSQRAQPQQRT |
| JGI1027J12803_1095319792 | 3300000955 | Soil | MKSILYSVCIGGVALAFTAVGAQAATDKRPERAKPQ |
| JGIcombinedJ43975_100052801 | 3300002899 | Soil | MKRILYSVCIGICALALTAGGAEAAKDKDKRSERAKAQQRTAKVHA |
| Ga0062593_1016567041 | 3300004114 | Soil | MEGNMKRILYSVCIGSLALALTTGGAQAARDKRPERSRPQQRTAAVHAARPANTGRTMN |
| Ga0062595_1019682921 | 3300004479 | Soil | MENEGKNMKSILYSVCIGSLALALTAGAAQDKRAERARPQQRAANVHAARPANTGRTM |
| Ga0062591_1012609962 | 3300004643 | Soil | MEGNTMRKIIYSVCIGSLALALTAWGAQNNNRKPERARPQHRTANVHAARPANTHATMAARH* |
| Ga0062591_1026872821 | 3300004643 | Soil | MKAILYSVCIGSLALVVTVGRAQAATEKEKRAPSAKPQQRSA |
| Ga0066677_106557101 | 3300005171 | Soil | MKSILYSVCIGTLGLALTAGGAQADKDKRSERAKPQQRSAKVQAARPA |
| Ga0066675_104009412 | 3300005187 | Soil | MKSILYSVCIGSLALALTAGGAQADKDKRSERAKPQQRSAKVQAARPANT |
| Ga0065712_102669331 | 3300005290 | Miscanthus Rhizosphere | MKSILYSALVGSLALALATGGAQAAKDNNKRSQRAQPQQRSANVHAARPANTGR |
| Ga0065707_105388283 | 3300005295 | Switchgrass Rhizosphere | MKRVLYSVCIGSLALALTAGGAQAATEKRPERAKPQQRAAK |
| Ga0070683_1002783523 | 3300005329 | Corn Rhizosphere | MKSILYSACIGTLALALTAGGAQAATDKNKRQERAKPQQRSANVQAAKPAN |
| Ga0068868_1022394271 | 3300005338 | Miscanthus Rhizosphere | MKSILYSACIGTLALALTPGGAQAATDKNKRQERAKPQQRTAHVQAA |
| Ga0070675_1003407903 | 3300005354 | Miscanthus Rhizosphere | MKSILYSACIGTLALALTAGGAQAATDKNKRQERAKPQHRSANVQVAKPANTGRSMA |
| Ga0070667_1004689161 | 3300005367 | Switchgrass Rhizosphere | MEGNMKRILYSACVGSLALALTAGGAQAARDKQPERSRPQQRTATVHAARPANTGRAMT |
| Ga0066661_100632561 | 3300005554 | Soil | MKSILYSVCIGSLALALTAGGAQADKDKRSERAKPQQRSAKVQAARPANTGGTMSARRN |
| Ga0066691_100857712 | 3300005586 | Soil | MKSILYSVCIGSLALALTAGGAQAPKDKRSERAKPQQRSAKVQA |
| Ga0066691_103399652 | 3300005586 | Soil | MKSILYSVCIGSLALALTAGGAQADKDKRSERAKPQQRSAKVQAARPANTG |
| Ga0068861_1004951073 | 3300005719 | Switchgrass Rhizosphere | MKSILYSVCIGTLALALTTGGAQAAKEKRTERAKPQQRSVKVQAARPANTG |
| Ga0068863_1004321541 | 3300005841 | Switchgrass Rhizosphere | MKSILYSACIGTLALALTAGGAQAATDKNKRQERAKPQHRSANVQVAKPANTGRSMAAHR |
| Ga0079222_110159562 | 3300006755 | Agricultural Soil | MRRIINSVCIGTLALALTAGAAQDRDKRSERAKPQQRTAKVHAARP |
| Ga0079220_119375611 | 3300006806 | Agricultural Soil | MKSILYLVCIGSLALALTAGAAQDKRAERARPQQRAANVHAA |
| Ga0075425_1027527551 | 3300006854 | Populus Rhizosphere | MEMRENMKRILYSVCIGSLALALTAAAAQDNKRKSERTRPQHRTATVQTARPANTGRS |
| Ga0075429_1018442291 | 3300006880 | Populus Rhizosphere | MKSILYSVVIGSLALALTTGAVQGATDKNKRQEKAKPQH |
| Ga0075424_1019514101 | 3300006904 | Populus Rhizosphere | MKAILYSVCIGSLALAVAAGGAQAATDKDKRQQRAKPQPRSANVQARP |
| Ga0099795_103733563 | 3300007788 | Vadose Zone Soil | MKRVLYSVCIGSLALALTAGAANDNKRKPETASPQHRTA |
| Ga0099829_104706403 | 3300009038 | Vadose Zone Soil | MKRVLYSVCIGSLALALTAGAAQDKRSEKARPQHRTANVHAARPANTGGMM |
| Ga0066709_1044817881 | 3300009137 | Grasslands Soil | MEMRENMKSILYSACIGTLALVLTTGGAQAAKDKRSERATPQHRSAAVHT |
| Ga0105248_110929682 | 3300009177 | Switchgrass Rhizosphere | MEKGKTMEGKIMKRILYSVCIGTIALALTAGGAQAATDNNKRQARTKPQQRSA |
| Ga0105249_132107731 | 3300009553 | Switchgrass Rhizosphere | MKSILYSVCIGTLALALTTGGAQAATDKRTGKAKPQQRP |
| Ga0126308_101924831 | 3300010040 | Serpentine Soil | MKSILYSICIGSVALTLTAVGAQAATDKRSEKAKPQQRTAKVQAARPANTGR |
| Ga0134064_102461541 | 3300010325 | Grasslands Soil | MKSILYSVCIGSLALALTAGGAQAAKDKRSERAKP |
| Ga0134065_104339311 | 3300010326 | Grasslands Soil | MKRVVYSLCIGSLALALTSGGAQAATERPERAKQQHRSA |
| Ga0134080_101632281 | 3300010333 | Grasslands Soil | MKSILYSVCIGSLALALTAGGAQAPKDKRSERAKPQQRSAKVQAARPANT |
| Ga0134063_102775021 | 3300010335 | Grasslands Soil | MKSILYSLCIGSLALALTAGGAQAARDKRSDNAKPQQR |
| Ga0126376_128652182 | 3300010359 | Tropical Forest Soil | MEKRGKNMKSILYSVCIGSLALALTAGAQQYNDKKPQRAKPQQR |
| Ga0126377_106379251 | 3300010362 | Tropical Forest Soil | MKSILYSVCIGSLALALTAGGAQAATDKNKRQERAKPLHRTANVQAARPANTGRSMAA |
| Ga0134125_120772252 | 3300010371 | Terrestrial Soil | MEKGNSGGKNMKSILYSTCIGTLALALTAGGAQAATDKNKRQERAKPQHRTANVQATRPA |
| Ga0126383_101583351 | 3300010398 | Tropical Forest Soil | MKSILYSVCVGTVAVALTAGGAQAATDKDKRAERAKP |
| Ga0138513_1000295892 | 3300011000 | Soil | MKRVLYSVCIGILALALTAGAAQDTKRKSERARPQHRTANVHAARPAKP |
| Ga0137399_103370272 | 3300012203 | Vadose Zone Soil | MYSVCIGSLALALTAGGAQADKDKRSERAKPQQRSAKVQAARPANTG |
| Ga0137378_111832482 | 3300012210 | Vadose Zone Soil | MKRVLYSVCIGSLALALTAGAAQDNKKKPERARLQHRTA |
| Ga0137367_105068441 | 3300012353 | Vadose Zone Soil | MKRVLYSVCIGSLALALTAGAAQDKRSERARPQHRTANVHAARPANTGGTISTHRNVS |
| Ga0137361_104557373 | 3300012362 | Vadose Zone Soil | MKSILYSVCIGSLALALTAGGAQADKDKRSERAKPQQRSAKVQAA |
| Ga0137419_116435281 | 3300012925 | Vadose Zone Soil | MKSILYSVCIGSLALALTAGGAQADKDKRSERAKPQQRSAKVQAARPVNTGGTMSA |
| Ga0126375_115202821 | 3300012948 | Tropical Forest Soil | MKRILYSVCIGSLALALTAAAAQDNKRKSERTRPQHRTATVQTARPVNT |
| Ga0164299_104102611 | 3300012958 | Soil | MKSILHSVCIGSLALALTAGAAQAATENRPERAKPQQR |
| Ga0126369_125470151 | 3300012971 | Tropical Forest Soil | MKGKTMRRIIYSVCIGSLALALTAGAQQVNDRKPERAKQQA |
| Ga0164306_106055502 | 3300012988 | Soil | MKSILYSICIGSLALALTAEGAQAAKDKRPERAKPQQRTANVQAARPANTGRT |
| Ga0164306_120338081 | 3300012988 | Soil | MENMEGNMKRILYSACVGSLALALTAGGAQAARDKRPERSRPQQRTA |
| Ga0163163_129114691 | 3300014325 | Switchgrass Rhizosphere | MKSILYSICIGTVALALTVVGAQGATDKNKRQERAKPQPRSAHPAAAARPANTTRTMS |
| Ga0137420_10661631 | 3300015054 | Vadose Zone Soil | MQFGLTCKMENEGKIMKSILYSVCIGSVALALTAVGAQAATERRTERAKPQQRTAKVQAARPTN |
| Ga0134072_100423251 | 3300015357 | Grasslands Soil | MKRVLYSVCIGSLALALTAGAAQDNKKKPERARPQHRTANVLVARPANTGATMSAHRNVS |
| Ga0132258_116553753 | 3300015371 | Arabidopsis Rhizosphere | MRKGKNMKSILYSALVGTLALALATGGAQAATDKNKRQERVKPQQ |
| Ga0132256_1014025352 | 3300015372 | Arabidopsis Rhizosphere | MKRILYSVCIGSLALALTAGAAQDNKKKPERARPQHGT |
| Ga0132257_1046275881 | 3300015373 | Arabidopsis Rhizosphere | MKRVLYSACIGSLALALTAGAQQINDRRAERARPQQRRATVQTARFGNTGSVRS |
| Ga0182032_120402011 | 3300016357 | Soil | MKSILYSVLVGTLALALATGRAQAATDNNKRSQRAQPQQRSANVHAARPVTAARPAVNPA |
| Ga0182037_101814744 | 3300016404 | Soil | MKSILYSVCIGILALALTGAGAQAATDKNKRQERAKPQQRS |
| Ga0182039_101026165 | 3300016422 | Soil | MKSILYSVCIGILALALAGAGAQAATDKDKRPERAKPQQRSAKVQPARPATAARPASAMPAT |
| Ga0182038_100642901 | 3300016445 | Soil | MKSILYSVCIGILALSLTGAGAQAATDKNKRQERAKPQQRSAKVQPARP |
| Ga0134112_103539821 | 3300017656 | Grasslands Soil | MKSILYSVCIGSLALALTAGGAQAAKDKRSERAKPQQRSAKVQ |
| Ga0184623_102155332 | 3300018056 | Groundwater Sediment | MKSILYSVCIGILALALTAGAAQAAKDKRPERAKPQQRSAKVQAA |
| Ga0184618_104101922 | 3300018071 | Groundwater Sediment | MEKRENHGGKIMKRILYSVCIGSLALALTAGAAQDNKRKPERAKPQHRTANVHAA |
| Ga0184640_105327402 | 3300018074 | Groundwater Sediment | MKRVLYSVCIGSLALALTAGAAQDNKRKSERARPQHRTANVHAARPANTGRAMSAH |
| Ga0066669_120577512 | 3300018482 | Grasslands Soil | MEKEGKTMRRIIYSVCIGSLALALTAGAQQVNVRKPERAKPQARTANVHAARPTNSG |
| Ga0193748_10091751 | 3300019865 | Soil | MEKGKTMEGKIMKRVLYSVCIGSLALALTAGAANDNKRKPERASPQHRTANVQAARPAN |
| Ga0193744_10363402 | 3300019874 | Soil | MKSILYSVCIASLALALTAGAANDNKRKPERASPQHRTANVHAARPANTGRTMSAH |
| Ga0193715_10373452 | 3300019878 | Soil | MKRVLYSVCVGSLALALTAGAAQDNKKKPERARPQHRTANVHAAR |
| Ga0193723_10780922 | 3300019879 | Soil | MKSILYSICIGSLALALTAGAAQAATEKRPERAKPPQRTAKVQTARPAN |
| Ga0193707_11288821 | 3300019881 | Soil | MEKRENHGGKIMKRILYSVCIGSLALALTAGAAQDNKRKSER |
| Ga0193693_10033115 | 3300019996 | Soil | MKSILHSVCIGSLALALTAGAAQSATEKRPERAKPQQRTAKVQTARPA |
| Ga0193755_10757742 | 3300020004 | Soil | MKRVLYSVCIGSLALALTAGAAQDNKRKPERAKPQHRT |
| Ga0193724_11143911 | 3300020062 | Soil | MKRILYSVCIGSLALALTAGAAQDNKKKPERARPQH |
| Ga0126371_104972721 | 3300021560 | Tropical Forest Soil | MKAILYSVCVGTLAVALTAGGAQAATDKNKRRERAKPQH |
| Ga0224452_10815201 | 3300022534 | Groundwater Sediment | MKSILYSVCIGSLALALTAGAAQDNKKKPERARPQHR |
| Ga0222622_113132541 | 3300022756 | Groundwater Sediment | MKRVLYSVCIGSLALALTAGAAQDNKKKPERARPQ |
| Ga0207652_107589801 | 3300025921 | Corn Rhizosphere | MKSILYSACIGTLALALTAGGAQAAKDKRTERAKPQQRSTK |
| Ga0207687_109577111 | 3300025927 | Miscanthus Rhizosphere | MENWEGKNMKSILYSACIGTLALALTAGGAQAATDKNKRQERAKPQHRSANVQVAKP |
| Ga0207701_102802811 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSILYSVCIGSLALAVAAGGTQAATDNDQRSKKAKPQQRSAKVQP |
| Ga0207701_115987451 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MENMEGNMKRILYSACVGSLALALTAGGAQAARDKRPERSRPQQRTATVHAARPANTG |
| Ga0207706_113577771 | 3300025933 | Corn Rhizosphere | MKSILYSVCIGTLALALTAGGAQAATDKRSEKAKPQQRSAKVQAAR |
| Ga0207665_114646492 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSILYSVCIGSLALALTAGGAQAAKDKRSERAKPQQRTANVHAARPANTGR |
| Ga0207668_118034981 | 3300025972 | Switchgrass Rhizosphere | MKSILYSVCIGTLALALTTGGAQAATDKRTGKAKPQQRPAKVQA |
| Ga0207640_108771222 | 3300025981 | Corn Rhizosphere | MKTILYTICIGSLALTLTAGGAQAAKNKQPERAKPQQRTAKVQPARP |
| Ga0207677_123040312 | 3300026023 | Miscanthus Rhizosphere | MKSILYSVCIGSLALALTAGGAQAAKDKRLERAKPQQR |
| Ga0207641_106366982 | 3300026088 | Switchgrass Rhizosphere | MKSILYSACIGTLALALTAGGAQAATDKNKRQERAKPQH |
| Ga0207674_105941951 | 3300026116 | Corn Rhizosphere | MKSILYSACIGTLALALTAGGAQAATDKNKRQERAKPQQRSANVQAAKPANTGRSMAAH |
| Ga0209468_11788671 | 3300026306 | Soil | MKSILYSVCIGSLALALTAGGAQAARDKRSDNAKPQQRSAKVQAARPANTGRSMS |
| Ga0209473_12134171 | 3300026330 | Soil | MKSILYSVCIGTLGLALTAGGAQADKDKRSERAKPQQRSAKIQAA |
| Ga0209807_13268282 | 3300026530 | Soil | MEKEGKTMRRIIYSVCIGSLALALTAGAQQVNDRKPERAKPQA |
| Ga0209376_12189471 | 3300026540 | Soil | MEKEGKTMRRIIYSVCIGSLALALTAGAQQVNDRKPERAKPQARTA |
| Ga0209805_12045202 | 3300026542 | Soil | MKSILYSVCIGTLALALTAGGAQADKDKRSERAKPQQRSAKVQAARPANTGATMSARRNA |
| Ga0209156_104154171 | 3300026547 | Soil | MKPILYSVCIGSLALALTAGAAQAATDKRPERAKPQHRSANVQTAGPANAGRTVSAHRDV |
| Ga0209325_10445301 | 3300027050 | Forest Soil | MKAIGYSIVIGSLALALTAGAQQTRDRRPEKAKAQQRSANGHAARPANTHANMGARH |
| Ga0268266_117860682 | 3300028379 | Switchgrass Rhizosphere | MENMEGNMKRILYSVCVGTLALTLTAGGAQAARDKRPER |
| Ga0268265_121437771 | 3300028380 | Switchgrass Rhizosphere | MKSILYSACIGTLALALTAGGAQAATDKNKRQERAKPQHRSANVQVAKPANTGGSMAAHR |
| Ga0307299_103747831 | 3300028793 | Soil | MKRVLYSVCIGSLALALTAGAAQDNKKKAERARPQHR |
| Ga0075373_100536351 | 3300030945 | Soil | MKSILYSICIGSLALALTAGAAQAATEKRPERAKPQQRTANVQAARPANTGRTMSVHR |
| Ga0170834_1028328231 | 3300031057 | Forest Soil | MKTILNTVCIGSLALALTAGGAQAAKDKGPERAKPQQRTAKVQPARPASAGRTMAE |
| Ga0170822_140460792 | 3300031122 | Forest Soil | MKTILYTVCIGSLALALTAGGAQAAKDKGPERAKPQQRTAKVQP |
| Ga0170824_1056829682 | 3300031231 | Forest Soil | MKSILYLVCVGTLALALAAGGAQTATDKNKHQERAKPQQRSAKVQTARPATAARPASAMPAT |
| Ga0170824_1145883863 | 3300031231 | Forest Soil | MKRVLYSVCIGSLALALTAGAANDNERKPERASPQHRTANVHAATPANTGR |
| Ga0170820_126884922 | 3300031446 | Forest Soil | MKTILYTVCIGSLALALTAGGAQAAKDKGPERAKPQQRTAK |
| Ga0170820_174506362 | 3300031446 | Forest Soil | MKSILYSVCIGSLAVVLAAGGAQAATNKRPERAKPQARTAKVQAARPANTGRT |
| Ga0170820_174517113 | 3300031446 | Forest Soil | MKRVLYSVCIGSLALALTAGAANDNKRKPERTSPQHRTANVHAARPANTGRT |
| Ga0170818_1002904993 | 3300031474 | Forest Soil | MKRVLYSVCIGSLALALTAGAANDNKRKPERAKPQQRTAKVQAARPAN |
| Ga0170818_1116190762 | 3300031474 | Forest Soil | MKSILYLVCVGTLALALAAGGAQAATEKEKRAQSAKPQQRSA |
| Ga0310813_119221161 | 3300031716 | Soil | MKSILYSACIGTLALALTAGGAQAATDKNKRQERAKPHQRSANVHAARPANAG |
| Ga0310904_113215362 | 3300031854 | Soil | MKSILYSVCIGSLALALTTGGAQAAKDKRTERAKPQQ |
| Ga0308174_108433761 | 3300031939 | Soil | MKTILYTICIGSLALALTAGGAQAAKNKQLERAKPQQRTAKVQPARP |
| Ga0310910_102359964 | 3300031946 | Soil | MKSILYSVCIGILALSLTGAGAQAATDKNKRQERAKPQQ |
| Ga0307471_1018128291 | 3300032180 | Hardwood Forest Soil | MKRVLYSVCIGSLALALTAGAAQDKKSERARPQHRTANVHAARPANTGATTRAR |
| Ga0307472_1000829321 | 3300032205 | Hardwood Forest Soil | MKSILYSVCIGILALALTAGGTQAAKDKRPERAKPQQGSAKVQAAR |
| Ga0364943_0082599_1_135 | 3300034354 | Sediment | MKSILYSVCIGILALALTAGAAQDNKRKPERAKPQHRTANVHAAR |
| ⦗Top⦘ |