| Basic Information | |
|---|---|
| Family ID | F077127 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSS |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.82 % |
| % of genes near scaffold ends (potentially truncated) | 27.35 % |
| % of genes from short scaffolds (< 2000 bps) | 91.45 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.991 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (9.402 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.513 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.991 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.56% β-sheet: 0.00% Coil/Unstructured: 47.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00476 | DNA_pol_A | 5.13 |
| PF13469 | Sulfotransfer_3 | 5.13 |
| PF09861 | Lar_N | 0.85 |
| PF00575 | S1 | 0.85 |
| PF12802 | MarR_2 | 0.85 |
| PF01464 | SLT | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 5.13 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.99 % |
| Unclassified | root | N/A | 47.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_101144374 | Not Available | 841 | Open in IMG/M |
| 3300000956|JGI10216J12902_106614665 | Not Available | 1004 | Open in IMG/M |
| 3300002568|C688J35102_119941610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
| 3300002568|C688J35102_120492099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1114 | Open in IMG/M |
| 3300002568|C688J35102_120870956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1925 | Open in IMG/M |
| 3300002568|C688J35102_120880192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1984 | Open in IMG/M |
| 3300003324|soilH2_10000653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3870 | Open in IMG/M |
| 3300004081|Ga0063454_101752920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300004114|Ga0062593_101715536 | Not Available | 687 | Open in IMG/M |
| 3300004153|Ga0063455_100802640 | Not Available | 652 | Open in IMG/M |
| 3300004157|Ga0062590_102103250 | Not Available | 588 | Open in IMG/M |
| 3300004479|Ga0062595_100465196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
| 3300004479|Ga0062595_102204270 | Not Available | 540 | Open in IMG/M |
| 3300004479|Ga0062595_102389457 | Not Available | 524 | Open in IMG/M |
| 3300004480|Ga0062592_101128976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300004480|Ga0062592_102233089 | Not Available | 546 | Open in IMG/M |
| 3300004643|Ga0062591_100923091 | Not Available | 821 | Open in IMG/M |
| 3300005171|Ga0066677_10218274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
| 3300005186|Ga0066676_10155154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1443 | Open in IMG/M |
| 3300005186|Ga0066676_10484341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 839 | Open in IMG/M |
| 3300005329|Ga0070683_100548797 | Not Available | 1105 | Open in IMG/M |
| 3300005332|Ga0066388_101895162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300005343|Ga0070687_100673690 | Not Available | 719 | Open in IMG/M |
| 3300005437|Ga0070710_11435566 | Not Available | 517 | Open in IMG/M |
| 3300005440|Ga0070705_100332863 | Not Available | 1100 | Open in IMG/M |
| 3300005458|Ga0070681_10114150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2640 | Open in IMG/M |
| 3300005526|Ga0073909_10719892 | Not Available | 502 | Open in IMG/M |
| 3300005532|Ga0070739_10003250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20548 | Open in IMG/M |
| 3300005540|Ga0066697_10104153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1656 | Open in IMG/M |
| 3300005545|Ga0070695_101651255 | Not Available | 536 | Open in IMG/M |
| 3300005546|Ga0070696_100382589 | Not Available | 1097 | Open in IMG/M |
| 3300005554|Ga0066661_10747441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300005576|Ga0066708_10254195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1117 | Open in IMG/M |
| 3300005616|Ga0068852_100598077 | Not Available | 1107 | Open in IMG/M |
| 3300005764|Ga0066903_101405155 | Not Available | 1311 | Open in IMG/M |
| 3300005764|Ga0066903_105231253 | Not Available | 686 | Open in IMG/M |
| 3300005764|Ga0066903_107824257 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005834|Ga0068851_10794019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300005900|Ga0075272_1074826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300006046|Ga0066652_100106663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2271 | Open in IMG/M |
| 3300006046|Ga0066652_100320243 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300006058|Ga0075432_10051967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1447 | Open in IMG/M |
| 3300006791|Ga0066653_10388648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
| 3300006800|Ga0066660_11306785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300006804|Ga0079221_10271580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
| 3300006806|Ga0079220_10173067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1217 | Open in IMG/M |
| 3300006806|Ga0079220_11250162 | Not Available | 618 | Open in IMG/M |
| 3300006854|Ga0075425_101687806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
| 3300006854|Ga0075425_101762317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300006854|Ga0075425_101997121 | Not Available | 649 | Open in IMG/M |
| 3300009093|Ga0105240_10398041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1552 | Open in IMG/M |
| 3300009137|Ga0066709_100299938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2181 | Open in IMG/M |
| 3300009137|Ga0066709_102293616 | Not Available | 740 | Open in IMG/M |
| 3300009545|Ga0105237_10779861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300010333|Ga0134080_10198941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300010371|Ga0134125_11502646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300010373|Ga0134128_10237468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2046 | Open in IMG/M |
| 3300010373|Ga0134128_10439640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1456 | Open in IMG/M |
| 3300010375|Ga0105239_11674397 | Not Available | 736 | Open in IMG/M |
| 3300010396|Ga0134126_11318012 | Not Available | 799 | Open in IMG/M |
| 3300012198|Ga0137364_10152815 | Not Available | 1670 | Open in IMG/M |
| 3300012200|Ga0137382_10033879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3078 | Open in IMG/M |
| 3300012200|Ga0137382_10572731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300012208|Ga0137376_10856915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300012210|Ga0137378_11770529 | Not Available | 522 | Open in IMG/M |
| 3300012211|Ga0137377_11160242 | Not Available | 702 | Open in IMG/M |
| 3300012212|Ga0150985_110839279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300012212|Ga0150985_117671183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300012951|Ga0164300_10132630 | Not Available | 1143 | Open in IMG/M |
| 3300012957|Ga0164303_10391417 | Not Available | 855 | Open in IMG/M |
| 3300012958|Ga0164299_11269983 | Not Available | 561 | Open in IMG/M |
| 3300012958|Ga0164299_11299340 | Not Available | 556 | Open in IMG/M |
| 3300012984|Ga0164309_11161575 | Not Available | 645 | Open in IMG/M |
| 3300012984|Ga0164309_11805944 | Not Available | 524 | Open in IMG/M |
| 3300012985|Ga0164308_10470076 | Not Available | 1045 | Open in IMG/M |
| 3300012985|Ga0164308_12202624 | Not Available | 513 | Open in IMG/M |
| 3300013105|Ga0157369_11259834 | Not Available | 754 | Open in IMG/M |
| 3300014166|Ga0134079_10746425 | Not Available | 504 | Open in IMG/M |
| 3300014497|Ga0182008_10236726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
| 3300015372|Ga0132256_100741311 | Not Available | 1098 | Open in IMG/M |
| 3300018433|Ga0066667_10286550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300018433|Ga0066667_10725872 | Not Available | 836 | Open in IMG/M |
| 3300018482|Ga0066669_10614707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
| 3300019361|Ga0173482_10035006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1545 | Open in IMG/M |
| 3300020069|Ga0197907_11269122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1304 | Open in IMG/M |
| 3300020075|Ga0206349_1695839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300020081|Ga0206354_10326249 | Not Available | 562 | Open in IMG/M |
| 3300020081|Ga0206354_11561831 | Not Available | 916 | Open in IMG/M |
| 3300020082|Ga0206353_11073916 | Not Available | 526 | Open in IMG/M |
| 3300021445|Ga0182009_10091972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1369 | Open in IMG/M |
| 3300022467|Ga0224712_10389942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300023077|Ga0247802_1061467 | Not Available | 608 | Open in IMG/M |
| 3300024055|Ga0247794_10126243 | Not Available | 782 | Open in IMG/M |
| 3300025912|Ga0207707_10750534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
| 3300025912|Ga0207707_11584803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300025915|Ga0207693_10841565 | Not Available | 706 | Open in IMG/M |
| 3300025917|Ga0207660_10067310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2594 | Open in IMG/M |
| 3300025918|Ga0207662_10598314 | Not Available | 767 | Open in IMG/M |
| 3300025920|Ga0207649_11117415 | Not Available | 622 | Open in IMG/M |
| 3300025927|Ga0207687_10210999 | Not Available | 1523 | Open in IMG/M |
| 3300025939|Ga0207665_11145484 | Not Available | 620 | Open in IMG/M |
| 3300026078|Ga0207702_11273804 | Not Available | 729 | Open in IMG/M |
| 3300026301|Ga0209238_1122473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 853 | Open in IMG/M |
| 3300027773|Ga0209810_1002688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20549 | Open in IMG/M |
| 3300027821|Ga0209811_10025020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1970 | Open in IMG/M |
| 3300027907|Ga0207428_11250939 | Not Available | 515 | Open in IMG/M |
| 3300028705|Ga0307276_10090233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300031226|Ga0307497_10137938 | Not Available | 999 | Open in IMG/M |
| 3300031938|Ga0308175_100028734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4562 | Open in IMG/M |
| 3300031938|Ga0308175_100378273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1472 | Open in IMG/M |
| 3300031938|Ga0308175_101223396 | Not Available | 835 | Open in IMG/M |
| 3300031938|Ga0308175_101828350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
| 3300031938|Ga0308175_102533147 | Not Available | 574 | Open in IMG/M |
| 3300031939|Ga0308174_10594281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300031939|Ga0308174_10690582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
| 3300031996|Ga0308176_10320428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1518 | Open in IMG/M |
| 3300032074|Ga0308173_11837180 | Not Available | 571 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 5.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.13% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1011443741 | 3300000956 | Soil | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRE |
| JGI10216J12902_1066146652 | 3300000956 | Soil | MLDWIWIPALYVLAFGLFGWLGGIAAAGDAIARWGRESAERRRRVVSPSS* |
| C688J35102_1199416102 | 3300002568 | Soil | MLSWIWIPALYVLAFGLFAWLGGISAAGDAIAHWGRETAERRRRTVSPCS* |
| C688J35102_1204920992 | 3300002568 | Soil | MLNWIWIPALYVLAFGLFAWLGGISAAGDAIARWGRETAERRRGALSPSS* |
| C688J35102_1208709562 | 3300002568 | Soil | MMSWIWVPALYVLAFGLFAWLGGISAAGDAIARWGRETAERRRYAASPCS* |
| C688J35102_1208801922 | 3300002568 | Soil | MLSWIWIPTLYVLAFGLFGWLGGISAAGDAIARWGRETAERRRCAVSPSS* |
| soilH2_100006533 | 3300003324 | Sugarcane Root And Bulk Soil | RYAGRVLSWIWVPFLYLIGFGLFGWLGGLAAAGDALSRWGRETADAAGA* |
| Ga0063454_1017529201 | 3300004081 | Soil | MLNWIWIPALYVLAFGLFAWLGGISAAGDAIARWGRETAERRRRTVSSCS* |
| Ga0062593_1017155363 | 3300004114 | Soil | MLSWIEVALLYLLGMGLLAWLGGISSAAGAIERWGRETAERRRCAASSSC* |
| Ga0063455_1008026402 | 3300004153 | Soil | MLNWIWIPALYVLAFGLFAWLGGISAAGDAIARWGRETAERRRRTVSPCS* |
| Ga0062590_1021032502 | 3300004157 | Soil | MLSWIWIPALYVLAFGLFGWLGGIASAGDAIARWGRETAERRRCTVSPCS* |
| Ga0062595_1004651962 | 3300004479 | Soil | MLSWIWIPVLYVVGFGLFGLLGGISAAGDAIARWGRENSESRRCAASSCS* |
| Ga0062595_1022042701 | 3300004479 | Soil | MLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSTCS* |
| Ga0062595_1023894571 | 3300004479 | Soil | SRYARYMLSWIWIPVLYVLAFALFGWLGGIAAAGDAIARWGRETAERRRRVVSPSC* |
| Ga0062592_1011289761 | 3300004480 | Soil | SWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSTCS* |
| Ga0062592_1022330892 | 3300004480 | Soil | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSC* |
| Ga0062591_1009230912 | 3300004643 | Soil | MLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGREAAERRRCTVSPCS* |
| Ga0066677_102182742 | 3300005171 | Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRETAERRRRAVSPSS* |
| Ga0066676_101551543 | 3300005186 | Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRETAERRRAAVSPSS* |
| Ga0066676_104843411 | 3300005186 | Soil | MLNWIWIPALYVLAFGLFAWLGGISAAGDAIARWGRETAERRRGALS |
| Ga0070683_1005487971 | 3300005329 | Corn Rhizosphere | RYARYMLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAESRRRVVSPSC* |
| Ga0066388_1018951622 | 3300005332 | Tropical Forest Soil | MLHWIWIPALYVLAFGLFGWLGGIASAGDAITHWGRETAERRHCAVSSCS* |
| Ga0070687_1006736901 | 3300005343 | Switchgrass Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAESRRRVVSPSC* |
| Ga0070710_114355662 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVSSSS* |
| Ga0070705_1003328632 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRVVSPSS* |
| Ga0070681_101141503 | 3300005458 | Corn Rhizosphere | MLNWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSPCS* |
| Ga0073909_107198921 | 3300005526 | Surface Soil | MLSWIWIPVLYVLAFGLLAWLGGISAAGDAIARWGRETAERRRCVVSPSS* |
| Ga0070739_1000325012 | 3300005532 | Surface Soil | VVGFGLFGWLGRLSAAGDAISRWGRETVERRRCTACCS* |
| Ga0066697_101041532 | 3300005540 | Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRESAERRRRAVSPSS* |
| Ga0070695_1016512552 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSWIWIPVVYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSC* |
| Ga0070696_1003825892 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRVVSPSS* |
| Ga0066661_107474412 | 3300005554 | Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRET |
| Ga0066708_102541954 | 3300005576 | Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRETAERRRR |
| Ga0068852_1005980771 | 3300005616 | Corn Rhizosphere | MLNWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSC* |
| Ga0066903_1014051555 | 3300005764 | Tropical Forest Soil | LAFGLFGWLGGIASAGDAITHWGRETAERRHCAVSSCS* |
| Ga0066903_1052312531 | 3300005764 | Tropical Forest Soil | FSLFAWLGGIASAGDAITRWGRETAGRRRPVSTSS* |
| Ga0066903_1078242572 | 3300005764 | Tropical Forest Soil | MLSWIWIPALYVLAFSLFAWLGGIASAGDAITRWGRETADRRRPVPTSS* |
| Ga0068851_107940191 | 3300005834 | Corn Rhizosphere | HMLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSTCS* |
| Ga0075272_10748262 | 3300005900 | Rice Paddy Soil | MLSWIWIPALYALAFGLFGWLGGISAAGDAIARWGRATAEHRRAAVSTSS* |
| Ga0066652_1001066632 | 3300006046 | Soil | VLSWIWIPVLYVLAFSLFGWLGGIPAAGDAIARWGRETADRRRCAVSPSS* |
| Ga0066652_1003202432 | 3300006046 | Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRETAERRRSAVSPSS* |
| Ga0075432_100519671 | 3300006058 | Populus Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSS* |
| Ga0066653_103886481 | 3300006791 | Soil | YVLAFSLFGWLGGIPAAGDAIARWGRETADRRRCAVSPSS* |
| Ga0066660_113067852 | 3300006800 | Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRETAERRRHAVSPSS |
| Ga0079221_102715801 | 3300006804 | Agricultural Soil | LYVLAFGLFGWLGGIASAGDAIARWGRETAERRRCAVSPCS* |
| Ga0079220_101730672 | 3300006806 | Agricultural Soil | MLSWIWIPLLYVLAFGLFGWLGGIASAGDAIARWGRETAERRRCAVSPCS* |
| Ga0079220_112501622 | 3300006806 | Agricultural Soil | RYAPRMLSWIWIPVLYVLAFGMFGWLGGIASAGDAITRWGRETAERRRRVVSASS* |
| Ga0075425_1016878062 | 3300006854 | Populus Rhizosphere | VHMLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSTCS* |
| Ga0075425_1017623172 | 3300006854 | Populus Rhizosphere | MLSWIWVPVLYVLAFGLFAWLGGISAAGDAIARWGRETAERRRCAVSSSS* |
| Ga0075425_1019971213 | 3300006854 | Populus Rhizosphere | YVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVSPSC* |
| Ga0105240_103980412 | 3300009093 | Corn Rhizosphere | MLNWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSTCS* |
| Ga0066709_1002999384 | 3300009137 | Grasslands Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRESAERRRGAASPSS* |
| Ga0066709_1022936162 | 3300009137 | Grasslands Soil | MMSWIWVPVLYVLAFGLFAWLGGISAAGDAIARWGRETAERRRYAASPCS* |
| Ga0105237_107798611 | 3300009545 | Corn Rhizosphere | WIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSPCS* |
| Ga0134080_101989412 | 3300010333 | Grasslands Soil | MLSWIWIPVLYVLSFGLFAWLGGISAAGDAIARWGRETAERRRGALSPSS* |
| Ga0134125_115026462 | 3300010371 | Terrestrial Soil | MFRYVLAFGLFAWLGGITAAGDAIARWGRETAERRRCAPSPCS* |
| Ga0134128_102374682 | 3300010373 | Terrestrial Soil | MLSWIWIPALYLVGFGLFGWLGGVFAAGDAIARWGRETAERRRCAVSCSS* |
| Ga0134128_104396402 | 3300010373 | Terrestrial Soil | MLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSPCS* |
| Ga0105239_116743972 | 3300010375 | Corn Rhizosphere | MLNWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAESRRRVVSPSC* |
| Ga0134126_113180122 | 3300010396 | Terrestrial Soil | MLDWIWVPALYVLAFGLFAWLGGITAAGDAIARWGRETAERRRCAPSPCS* |
| Ga0137364_101528152 | 3300012198 | Vadose Zone Soil | MLSWIWIPVLYVLSFGLFAWLGGISAAGDAIARWGRETAERRRAAVSPSS* |
| Ga0137382_100338794 | 3300012200 | Vadose Zone Soil | MLSWIWIPVLYVLAFSLFGWLGGIPAAGDAIARWGRETADRRRCAVSPSS* |
| Ga0137382_105727312 | 3300012200 | Vadose Zone Soil | MLSWIWIPVLYVLSFGLLAWLGGISAAGDTIARWGRETAERRRGAASPSS* |
| Ga0137376_108569151 | 3300012208 | Vadose Zone Soil | MLSWIWIPVLYVLSFGLFAWLGGISAAGDAIARWGRETAARRRAAVSP |
| Ga0137378_117705291 | 3300012210 | Vadose Zone Soil | MLSWIWIPVLYVLSFGLFAWLGGISAAGDAIARWGRETAERRRRTVSSCS* |
| Ga0137377_111602422 | 3300012211 | Vadose Zone Soil | MLRWIWIPVLYVLSFGLFAWLGGISAAGDAIARWGRETAERRRGAASPSS* |
| Ga0150985_1108392792 | 3300012212 | Avena Fatua Rhizosphere | MLSWIWIPTLYVLAFGLFGWLGGISAAGDAIARWGRETAEQRRCAVSPSS* |
| Ga0150985_1176711832 | 3300012212 | Avena Fatua Rhizosphere | RYARQMLNWIWIPALYVLAFGLFAWLGGISAAGDAIARWGRETAERRRRTVSSCS* |
| Ga0164300_101326302 | 3300012951 | Soil | MLSWIWIPLVYVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVSSSS* |
| Ga0164303_103914172 | 3300012957 | Soil | MLSWIWIPVLYVLAFGLLTWLGGISAAGDAIARWGRETAERRRCVVSPSS* |
| Ga0164299_112699831 | 3300012958 | Soil | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVS |
| Ga0164299_112993402 | 3300012958 | Soil | YVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVSSSS* |
| Ga0164309_111615752 | 3300012984 | Soil | MLSWIWIPVLYVLAFGLLAWLGGISAAGDAIARWGRETADRRRCAVSSSS* |
| Ga0164309_118059442 | 3300012984 | Soil | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVSPSC* |
| Ga0164308_104700763 | 3300012985 | Soil | MLSWIWIPLVYVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVSPSC* |
| Ga0164308_122026241 | 3300012985 | Soil | LAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSS* |
| Ga0157369_112598341 | 3300013105 | Corn Rhizosphere | MLSWIWIPVLYVLAFALFGWLGGIAAAGDAIARWGRETAERRRRVVSPSC* |
| Ga0134079_107464252 | 3300014166 | Grasslands Soil | MLSWIWIPVLYVLAFSLFGWLGGIPAAGDAIARWGRETADRRRC |
| Ga0182008_102367262 | 3300014497 | Rhizosphere | MLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRCLVSPCS* |
| Ga0132256_1007413112 | 3300015372 | Arabidopsis Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRHVVSPSC* |
| Ga0066667_102865502 | 3300018433 | Grasslands Soil | MLNWIWIPALYVLAFGLFAWLGGISAAGDAIARWGRETAERRRGALSPSS |
| Ga0066667_107258722 | 3300018433 | Grasslands Soil | VLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSS |
| Ga0066669_106147073 | 3300018482 | Grasslands Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRETAERRRRAVSPSS |
| Ga0173482_100350063 | 3300019361 | Soil | MLSWIEVALLYLLGMGLLAWLGGISSAAGAIERWGRETAERRRCAASSSC |
| Ga0197907_112691223 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | SRYARRMLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSTCS |
| Ga0206349_16958391 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | ILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSTCS |
| Ga0206354_103262492 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | SRYARYMLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSC |
| Ga0206354_115618312 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSTCS |
| Ga0206353_110739161 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSC |
| Ga0182009_100919723 | 3300021445 | Soil | MLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRCAVSPCS |
| Ga0224712_103899421 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSWIWIPLLYVLAFGLFGWLGGIASAGDAIARWGRETAERRRCAVSPCS |
| Ga0247802_10614671 | 3300023077 | Soil | LHTRLTGSRYARYMLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSC |
| Ga0247794_101262431 | 3300024055 | Soil | QGSRYARYMLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSC |
| Ga0207707_107505342 | 3300025912 | Corn Rhizosphere | MLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAERRRSAVSPCS |
| Ga0207707_115848031 | 3300025912 | Corn Rhizosphere | AMLSWIWIPALYVLAFGLFGWLGGIASAGDAIARWGRETAERRRCTVSPCS |
| Ga0207693_108415652 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVSSSS |
| Ga0207660_100673105 | 3300025917 | Corn Rhizosphere | MLSWIWIPALYVLAFGLFGWLGGIASAGDAIARWGRETAERRRCTVSPCS |
| Ga0207662_105983142 | 3300025918 | Switchgrass Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAESRRRVVSPSC |
| Ga0207649_111174152 | 3300025920 | Corn Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRVVSPSS |
| Ga0207687_102109993 | 3300025927 | Miscanthus Rhizosphere | MLNWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRVVSPSS |
| Ga0207665_111454842 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVSPSC |
| Ga0207702_112738041 | 3300026078 | Corn Rhizosphere | MLSWIWIPILYVLAFGLFGWLGGIASAGDAIARWGRETAER |
| Ga0209238_11224732 | 3300026301 | Grasslands Soil | MLSWIWIPALYVLSFGLLAWLGGISAAGDAIARWGRETAERRRSAVSPSS |
| Ga0209810_100268812 | 3300027773 | Surface Soil | VVGFGLFGWLGRLSAAGDAISRWGRETVERRRCTACCS |
| Ga0209811_100250204 | 3300027821 | Surface Soil | LYVLAFGLFGWLGGIAAAGDAIARWGRETADRRRCAVSSSS |
| Ga0207428_112509392 | 3300027907 | Populus Rhizosphere | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRRVVSPSS |
| Ga0307276_100902332 | 3300028705 | Soil | MLSWIWIPALYALAFGLFAWLGGISAAGDAIARWGRETADRHRCAVSPSS |
| Ga0307497_101379382 | 3300031226 | Soil | MLSWIWIPVLYVLAFGLLAWLGGISAAGDAIARWGRETAERRRCVVSPSS |
| Ga0308175_1000287344 | 3300031938 | Soil | MLSWIWIPALYVLAFGLFAWVGGIPAAGDAIARWGRETAERRRRTVSPCS |
| Ga0308175_1003782732 | 3300031938 | Soil | MMSWIWVPVLYVLAFGLFAWLGGISAAGDAIARWGRETAERRRCAASTCS |
| Ga0308175_1012233961 | 3300031938 | Soil | MLSWIWVPALYVLAFGLFAWLGGISAAGDAIARWGRETA |
| Ga0308175_1018283502 | 3300031938 | Soil | VLSWIWIPVLYLVGFGLFGWLGGLAAAGDALSRWGRETAERRRYAVSPSS |
| Ga0308175_1025331472 | 3300031938 | Soil | MLSWIWIPVLYVLAFGLFGWLGGIAAAGDAIARWGRETAERRRPTVSACS |
| Ga0308174_105942811 | 3300031939 | Soil | YLVGFGLFGWLGGVFAAGDAIARWGRETAERRRCAVSCSS |
| Ga0308174_106905822 | 3300031939 | Soil | MLSWIWIPALYLVGFGLFGWLGGVFAAGDAIARWGRETAERRRCAVSCSS |
| Ga0308176_103204282 | 3300031996 | Soil | MMLSWIWIPALYVLAFGLFGWLGGIASAGDAIARWGRETAERRRCTVSPCS |
| Ga0308173_118371802 | 3300032074 | Soil | MSWIWIPALYLVGFGLFGWLGGVFAAGDAIARWGRETAERRRCAVSCSS |
| ⦗Top⦘ |