Metagenome Family F077092

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F077092
Family Type	Metagenome
Number of Sequences	117
Average Sequence Length	38 residues
Representative Sequence	LISEAKRTAKVDREVSLSEVADLSILKEAQKELGIK
Number of Associated Samples	94
Number of Associated Scaffolds	117

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	8.49 %
% of genes near scaffold ends (potentially truncated)	77.78 %
% of genes from short scaffolds (< 2000 bps)	77.78 %
Associated GOLD sequencing projects	90
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (75.214 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.385 % of family members)
Environment Ontology (ENVO)	Unclassified (24.786 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (41.026 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 31.25% β-sheet: 0.00% Coil/Unstructured: 68.75%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.35
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF09084	NMT1	31.62
PF07746	LigA	5.98
PF07883	Cupin_2	5.98
PF01169	UPF0016	4.27
PF03401	TctC	2.56
PF13379	NMT1_2	2.56
PF00903	Glyoxalase	2.56
PF13620	CarboxypepD_reg	1.71
PF00389	2-Hacid_dh	1.71
PF13964	Kelch_6	1.71
PF02281	Dimer_Tnp_Tn5	0.85
PF13343	SBP_bac_6	0.85
PF13531	SBP_bac_11	0.85
PF04909	Amidohydro_2	0.85
PF00355	Rieske	0.85
PF12706	Lactamase_B_2	0.85
PF01694	Rhomboid	0.85
PF13643	DUF4145	0.85
PF02900	LigB	0.85
PF00596	Aldolase_II	0.85

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	31.62
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	31.62
COG2119	Putative Ca2+/H+ antiporter, TMEM165/GDT1 family	General function prediction only [R]	4.27
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	2.56
COG0705	Membrane-associated serine protease, rhomboid family	Posttranslational modification, protein turnover, chaperones [O]	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	75.21 %
Unclassified	root	N/A	24.79 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	75.21 %
Unclassified	root	N/A	24.79 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	75.21 %
Unclassified	root	N/A	24.79 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	37.61 %
Unclassified	root	N/A	24.79 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.71 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.85 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	34.19 %
Unclassified	root	N/A	24.79 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.56 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.71 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.85 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	34.19 %
Unclassified	root	N/A	24.79 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1.71 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.85 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.85 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	27.35 %
Unclassified	root	N/A	24.79 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	1.71 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.85 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28	0.85 %
Gemmatales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales	0.85 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	26.50 %
Unclassified	root	N/A	24.79 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.71 %
Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_16	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_16	0.85 %
Gemmataceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae	0.85 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.85 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28	0.85 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	26.50 %
Unclassified	root	N/A	24.79 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.71 %
unclassified Variovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax	0.85 %
unclassified Gemmataceae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → unclassified Gemmataceae	0.85 %
Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_16	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_16	0.85 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28	0.85 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	26.50 %
Unclassified	root	N/A	24.79 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1.71 %
Variovorax sp. CF079	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF079	0.85 %
Gemmataceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → unclassified Gemmataceae → Gemmataceae bacterium	0.85 %
Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_16	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_16	0.85 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000655\|AF_2010_repII_A100DRAFT_1020267	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1253	Open in IMG/M
3300000789\|JGI1027J11758_11850245	Not Available	649	Open in IMG/M
3300002223\|C687J26845_10118088	All Organisms → cellular organisms → Bacteria	983	Open in IMG/M
3300005181\|Ga0066678_10064081	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2131	Open in IMG/M
3300005294\|Ga0065705_10167378	All Organisms → cellular organisms → Bacteria	1714	Open in IMG/M
3300005526\|Ga0073909_10493457	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300005548\|Ga0070665_100736557	All Organisms → cellular organisms → Bacteria	999	Open in IMG/M
3300005553\|Ga0066695_10190167	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1286	Open in IMG/M
3300005558\|Ga0066698_10264263	Not Available	1189	Open in IMG/M
3300005713\|Ga0066905_101815361	Not Available	563	Open in IMG/M
3300005719\|Ga0068861_101572532	Not Available	647	Open in IMG/M
3300005764\|Ga0066903_101070064	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28	1483	Open in IMG/M
3300005764\|Ga0066903_103054404	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	906	Open in IMG/M
3300005764\|Ga0066903_103919861	All Organisms → cellular organisms → Bacteria	799	Open in IMG/M
3300005887\|Ga0075292_1007788	All Organisms → cellular organisms → Bacteria	1321	Open in IMG/M
3300006796\|Ga0066665_10446071	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1068	Open in IMG/M
3300006844\|Ga0075428_102547499	All Organisms → cellular organisms → Bacteria	523	Open in IMG/M
3300006845\|Ga0075421_102164795	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300006852\|Ga0075433_10522221	All Organisms → cellular organisms → Bacteria	1044	Open in IMG/M
3300006903\|Ga0075426_10530623	All Organisms → cellular organisms → Bacteria	876	Open in IMG/M
3300006903\|Ga0075426_10590482	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	829	Open in IMG/M
3300006903\|Ga0075426_11147752	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	589	Open in IMG/M
3300006904\|Ga0075424_102206836	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300006969\|Ga0075419_10097691	All Organisms → cellular organisms → Bacteria	1885	Open in IMG/M
3300009012\|Ga0066710_100603088	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1666	Open in IMG/M
3300009087\|Ga0105107_10575105	Not Available	785	Open in IMG/M
3300009100\|Ga0075418_10147496	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2504	Open in IMG/M
3300009100\|Ga0075418_10863343	All Organisms → cellular organisms → Bacteria	978	Open in IMG/M
3300009147\|Ga0114129_10330695	All Organisms → cellular organisms → Bacteria	2023	Open in IMG/M
3300009147\|Ga0114129_12602501	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	604	Open in IMG/M
3300009147\|Ga0114129_13352167	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	517	Open in IMG/M
3300009162\|Ga0075423_12293751	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300009174\|Ga0105241_10063118	All Organisms → cellular organisms → Bacteria	2857	Open in IMG/M
3300009444\|Ga0114945_10783348	Not Available	584	Open in IMG/M
3300009553\|Ga0105249_11070668	All Organisms → cellular organisms → Bacteria	876	Open in IMG/M
3300009792\|Ga0126374_10219598	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1218	Open in IMG/M
3300010043\|Ga0126380_10051176	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_16	2232	Open in IMG/M
3300010046\|Ga0126384_12101476	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	542	Open in IMG/M
3300010301\|Ga0134070_10246780	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	667	Open in IMG/M
3300010329\|Ga0134111_10010552	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2946	Open in IMG/M
3300010337\|Ga0134062_10390490	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	679	Open in IMG/M
3300010358\|Ga0126370_10025914	All Organisms → cellular organisms → Bacteria	3451	Open in IMG/M
3300010358\|Ga0126370_10086722	All Organisms → cellular organisms → Bacteria	2122	Open in IMG/M
3300010358\|Ga0126370_10991927	All Organisms → cellular organisms → Bacteria	766	Open in IMG/M
3300010358\|Ga0126370_11510002	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	639	Open in IMG/M
3300010360\|Ga0126372_10838608	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300010360\|Ga0126372_11856493	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	647	Open in IMG/M
3300010362\|Ga0126377_11960353	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	662	Open in IMG/M
3300010375\|Ga0105239_10083873	All Organisms → cellular organisms → Bacteria	3510	Open in IMG/M
3300010375\|Ga0105239_11106929	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300010398\|Ga0126383_10913638	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	964	Open in IMG/M
3300010398\|Ga0126383_11463205	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	773	Open in IMG/M
3300010398\|Ga0126383_13372596	Not Available	522	Open in IMG/M
3300010868\|Ga0124844_1163739	All Organisms → cellular organisms → Bacteria	834	Open in IMG/M
3300012200\|Ga0137382_10099733	All Organisms → cellular organisms → Bacteria → Proteobacteria	1914	Open in IMG/M
3300012206\|Ga0137380_10042724	All Organisms → cellular organisms → Bacteria	4170	Open in IMG/M
3300012207\|Ga0137381_11229076	Not Available	642	Open in IMG/M
3300012285\|Ga0137370_10725241	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	617	Open in IMG/M
3300012353\|Ga0137367_11097336	Not Available	538	Open in IMG/M
3300012476\|Ga0157344_1005979	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300012922\|Ga0137394_10054534	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3307	Open in IMG/M
3300012922\|Ga0137394_10065644	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3017	Open in IMG/M
3300012958\|Ga0164299_10077209	All Organisms → cellular organisms → Bacteria	1657	Open in IMG/M
3300012971\|Ga0126369_11093842	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	886	Open in IMG/M
3300012971\|Ga0126369_13317827	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300012984\|Ga0164309_10965991	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300013297\|Ga0157378_11262004	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300014881\|Ga0180094_1037772	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1001	Open in IMG/M
3300015259\|Ga0180085_1011249	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2446	Open in IMG/M
3300015358\|Ga0134089_10335320	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	634	Open in IMG/M
3300015371\|Ga0132258_10150038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF079	5589	Open in IMG/M
3300015371\|Ga0132258_10846552	All Organisms → cellular organisms → Bacteria	2308	Open in IMG/M
3300015372\|Ga0132256_100214653	All Organisms → cellular organisms → Bacteria	1977	Open in IMG/M
3300015372\|Ga0132256_101238880	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	859	Open in IMG/M
3300015372\|Ga0132256_101493672	Not Available	787	Open in IMG/M
3300015374\|Ga0132255_101032103	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1234	Open in IMG/M
3300015374\|Ga0132255_103709707	Not Available	649	Open in IMG/M
3300016270\|Ga0182036_11931667	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → unclassified Gemmataceae → Gemmataceae bacterium	501	Open in IMG/M
3300016387\|Ga0182040_10503140	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	968	Open in IMG/M
3300016404\|Ga0182037_12015765	Not Available	518	Open in IMG/M
3300017944\|Ga0187786_10324114	Not Available	641	Open in IMG/M
3300018084\|Ga0184629_10719082	Not Available	502	Open in IMG/M
3300018433\|Ga0066667_10933560	Not Available	747	Open in IMG/M
3300020006\|Ga0193735_1028243	All Organisms → cellular organisms → Bacteria	1720	Open in IMG/M
3300020018\|Ga0193721_1027510	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1506	Open in IMG/M
3300021418\|Ga0193695_1103577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	607	Open in IMG/M
3300022563\|Ga0212128_10121526	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1686	Open in IMG/M
3300025174\|Ga0209324_10485450	Not Available	753	Open in IMG/M
3300025324\|Ga0209640_10629882	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300025910\|Ga0207684_10230860	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1597	Open in IMG/M
3300025926\|Ga0207659_10799258	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	810	Open in IMG/M
3300025932\|Ga0207690_11371418	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300025939\|Ga0207665_11491208	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	537	Open in IMG/M
3300026313\|Ga0209761_1203447	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	865	Open in IMG/M
3300026323\|Ga0209472_1318262	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300027277\|Ga0209846_1008740	Not Available	1738	Open in IMG/M
3300027646\|Ga0209466_1013266	Not Available	1737	Open in IMG/M
3300027909\|Ga0209382_11364656	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	714	Open in IMG/M
3300027909\|Ga0209382_11696581	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	620	Open in IMG/M
3300028379\|Ga0268266_11019439	All Organisms → cellular organisms → Bacteria	801	Open in IMG/M
3300031198\|Ga0307500_10031943	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1197	Open in IMG/M
3300031231\|Ga0170824_119799482	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	619	Open in IMG/M
3300031908\|Ga0310900_11881667	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300032180\|Ga0307471_102501991	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300032205\|Ga0307472_100141875	All Organisms → cellular organisms → Bacteria	1739	Open in IMG/M
3300034417\|Ga0364941_085513	All Organisms → cellular organisms → Bacteria	746	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	69.23%
Host-Associated	Host-Associated	30.77%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.25%
Plants	Host-Associated → Plants	30.77%
Aquatic	Environmental → Aquatic	5.98%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	62.39%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.64%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.13%
Sediment	Environmental → Aquatic → Sediment	2.56%
Freshwater	Environmental → Aquatic → Freshwater	1.71%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.71%
Floodplain	Environmental → Terrestrial → Floodplain	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	49.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	19.66%
Loam	Environmental → Terrestrial → Soil → Loam	9.40%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.98%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.56%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.56%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.71%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.71%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.71%
Sand	Environmental → Terrestrial → Soil → Sand	0.85%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	19.66%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	9.40%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.98%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.13%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.56%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.56%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.71%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	1.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.71%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	1.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.71%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.85%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.85%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.85%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	15.38%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	13.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.84%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.13%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	5.13%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.13%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.42%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.56%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.56%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	2.56%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.71%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	1.71%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.71%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.71%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	1.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.71%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.85%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.85%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.85%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.85%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.85%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.85%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.85%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.85%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002223	Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005887	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009444	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012476	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610	Host-Associated	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014881	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da	Environmental	Open in IMG/M
3300015259	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D	Environmental	Open in IMG/M
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300020006	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2	Environmental	Open in IMG/M
3300020018	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2	Environmental	Open in IMG/M
3300021418	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2	Environmental	Open in IMG/M
3300022563	OV2_combined assembly	Environmental	Open in IMG/M
3300025174	Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3	Environmental	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026307	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026315	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)	Environmental	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300027277	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300034417	Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1019027351	3300000364	Soil	IEERKTTLKVTREVPLSEVADLSILREAQRELGITVK*
AF_2010_repII_A100DRAFT_10202671	3300000655	Forest Soil	LVIDELKKLAKVERAISPNEVEDLSLLKEAQKEMGITVR*
JGI1027J11758_118502451	3300000789	Soil	EAKKTAKIEREIPLSEVADLSILREAQKELGIRPR*
C687J26845_101180881	3300002223	Soil	LEDTKRLAKQDREVSLNDVTDLSILKEAQRDLGIK*
Ga0066678_100640813	3300005181	Soil	RLAIEEAKRVGKVDREVSLSEVADLSILKQAQKELGIAER*
Ga0065705_101673784	3300005294	Switchgrass Rhizosphere	VAIDEARRVGKVERDVSFGEVADLSILREAQKELGITTGK*
Ga0073909_104934572	3300005526	Surface Soil	RVAIDEERRVGKVERDVSFGEVADLSILREAEKELGITTGK*
Ga0070665_1007365571	3300005548	Switchgrass Rhizosphere	RVAIDEARRVGKVERGVSFSEVADLSILREAQRELAVLGK*
Ga0066695_101901673	3300005553	Soil	LIDEAKKQARVEREISPSEVADLSILREAQKELGIKTK*
Ga0066698_102642631	3300005558	Soil	LLLVIDELRKLGKVEREISVREVADLSLLREAQKELGIK*
Ga0066905_1018153611	3300005713	Tropical Forest Soil	LIADTKKVTKVDREIAFSEVADLSILKEAQKELGIKAR*
Ga0068861_1015725321	3300005719	Switchgrass Rhizosphere	EAKKQTKVSRDIAPGDIADLSMLREAQKELGIRK*
Ga0066903_1010700641	3300005764	Tropical Forest Soil	VDEAKKTAKIDREIPLNEIADLSILREAQKELGIRPK*
Ga0066903_1030544041	3300005764	Tropical Forest Soil	LIVDEAKKTAKIDREIPLNEIADLSILREAQKELGIRPK*
Ga0066903_1039198612	3300005764	Tropical Forest Soil	IDELKKLAKVEREITPSEIADLSLLKEAQKELVAK*
Ga0075292_10077882	3300005887	Rice Paddy Soil	IDEAKKTAKVERTIALNEIADLSILKQAQKELAIKTK*
Ga0066665_104460712	3300006796	Soil	ETRKAGKVSREIASSEVADLSILREAQKELGIQGR*
Ga0075428_1025474991	3300006844	Populus Rhizosphere	EEAKRIGKVERDVSFSEVADLSILREAQKELVSGAK*
Ga0075421_1021647951	3300006845	Populus Rhizosphere	LNIEEAKRVGKVDREISFAEVADLTILREAQKELGLKTR*
Ga0075433_105222213	3300006852	Populus Rhizosphere	HLAIDEAKRIGKVDREVSVSEVADLSILREAQKELGISER*
Ga0075420_1011441602	3300006853	Populus Rhizosphere	FRLLIDDAKQTAKVTRDVAVNEVADFSIVREVQRELGIMEK*
Ga0075426_105306231	3300006903	Populus Rhizosphere	LRVAIDEARRVGKVERGVSFSEVADLSILREAQRELAVLGK*
Ga0075426_105904822	3300006903	Populus Rhizosphere	AKRVAKINREISFAEVADLSILREAQKELGIIGR*
Ga0075426_111477522	3300006903	Populus Rhizosphere	EAKKTAKIDREIPLSDIADLSILREAQKELGTKPK*
Ga0075424_1022068362	3300006904	Populus Rhizosphere	LRVAIDEARRVGKVERDVSFGEVADLSILREAQKELGITTGK*
Ga0075419_100976913	3300006969	Populus Rhizosphere	IEETKKAIKVNREVSFNEVVDLTILREAQRELGIK*
Ga0066710_1006030882	3300009012	Grasslands Soil	LRGEKKQAKVNREVSPSEIADLSILRDAQKELGIKGR
Ga0105107_105751053	3300009087	Freshwater Sediment	VDGFQTRLEDTKRLAKLDREVSLNDVADLLILKEAQRELGIK*
Ga0075418_101474963	3300009100	Populus Rhizosphere	LIEEAKRAAKVEREVATNEVADLSILREAQRELGIAQR*
Ga0075418_108633431	3300009100	Populus Rhizosphere	VAIEEAKRVGKVEREVSLNEIADLSILREAQRELGIAVK*
Ga0114129_103306951	3300009147	Populus Rhizosphere	AKKTAKVEREISLSEIADLSILREAQKELGNRPK*
Ga0114129_126025011	3300009147	Populus Rhizosphere	ELKKLAKVEREISPSEVADLSILGEAQKELGIGTR*
Ga0114129_133521672	3300009147	Populus Rhizosphere	LLVIDELRKLGKVEREISVREVADLSLLREAQRELGIIGR*
Ga0111538_136220171	3300009156	Populus Rhizosphere	IDEAKKNAKLNREVSIDQVADLSILREAQREMGIK*
Ga0075423_122937512	3300009162	Populus Rhizosphere	LRVAIEYAKRIGKVERDVSFSEVADLSILREAQKELGSGAK*
Ga0105104_108609742	3300009168	Freshwater Sediment	IDEAKKNAKLNREVSIDQVADLSILKEVQREVGIGGR*
Ga0105241_100631181	3300009174	Corn Rhizosphere	IEEAKRVGKVAREVSFSEVADLSILKEAQKELGIGDR*
Ga0114945_107833481	3300009444	Thermal Springs	VVEEAKRVAKVDREVSFSEVADLSILRKAQKELGIERR*
Ga0105249_110706683	3300009553	Switchgrass Rhizosphere	LIDEAKKQAKVSRDVAPGDIADLSLLREAQKELGIRK*
Ga0126374_102195982	3300009792	Tropical Forest Soil	EAKKAAKISREVASSEVADLAILREAQRELGIQGR*
Ga0126380_100511761	3300010043	Tropical Forest Soil	EAKKTAKIDREIPLNEIADLSILREAQKELGIRPK*
Ga0126380_103474291	3300010043	Tropical Forest Soil	IEDIKGSAKVTRDVSVSEVADLSILHEAQRELGIGGK*
Ga0126384_121014762	3300010046	Tropical Forest Soil	EEAKRVGKVEREIAVNEVVDLTSLKEAQKELGIR*
Ga0134070_102467802	3300010301	Grasslands Soil	LLVIDELKRLGRVEPEISLSEVEDLSLLKEAQRELGIK*
Ga0134111_100105521	3300010329	Grasslands Soil	EAKRVGKVDREVSLSEVADLSILKQAQKELGIAER*
Ga0134062_103904902	3300010337	Grasslands Soil	EEAKRVGKVDREVSLSEVADLSILKQAQKELGIAER*
Ga0126370_100259145	3300010358	Tropical Forest Soil	LVIEELKKLSKVEREISLSEVADLSLLKEVQKELGIKEK*
Ga0126370_100867221	3300010358	Tropical Forest Soil	AIDEAKRIGKVDRDVAFSEVADLSILREAQRELGISQK*
Ga0126370_109919272	3300010358	Tropical Forest Soil	AIEEAKRIGKVDRDISFGEVADLSILREAQKELGISAK*
Ga0126370_115100022	3300010358	Tropical Forest Soil	VEEAKRVGKVEREISLSEIADLSILKEVQRELGIAAIAIKQITE*
Ga0126372_108386082	3300010360	Tropical Forest Soil	DELKKLAKVEREIAPSEVEDLSLLKEAQKELVAK*
Ga0126372_118564932	3300010360	Tropical Forest Soil	IEEAKRVGKVEREIALSEVVDLTILKEAQKELGIK*
Ga0126377_119603531	3300010362	Tropical Forest Soil	IDELKKLAKVERAISPNEVEDLSLLKEAQKDMGIQGGRN*
Ga0105239_100838736	3300010375	Corn Rhizosphere	AIDEARRVGKVERGVSFSEVADLSILREAQRELAVLGK*
Ga0105239_111069291	3300010375	Corn Rhizosphere	RRVGKVERDVSFGEVADLSILREAQKELGITTGK*
Ga0126383_109136382	3300010398	Tropical Forest Soil	VIEEAKRVGKVEREIAVSEVADLTSLKEAQKELGIK*
Ga0126383_114632052	3300010398	Tropical Forest Soil	LRLVIEEAKRVGKVEREIAVNEVVDLTSLKEAQKELGIR*
Ga0126383_133725961	3300010398	Tropical Forest Soil	KGLLLVIDELKKLAKVEREIAPSEVEDLSLLKEAQKELVAK*
Ga0124844_11637391	3300010868	Tropical Forest Soil	LIEETRKAGKVSREIASSEVADLSILKEAQKELGIQG
Ga0137382_100997331	3300012200	Vadose Zone Soil	EAKRVGKVDREVSLSEGADLSILKQAQKELGIAER*
Ga0137380_100427241	3300012206	Vadose Zone Soil	IEELKKLGKVEREIAPSDVADLSILREAQRELGIKER*
Ga0137381_112290761	3300012207	Vadose Zone Soil	VLIEEAKKAAKLSREVASSEVADLSILREAQKELGFKVK*
Ga0137370_107252411	3300012285	Vadose Zone Soil	VVEEAKRVGKVDREVSLSEVVHLSILREVQRELGIP
Ga0137367_110973361	3300012353	Vadose Zone Soil	ERKKSAKVSREVSIGDVADLTILREAQRELGIKGK*
Ga0157344_10059791	3300012476	Arabidopsis Rhizosphere	MLLVIDELKKLGKVEREISLSEVADLSILKDAQRELGITAK*
Ga0137394_100545341	3300012922	Vadose Zone Soil	LLIEEAKRAAKVEREVAMNEVADLSILREAQRELGVAQR*
Ga0137394_100656441	3300012922	Vadose Zone Soil	LKKLGKVEREISLSEVADLSILKDAQKELAITAK*
Ga0164299_100772091	3300012958	Soil	GLRVAIDEERRVGKVERDVSFGEVADLSILREAQKELGITTGK*
Ga0126369_110938422	3300012971	Tropical Forest Soil	LLIDEAKKAAKTNREIASSEVADPAILKEAQKELGIK*
Ga0126369_133178271	3300012971	Tropical Forest Soil	DELKKLAKVEREITPSEVADLSLLKEVQKEMGITVR*
Ga0134087_101566673	3300012977	Grasslands Soil	ETKKQAEVNREVPLNDVADISILKEAQRELGITGR*
Ga0164309_109659912	3300012984	Soil	IEEAKRVGKVERDVSFNEVADLSILREAQRELGIAVR*
Ga0157378_112620041	3300013297	Miscanthus Rhizosphere	AIDEARRVGKVERDVSFGEVADLSILREAQKELGITTGK*
Ga0180094_10377722	3300014881	Soil	LLISEAKRTAKVEREISPSEVLDLALLKEAQKEMGIQGR*
Ga0180085_10112491	3300015259	Soil	LISEAKRTAKVDREVSLSEVADLSILKEAQKELGIK*
Ga0134089_103353201	3300015358	Grasslands Soil	LLIEEGKRQAKVEREVSAAEVADLSILKEAQKALGIRER*
Ga0134089_105362412	3300015358	Grasslands Soil	LIDEAKKNAKLNREVSLDQVADLSILKEVQRELGIKPF*
Ga0132258_101500388	3300015371	Arabidopsis Rhizosphere	EEAKRTAKVNREISTNEVEDLSILREVQKELGVKGR*
Ga0132258_108465524	3300015371	Arabidopsis Rhizosphere	LIDEAKKQTKVSRDIAPGDVADLSMLREAQKELGK*
Ga0132256_1002146531	3300015372	Arabidopsis Rhizosphere	LLIDEAKKQTKVTREVAQSDIADLSILREAQRELGMRK*
Ga0132256_1012388803	3300015372	Arabidopsis Rhizosphere	LIDEAKKQTKGSRDIAPGDVADLSMLREAQKELGK*
Ga0132256_1014936722	3300015372	Arabidopsis Rhizosphere	LIDEAKKQARVEREISPSEVADLSILREAQKELGIKTT*
Ga0132255_1010321032	3300015374	Arabidopsis Rhizosphere	LMIDEAKKTAKVEREIPLTNIADLSILREAQKELGIRPK*
Ga0132255_1037097071	3300015374	Arabidopsis Rhizosphere	MPIPANLRKQTRVSRDVSPGDIADLSLLREAQKELGIRK*
Ga0182036_119316671	3300016270	Soil	EEAKKGAKVEREVSINEVADLSILKLAQKELGIKGK
Ga0182040_105031402	3300016387	Soil	VVEEAKRVGKVEREISLSEIANLSILKEAQKELGIMAAR
Ga0182037_120157651	3300016404	Soil	DEAKKATKINREIASSEVADLSILREAQKELGIKER
Ga0187786_103241141	3300017944	Tropical Peatland	HLVIEEAQKAAKVSREISMKDLADLSILREAQRELGIK
Ga0184629_107190822	3300018084	Groundwater Sediment	IEEARQSLKASREVSIAEVTDLSILREAQKELGIKGK
Ga0066667_109335602	3300018433	Grasslands Soil	ETRKAGKVSREIASSEVADLSILREAQKELGIQGR
Ga0193735_10282431	3300020006	Soil	LIDEAKKQAKVSRDIVAADIADLSMLREAQGELGLRK
Ga0193721_10275101	3300020018	Soil	LVIDELKKLGKVEREISLSEVADLSILKEAQRELGIMTAR
Ga0193695_11035772	3300021418	Soil	IEEAKKTAKLDREIPLNEVADLSILREAQKELGIKPR
Ga0212128_101215264	3300022563	Thermal Springs	VVEEAKRVAKVDREVSFSEVADLSILRKAQKELGIERR
Ga0209324_104854501	3300025174	Soil	VIDENKKVAKVDREVALSEVADLSILKQAQQELGIGKK
Ga0209640_106298822	3300025324	Soil	LRLVIEERKKFAKIDREVSLSEVADLSILRDAQRELGKGRN
Ga0207684_102308601	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	IDELKKLGKVEREVSMSEVADLSILKEAQKELGITVR
Ga0207659_107992581	3300025926	Miscanthus Rhizosphere	IIDEARKTAKVEREIPLTNVADLSILREAQKELGIRAK
Ga0207690_113714181	3300025932	Corn Rhizosphere	LIDEAKKAAKISREITSSEFVDLSILKEAQRELGIQGR
Ga0207665_114912082	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	LVIDELKKLAKVEREISPSEVADLSILREAQKEMGIKER
Ga0209469_10287121	3300026307	Soil	LIEETKKQAKVNREVPLSDVADISILKEAQREFGITGR
Ga0209761_12034471	3300026313	Grasslands Soil	VVEEAKRVGKVDGEVSLSEVADLSILKEAQKELGIRTP
Ga0209686_11530981	3300026315	Soil	LIDEAKKNAKLNREVSLDQVADLSILKEVQRELGIKPF
Ga0209472_13182621	3300026323	Soil	VVEEAKRVGKVDREVSLSEAVHRSILREVQRELGIAAS
Ga0209846_10087403	3300027277	Groundwater Sand	GLNLLIELAKRDAKISREIPISEVADFSILKEAQKELGLR
Ga0209466_10132661	3300027646	Tropical Forest Soil	LIDEAKKAAKISRAIASSEVADLSILREAQKELGIK
Ga0209382_113646561	3300027909	Populus Rhizosphere	RLLISEAKRITKVDREVSFSEVADLSIVREAQKDLAIRK
Ga0209382_116965812	3300027909	Populus Rhizosphere	IDELKKLGKAEREISLSEVADLSILKEAQRELGIMTAR
Ga0268266_110194393	3300028379	Switchgrass Rhizosphere	VAIDEARRVGKVERGVSFSEVADLSILREAQRELAVLGK
Ga0307500_100319431	3300031198	Soil	VIDELKKLGKVEREISLSEVADLSILKDAQKELGITAK
Ga0170824_1197994822	3300031231	Forest Soil	IEEAKRTAKVTREVPINEVEDLSILKEAQRELGIK
Ga0310900_118816672	3300031908	Soil	LVIEEAKRTAKVNREISTNEVEDLSILREVQKELGVKGR
Ga0307470_101533351	3300032174	Hardwood Forest Soil	IFRRRTRLVIEEAKKAGNASRTFALSEVADLSILREAQELGIKSK
Ga0307471_1025019911	3300032180	Hardwood Forest Soil	IDEAKRIGKVDRDVAFSEVADLSILKEAQRELGIPLK
Ga0307472_1001418751	3300032205	Hardwood Forest Soil	DEAKKQTKVTREVAQSDIADLSILREAQRELGMRK
Ga0335069_107904153	3300032893	Soil	DEAKKNAKVNREVSIDQVADLSILKEVQRELGIKEK
Ga0364941_085513_1_111	3300034417	Sediment	EELKKLAKVDREISPSEVADLSLLKEAQKEMGIGGR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F077092

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences