| Basic Information | |
|---|---|
| Family ID | F077092 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 38 residues |
| Representative Sequence | LISEAKRTAKVDREVSLSEVADLSILKEAQKELGIK |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.49 % |
| % of genes near scaffold ends (potentially truncated) | 77.78 % |
| % of genes from short scaffolds (< 2000 bps) | 77.78 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.214 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.786 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.026 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.25% β-sheet: 0.00% Coil/Unstructured: 68.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 31.62 |
| PF07746 | LigA | 5.98 |
| PF07883 | Cupin_2 | 5.98 |
| PF01169 | UPF0016 | 4.27 |
| PF03401 | TctC | 2.56 |
| PF13379 | NMT1_2 | 2.56 |
| PF00903 | Glyoxalase | 2.56 |
| PF13620 | CarboxypepD_reg | 1.71 |
| PF00389 | 2-Hacid_dh | 1.71 |
| PF13964 | Kelch_6 | 1.71 |
| PF02281 | Dimer_Tnp_Tn5 | 0.85 |
| PF13343 | SBP_bac_6 | 0.85 |
| PF13531 | SBP_bac_11 | 0.85 |
| PF04909 | Amidohydro_2 | 0.85 |
| PF00355 | Rieske | 0.85 |
| PF12706 | Lactamase_B_2 | 0.85 |
| PF01694 | Rhomboid | 0.85 |
| PF13643 | DUF4145 | 0.85 |
| PF02900 | LigB | 0.85 |
| PF00596 | Aldolase_II | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 31.62 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 31.62 |
| COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 4.27 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.56 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.21 % |
| Unclassified | root | N/A | 24.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1020267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1253 | Open in IMG/M |
| 3300000789|JGI1027J11758_11850245 | Not Available | 649 | Open in IMG/M |
| 3300002223|C687J26845_10118088 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300005181|Ga0066678_10064081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2131 | Open in IMG/M |
| 3300005294|Ga0065705_10167378 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300005526|Ga0073909_10493457 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005548|Ga0070665_100736557 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300005553|Ga0066695_10190167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1286 | Open in IMG/M |
| 3300005558|Ga0066698_10264263 | Not Available | 1189 | Open in IMG/M |
| 3300005713|Ga0066905_101815361 | Not Available | 563 | Open in IMG/M |
| 3300005719|Ga0068861_101572532 | Not Available | 647 | Open in IMG/M |
| 3300005764|Ga0066903_101070064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_67_28 | 1483 | Open in IMG/M |
| 3300005764|Ga0066903_103054404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 906 | Open in IMG/M |
| 3300005764|Ga0066903_103919861 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005887|Ga0075292_1007788 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300006796|Ga0066665_10446071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1068 | Open in IMG/M |
| 3300006844|Ga0075428_102547499 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006845|Ga0075421_102164795 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300006852|Ga0075433_10522221 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300006903|Ga0075426_10530623 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300006903|Ga0075426_10590482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300006903|Ga0075426_11147752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300006904|Ga0075424_102206836 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006969|Ga0075419_10097691 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300009012|Ga0066710_100603088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1666 | Open in IMG/M |
| 3300009087|Ga0105107_10575105 | Not Available | 785 | Open in IMG/M |
| 3300009100|Ga0075418_10147496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2504 | Open in IMG/M |
| 3300009100|Ga0075418_10863343 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300009147|Ga0114129_10330695 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300009147|Ga0114129_12602501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300009147|Ga0114129_13352167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300009162|Ga0075423_12293751 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009174|Ga0105241_10063118 | All Organisms → cellular organisms → Bacteria | 2857 | Open in IMG/M |
| 3300009444|Ga0114945_10783348 | Not Available | 584 | Open in IMG/M |
| 3300009553|Ga0105249_11070668 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300009792|Ga0126374_10219598 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1218 | Open in IMG/M |
| 3300010043|Ga0126380_10051176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_16 | 2232 | Open in IMG/M |
| 3300010046|Ga0126384_12101476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300010301|Ga0134070_10246780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 667 | Open in IMG/M |
| 3300010329|Ga0134111_10010552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2946 | Open in IMG/M |
| 3300010337|Ga0134062_10390490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300010358|Ga0126370_10025914 | All Organisms → cellular organisms → Bacteria | 3451 | Open in IMG/M |
| 3300010358|Ga0126370_10086722 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300010358|Ga0126370_10991927 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010358|Ga0126370_11510002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300010360|Ga0126372_10838608 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300010360|Ga0126372_11856493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300010362|Ga0126377_11960353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300010375|Ga0105239_10083873 | All Organisms → cellular organisms → Bacteria | 3510 | Open in IMG/M |
| 3300010375|Ga0105239_11106929 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300010398|Ga0126383_10913638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 964 | Open in IMG/M |
| 3300010398|Ga0126383_11463205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300010398|Ga0126383_13372596 | Not Available | 522 | Open in IMG/M |
| 3300010868|Ga0124844_1163739 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012200|Ga0137382_10099733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1914 | Open in IMG/M |
| 3300012206|Ga0137380_10042724 | All Organisms → cellular organisms → Bacteria | 4170 | Open in IMG/M |
| 3300012207|Ga0137381_11229076 | Not Available | 642 | Open in IMG/M |
| 3300012285|Ga0137370_10725241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 617 | Open in IMG/M |
| 3300012353|Ga0137367_11097336 | Not Available | 538 | Open in IMG/M |
| 3300012476|Ga0157344_1005979 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300012922|Ga0137394_10054534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3307 | Open in IMG/M |
| 3300012922|Ga0137394_10065644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3017 | Open in IMG/M |
| 3300012958|Ga0164299_10077209 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300012971|Ga0126369_11093842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 886 | Open in IMG/M |
| 3300012971|Ga0126369_13317827 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012984|Ga0164309_10965991 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300013297|Ga0157378_11262004 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300014881|Ga0180094_1037772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300015259|Ga0180085_1011249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2446 | Open in IMG/M |
| 3300015358|Ga0134089_10335320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300015371|Ga0132258_10150038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF079 | 5589 | Open in IMG/M |
| 3300015371|Ga0132258_10846552 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300015372|Ga0132256_100214653 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300015372|Ga0132256_101238880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300015372|Ga0132256_101493672 | Not Available | 787 | Open in IMG/M |
| 3300015374|Ga0132255_101032103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1234 | Open in IMG/M |
| 3300015374|Ga0132255_103709707 | Not Available | 649 | Open in IMG/M |
| 3300016270|Ga0182036_11931667 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → unclassified Gemmataceae → Gemmataceae bacterium | 501 | Open in IMG/M |
| 3300016387|Ga0182040_10503140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 968 | Open in IMG/M |
| 3300016404|Ga0182037_12015765 | Not Available | 518 | Open in IMG/M |
| 3300017944|Ga0187786_10324114 | Not Available | 641 | Open in IMG/M |
| 3300018084|Ga0184629_10719082 | Not Available | 502 | Open in IMG/M |
| 3300018433|Ga0066667_10933560 | Not Available | 747 | Open in IMG/M |
| 3300020006|Ga0193735_1028243 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300020018|Ga0193721_1027510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1506 | Open in IMG/M |
| 3300021418|Ga0193695_1103577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 607 | Open in IMG/M |
| 3300022563|Ga0212128_10121526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1686 | Open in IMG/M |
| 3300025174|Ga0209324_10485450 | Not Available | 753 | Open in IMG/M |
| 3300025324|Ga0209640_10629882 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300025910|Ga0207684_10230860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1597 | Open in IMG/M |
| 3300025926|Ga0207659_10799258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300025932|Ga0207690_11371418 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300025939|Ga0207665_11491208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300026313|Ga0209761_1203447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 865 | Open in IMG/M |
| 3300026323|Ga0209472_1318262 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027277|Ga0209846_1008740 | Not Available | 1738 | Open in IMG/M |
| 3300027646|Ga0209466_1013266 | Not Available | 1737 | Open in IMG/M |
| 3300027909|Ga0209382_11364656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300027909|Ga0209382_11696581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300028379|Ga0268266_11019439 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300031198|Ga0307500_10031943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1197 | Open in IMG/M |
| 3300031231|Ga0170824_119799482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300031908|Ga0310900_11881667 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032180|Ga0307471_102501991 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032205|Ga0307472_100141875 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300034417|Ga0364941_085513 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.13% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.71% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.71% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.85% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1019027351 | 3300000364 | Soil | IEERKTTLKVTREVPLSEVADLSILREAQRELGITVK* |
| AF_2010_repII_A100DRAFT_10202671 | 3300000655 | Forest Soil | LVIDELKKLAKVERAISPNEVEDLSLLKEAQKEMGITVR* |
| JGI1027J11758_118502451 | 3300000789 | Soil | EAKKTAKIEREIPLSEVADLSILREAQKELGIRPR* |
| C687J26845_101180881 | 3300002223 | Soil | LEDTKRLAKQDREVSLNDVTDLSILKEAQRDLGIK* |
| Ga0066678_100640813 | 3300005181 | Soil | RLAIEEAKRVGKVDREVSLSEVADLSILKQAQKELGIAER* |
| Ga0065705_101673784 | 3300005294 | Switchgrass Rhizosphere | VAIDEARRVGKVERDVSFGEVADLSILREAQKELGITTGK* |
| Ga0073909_104934572 | 3300005526 | Surface Soil | RVAIDEERRVGKVERDVSFGEVADLSILREAEKELGITTGK* |
| Ga0070665_1007365571 | 3300005548 | Switchgrass Rhizosphere | RVAIDEARRVGKVERGVSFSEVADLSILREAQRELAVLGK* |
| Ga0066695_101901673 | 3300005553 | Soil | LIDEAKKQARVEREISPSEVADLSILREAQKELGIKTK* |
| Ga0066698_102642631 | 3300005558 | Soil | LLLVIDELRKLGKVEREISVREVADLSLLREAQKELGIK* |
| Ga0066905_1018153611 | 3300005713 | Tropical Forest Soil | LIADTKKVTKVDREIAFSEVADLSILKEAQKELGIKAR* |
| Ga0068861_1015725321 | 3300005719 | Switchgrass Rhizosphere | EAKKQTKVSRDIAPGDIADLSMLREAQKELGIRK* |
| Ga0066903_1010700641 | 3300005764 | Tropical Forest Soil | VDEAKKTAKIDREIPLNEIADLSILREAQKELGIRPK* |
| Ga0066903_1030544041 | 3300005764 | Tropical Forest Soil | LIVDEAKKTAKIDREIPLNEIADLSILREAQKELGIRPK* |
| Ga0066903_1039198612 | 3300005764 | Tropical Forest Soil | IDELKKLAKVEREITPSEIADLSLLKEAQKELVAK* |
| Ga0075292_10077882 | 3300005887 | Rice Paddy Soil | IDEAKKTAKVERTIALNEIADLSILKQAQKELAIKTK* |
| Ga0066665_104460712 | 3300006796 | Soil | ETRKAGKVSREIASSEVADLSILREAQKELGIQGR* |
| Ga0075428_1025474991 | 3300006844 | Populus Rhizosphere | EEAKRIGKVERDVSFSEVADLSILREAQKELVSGAK* |
| Ga0075421_1021647951 | 3300006845 | Populus Rhizosphere | LNIEEAKRVGKVDREISFAEVADLTILREAQKELGLKTR* |
| Ga0075433_105222213 | 3300006852 | Populus Rhizosphere | HLAIDEAKRIGKVDREVSVSEVADLSILREAQKELGISER* |
| Ga0075420_1011441602 | 3300006853 | Populus Rhizosphere | FRLLIDDAKQTAKVTRDVAVNEVADFSIVREVQRELGIMEK* |
| Ga0075426_105306231 | 3300006903 | Populus Rhizosphere | LRVAIDEARRVGKVERGVSFSEVADLSILREAQRELAVLGK* |
| Ga0075426_105904822 | 3300006903 | Populus Rhizosphere | AKRVAKINREISFAEVADLSILREAQKELGIIGR* |
| Ga0075426_111477522 | 3300006903 | Populus Rhizosphere | EAKKTAKIDREIPLSDIADLSILREAQKELGTKPK* |
| Ga0075424_1022068362 | 3300006904 | Populus Rhizosphere | LRVAIDEARRVGKVERDVSFGEVADLSILREAQKELGITTGK* |
| Ga0075419_100976913 | 3300006969 | Populus Rhizosphere | IEETKKAIKVNREVSFNEVVDLTILREAQRELGIK* |
| Ga0066710_1006030882 | 3300009012 | Grasslands Soil | LRGEKKQAKVNREVSPSEIADLSILRDAQKELGIKGR |
| Ga0105107_105751053 | 3300009087 | Freshwater Sediment | VDGFQTRLEDTKRLAKLDREVSLNDVADLLILKEAQRELGIK* |
| Ga0075418_101474963 | 3300009100 | Populus Rhizosphere | LIEEAKRAAKVEREVATNEVADLSILREAQRELGIAQR* |
| Ga0075418_108633431 | 3300009100 | Populus Rhizosphere | VAIEEAKRVGKVEREVSLNEIADLSILREAQRELGIAVK* |
| Ga0114129_103306951 | 3300009147 | Populus Rhizosphere | AKKTAKVEREISLSEIADLSILREAQKELGNRPK* |
| Ga0114129_126025011 | 3300009147 | Populus Rhizosphere | ELKKLAKVEREISPSEVADLSILGEAQKELGIGTR* |
| Ga0114129_133521672 | 3300009147 | Populus Rhizosphere | LLVIDELRKLGKVEREISVREVADLSLLREAQRELGIIGR* |
| Ga0111538_136220171 | 3300009156 | Populus Rhizosphere | IDEAKKNAKLNREVSIDQVADLSILREAQREMGIK* |
| Ga0075423_122937512 | 3300009162 | Populus Rhizosphere | LRVAIEYAKRIGKVERDVSFSEVADLSILREAQKELGSGAK* |
| Ga0105104_108609742 | 3300009168 | Freshwater Sediment | IDEAKKNAKLNREVSIDQVADLSILKEVQREVGIGGR* |
| Ga0105241_100631181 | 3300009174 | Corn Rhizosphere | IEEAKRVGKVAREVSFSEVADLSILKEAQKELGIGDR* |
| Ga0114945_107833481 | 3300009444 | Thermal Springs | VVEEAKRVAKVDREVSFSEVADLSILRKAQKELGIERR* |
| Ga0105249_110706683 | 3300009553 | Switchgrass Rhizosphere | LIDEAKKQAKVSRDVAPGDIADLSLLREAQKELGIRK* |
| Ga0126374_102195982 | 3300009792 | Tropical Forest Soil | EAKKAAKISREVASSEVADLAILREAQRELGIQGR* |
| Ga0126380_100511761 | 3300010043 | Tropical Forest Soil | EAKKTAKIDREIPLNEIADLSILREAQKELGIRPK* |
| Ga0126380_103474291 | 3300010043 | Tropical Forest Soil | IEDIKGSAKVTRDVSVSEVADLSILHEAQRELGIGGK* |
| Ga0126384_121014762 | 3300010046 | Tropical Forest Soil | EEAKRVGKVEREIAVNEVVDLTSLKEAQKELGIR* |
| Ga0134070_102467802 | 3300010301 | Grasslands Soil | LLVIDELKRLGRVEPEISLSEVEDLSLLKEAQRELGIK* |
| Ga0134111_100105521 | 3300010329 | Grasslands Soil | EAKRVGKVDREVSLSEVADLSILKQAQKELGIAER* |
| Ga0134062_103904902 | 3300010337 | Grasslands Soil | EEAKRVGKVDREVSLSEVADLSILKQAQKELGIAER* |
| Ga0126370_100259145 | 3300010358 | Tropical Forest Soil | LVIEELKKLSKVEREISLSEVADLSLLKEVQKELGIKEK* |
| Ga0126370_100867221 | 3300010358 | Tropical Forest Soil | AIDEAKRIGKVDRDVAFSEVADLSILREAQRELGISQK* |
| Ga0126370_109919272 | 3300010358 | Tropical Forest Soil | AIEEAKRIGKVDRDISFGEVADLSILREAQKELGISAK* |
| Ga0126370_115100022 | 3300010358 | Tropical Forest Soil | VEEAKRVGKVEREISLSEIADLSILKEVQRELGIAAIAIKQITE* |
| Ga0126372_108386082 | 3300010360 | Tropical Forest Soil | DELKKLAKVEREIAPSEVEDLSLLKEAQKELVAK* |
| Ga0126372_118564932 | 3300010360 | Tropical Forest Soil | IEEAKRVGKVEREIALSEVVDLTILKEAQKELGIK* |
| Ga0126377_119603531 | 3300010362 | Tropical Forest Soil | IDELKKLAKVERAISPNEVEDLSLLKEAQKDMGIQGGRN* |
| Ga0105239_100838736 | 3300010375 | Corn Rhizosphere | AIDEARRVGKVERGVSFSEVADLSILREAQRELAVLGK* |
| Ga0105239_111069291 | 3300010375 | Corn Rhizosphere | RRVGKVERDVSFGEVADLSILREAQKELGITTGK* |
| Ga0126383_109136382 | 3300010398 | Tropical Forest Soil | VIEEAKRVGKVEREIAVSEVADLTSLKEAQKELGIK* |
| Ga0126383_114632052 | 3300010398 | Tropical Forest Soil | LRLVIEEAKRVGKVEREIAVNEVVDLTSLKEAQKELGIR* |
| Ga0126383_133725961 | 3300010398 | Tropical Forest Soil | KGLLLVIDELKKLAKVEREIAPSEVEDLSLLKEAQKELVAK* |
| Ga0124844_11637391 | 3300010868 | Tropical Forest Soil | LIEETRKAGKVSREIASSEVADLSILKEAQKELGIQG |
| Ga0137382_100997331 | 3300012200 | Vadose Zone Soil | EAKRVGKVDREVSLSEGADLSILKQAQKELGIAER* |
| Ga0137380_100427241 | 3300012206 | Vadose Zone Soil | IEELKKLGKVEREIAPSDVADLSILREAQRELGIKER* |
| Ga0137381_112290761 | 3300012207 | Vadose Zone Soil | VLIEEAKKAAKLSREVASSEVADLSILREAQKELGFKVK* |
| Ga0137370_107252411 | 3300012285 | Vadose Zone Soil | VVEEAKRVGKVDREVSLSEVVHLSILREVQRELGIP |
| Ga0137367_110973361 | 3300012353 | Vadose Zone Soil | ERKKSAKVSREVSIGDVADLTILREAQRELGIKGK* |
| Ga0157344_10059791 | 3300012476 | Arabidopsis Rhizosphere | MLLVIDELKKLGKVEREISLSEVADLSILKDAQRELGITAK* |
| Ga0137394_100545341 | 3300012922 | Vadose Zone Soil | LLIEEAKRAAKVEREVAMNEVADLSILREAQRELGVAQR* |
| Ga0137394_100656441 | 3300012922 | Vadose Zone Soil | LKKLGKVEREISLSEVADLSILKDAQKELAITAK* |
| Ga0164299_100772091 | 3300012958 | Soil | GLRVAIDEERRVGKVERDVSFGEVADLSILREAQKELGITTGK* |
| Ga0126369_110938422 | 3300012971 | Tropical Forest Soil | LLIDEAKKAAKTNREIASSEVADPAILKEAQKELGIK* |
| Ga0126369_133178271 | 3300012971 | Tropical Forest Soil | DELKKLAKVEREITPSEVADLSLLKEVQKEMGITVR* |
| Ga0134087_101566673 | 3300012977 | Grasslands Soil | ETKKQAEVNREVPLNDVADISILKEAQRELGITGR* |
| Ga0164309_109659912 | 3300012984 | Soil | IEEAKRVGKVERDVSFNEVADLSILREAQRELGIAVR* |
| Ga0157378_112620041 | 3300013297 | Miscanthus Rhizosphere | AIDEARRVGKVERDVSFGEVADLSILREAQKELGITTGK* |
| Ga0180094_10377722 | 3300014881 | Soil | LLISEAKRTAKVEREISPSEVLDLALLKEAQKEMGIQGR* |
| Ga0180085_10112491 | 3300015259 | Soil | LISEAKRTAKVDREVSLSEVADLSILKEAQKELGIK* |
| Ga0134089_103353201 | 3300015358 | Grasslands Soil | LLIEEGKRQAKVEREVSAAEVADLSILKEAQKALGIRER* |
| Ga0134089_105362412 | 3300015358 | Grasslands Soil | LIDEAKKNAKLNREVSLDQVADLSILKEVQRELGIKPF* |
| Ga0132258_101500388 | 3300015371 | Arabidopsis Rhizosphere | EEAKRTAKVNREISTNEVEDLSILREVQKELGVKGR* |
| Ga0132258_108465524 | 3300015371 | Arabidopsis Rhizosphere | LIDEAKKQTKVSRDIAPGDVADLSMLREAQKELGK* |
| Ga0132256_1002146531 | 3300015372 | Arabidopsis Rhizosphere | LLIDEAKKQTKVTREVAQSDIADLSILREAQRELGMRK* |
| Ga0132256_1012388803 | 3300015372 | Arabidopsis Rhizosphere | LIDEAKKQTKGSRDIAPGDVADLSMLREAQKELGK* |
| Ga0132256_1014936722 | 3300015372 | Arabidopsis Rhizosphere | LIDEAKKQARVEREISPSEVADLSILREAQKELGIKTT* |
| Ga0132255_1010321032 | 3300015374 | Arabidopsis Rhizosphere | LMIDEAKKTAKVEREIPLTNIADLSILREAQKELGIRPK* |
| Ga0132255_1037097071 | 3300015374 | Arabidopsis Rhizosphere | MPIPANLRKQTRVSRDVSPGDIADLSLLREAQKELGIRK* |
| Ga0182036_119316671 | 3300016270 | Soil | EEAKKGAKVEREVSINEVADLSILKLAQKELGIKGK |
| Ga0182040_105031402 | 3300016387 | Soil | VVEEAKRVGKVEREISLSEIANLSILKEAQKELGIMAAR |
| Ga0182037_120157651 | 3300016404 | Soil | DEAKKATKINREIASSEVADLSILREAQKELGIKER |
| Ga0187786_103241141 | 3300017944 | Tropical Peatland | HLVIEEAQKAAKVSREISMKDLADLSILREAQRELGIK |
| Ga0184629_107190822 | 3300018084 | Groundwater Sediment | IEEARQSLKASREVSIAEVTDLSILREAQKELGIKGK |
| Ga0066667_109335602 | 3300018433 | Grasslands Soil | ETRKAGKVSREIASSEVADLSILREAQKELGIQGR |
| Ga0193735_10282431 | 3300020006 | Soil | LIDEAKKQAKVSRDIVAADIADLSMLREAQGELGLRK |
| Ga0193721_10275101 | 3300020018 | Soil | LVIDELKKLGKVEREISLSEVADLSILKEAQRELGIMTAR |
| Ga0193695_11035772 | 3300021418 | Soil | IEEAKKTAKLDREIPLNEVADLSILREAQKELGIKPR |
| Ga0212128_101215264 | 3300022563 | Thermal Springs | VVEEAKRVAKVDREVSFSEVADLSILRKAQKELGIERR |
| Ga0209324_104854501 | 3300025174 | Soil | VIDENKKVAKVDREVALSEVADLSILKQAQQELGIGKK |
| Ga0209640_106298822 | 3300025324 | Soil | LRLVIEERKKFAKIDREVSLSEVADLSILRDAQRELGKGRN |
| Ga0207684_102308601 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | IDELKKLGKVEREVSMSEVADLSILKEAQKELGITVR |
| Ga0207659_107992581 | 3300025926 | Miscanthus Rhizosphere | IIDEARKTAKVEREIPLTNVADLSILREAQKELGIRAK |
| Ga0207690_113714181 | 3300025932 | Corn Rhizosphere | LIDEAKKAAKISREITSSEFVDLSILKEAQRELGIQGR |
| Ga0207665_114912082 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LVIDELKKLAKVEREISPSEVADLSILREAQKEMGIKER |
| Ga0209469_10287121 | 3300026307 | Soil | LIEETKKQAKVNREVPLSDVADISILKEAQREFGITGR |
| Ga0209761_12034471 | 3300026313 | Grasslands Soil | VVEEAKRVGKVDGEVSLSEVADLSILKEAQKELGIRTP |
| Ga0209686_11530981 | 3300026315 | Soil | LIDEAKKNAKLNREVSLDQVADLSILKEVQRELGIKPF |
| Ga0209472_13182621 | 3300026323 | Soil | VVEEAKRVGKVDREVSLSEAVHRSILREVQRELGIAAS |
| Ga0209846_10087403 | 3300027277 | Groundwater Sand | GLNLLIELAKRDAKISREIPISEVADFSILKEAQKELGLR |
| Ga0209466_10132661 | 3300027646 | Tropical Forest Soil | LIDEAKKAAKISRAIASSEVADLSILREAQKELGIK |
| Ga0209382_113646561 | 3300027909 | Populus Rhizosphere | RLLISEAKRITKVDREVSFSEVADLSIVREAQKDLAIRK |
| Ga0209382_116965812 | 3300027909 | Populus Rhizosphere | IDELKKLGKAEREISLSEVADLSILKEAQRELGIMTAR |
| Ga0268266_110194393 | 3300028379 | Switchgrass Rhizosphere | VAIDEARRVGKVERGVSFSEVADLSILREAQRELAVLGK |
| Ga0307500_100319431 | 3300031198 | Soil | VIDELKKLGKVEREISLSEVADLSILKDAQKELGITAK |
| Ga0170824_1197994822 | 3300031231 | Forest Soil | IEEAKRTAKVTREVPINEVEDLSILKEAQRELGIK |
| Ga0310900_118816672 | 3300031908 | Soil | LVIEEAKRTAKVNREISTNEVEDLSILREVQKELGVKGR |
| Ga0307470_101533351 | 3300032174 | Hardwood Forest Soil | IFRRRTRLVIEEAKKAGNASRTFALSEVADLSILREAQELGIKSK |
| Ga0307471_1025019911 | 3300032180 | Hardwood Forest Soil | IDEAKRIGKVDRDVAFSEVADLSILKEAQRELGIPLK |
| Ga0307472_1001418751 | 3300032205 | Hardwood Forest Soil | DEAKKQTKVTREVAQSDIADLSILREAQRELGMRK |
| Ga0335069_107904153 | 3300032893 | Soil | DEAKKNAKVNREVSIDQVADLSILKEVQRELGIKEK |
| Ga0364941_085513_1_111 | 3300034417 | Sediment | EELKKLAKVDREISPSEVADLSLLKEAQKEMGIGGR |
| ⦗Top⦘ |