| Basic Information | |
|---|---|
| Family ID | F077036 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MGTKSIRHIVESTLATYLSTQTGLTTVTFLTGDSAATQTLPK |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.98 % |
| % of genes near scaffold ends (potentially truncated) | 99.15 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.829 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (34.188 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.701 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.95% β-sheet: 11.90% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF14743 | DNA_ligase_OB_2 | 11.97 |
| PF01068 | DNA_ligase_A_M | 8.55 |
| PF01343 | Peptidase_S49 | 2.56 |
| PF05136 | Phage_portal_2 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 8.55 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 8.55 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 5.13 |
| COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.81 % |
| Unclassified | root | N/A | 34.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003277|JGI25908J49247_10034818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1398 | Open in IMG/M |
| 3300003393|JGI25909J50240_1023906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1386 | Open in IMG/M |
| 3300003393|JGI25909J50240_1043439 | Not Available | 950 | Open in IMG/M |
| 3300005581|Ga0049081_10243802 | Not Available | 632 | Open in IMG/M |
| 3300005805|Ga0079957_1022869 | All Organisms → cellular organisms → Bacteria | 4308 | Open in IMG/M |
| 3300006802|Ga0070749_10181755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1211 | Open in IMG/M |
| 3300006802|Ga0070749_10183420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1204 | Open in IMG/M |
| 3300006805|Ga0075464_10886167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 557 | Open in IMG/M |
| 3300006917|Ga0075472_10168371 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300007363|Ga0075458_10031219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1688 | Open in IMG/M |
| 3300007559|Ga0102828_1035430 | Not Available | 1131 | Open in IMG/M |
| 3300007639|Ga0102865_1048503 | Not Available | 1256 | Open in IMG/M |
| 3300008266|Ga0114363_1160445 | Not Available | 736 | Open in IMG/M |
| 3300009160|Ga0114981_10140152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1336 | Open in IMG/M |
| 3300009161|Ga0114966_10787415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 514 | Open in IMG/M |
| 3300009165|Ga0105102_10273979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 866 | Open in IMG/M |
| 3300009181|Ga0114969_10062415 | Not Available | 2463 | Open in IMG/M |
| 3300010885|Ga0133913_11723910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1573 | Open in IMG/M |
| 3300010885|Ga0133913_12839565 | Not Available | 1164 | Open in IMG/M |
| 3300011010|Ga0139557_1021804 | Not Available | 1167 | Open in IMG/M |
| 3300011011|Ga0139556_1068667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 533 | Open in IMG/M |
| 3300013372|Ga0177922_10213108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 901 | Open in IMG/M |
| 3300013372|Ga0177922_10299022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1143 | Open in IMG/M |
| 3300013372|Ga0177922_10375428 | Not Available | 606 | Open in IMG/M |
| 3300013372|Ga0177922_10390376 | Not Available | 500 | Open in IMG/M |
| 3300013372|Ga0177922_11017478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 606 | Open in IMG/M |
| 3300013372|Ga0177922_11091272 | Not Available | 2298 | Open in IMG/M |
| 3300017722|Ga0181347_1041473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1410 | Open in IMG/M |
| 3300017722|Ga0181347_1120719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 733 | Open in IMG/M |
| 3300017723|Ga0181362_1024240 | Not Available | 1300 | Open in IMG/M |
| 3300017736|Ga0181365_1021109 | Not Available | 1641 | Open in IMG/M |
| 3300017736|Ga0181365_1025313 | All Organisms → Viruses → Predicted Viral | 1496 | Open in IMG/M |
| 3300017736|Ga0181365_1038671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1201 | Open in IMG/M |
| 3300017754|Ga0181344_1032174 | Not Available | 1601 | Open in IMG/M |
| 3300017766|Ga0181343_1202725 | Not Available | 543 | Open in IMG/M |
| 3300017774|Ga0181358_1044750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1689 | Open in IMG/M |
| 3300017774|Ga0181358_1159419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 764 | Open in IMG/M |
| 3300017774|Ga0181358_1179158 | Not Available | 706 | Open in IMG/M |
| 3300017777|Ga0181357_1125140 | Not Available | 962 | Open in IMG/M |
| 3300017777|Ga0181357_1282223 | Not Available | 569 | Open in IMG/M |
| 3300017777|Ga0181357_1297044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 549 | Open in IMG/M |
| 3300017778|Ga0181349_1164107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 790 | Open in IMG/M |
| 3300017778|Ga0181349_1230056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 628 | Open in IMG/M |
| 3300017778|Ga0181349_1257902 | Not Available | 579 | Open in IMG/M |
| 3300017780|Ga0181346_1023344 | Not Available | 2591 | Open in IMG/M |
| 3300017784|Ga0181348_1149296 | Not Available | 876 | Open in IMG/M |
| 3300017784|Ga0181348_1184799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 758 | Open in IMG/M |
| 3300017784|Ga0181348_1256391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 603 | Open in IMG/M |
| 3300017785|Ga0181355_1101829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1187 | Open in IMG/M |
| 3300017785|Ga0181355_1121445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1069 | Open in IMG/M |
| 3300017785|Ga0181355_1204501 | Not Available | 774 | Open in IMG/M |
| 3300017785|Ga0181355_1244349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 690 | Open in IMG/M |
| 3300019784|Ga0181359_1074369 | Not Available | 1283 | Open in IMG/M |
| 3300020048|Ga0207193_1582487 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300020160|Ga0211733_11006898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2105 | Open in IMG/M |
| 3300020162|Ga0211735_11269878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1632 | Open in IMG/M |
| 3300020205|Ga0211731_10907581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 660 | Open in IMG/M |
| 3300020205|Ga0211731_11416347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 615 | Open in IMG/M |
| 3300020205|Ga0211731_11731903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 986 | Open in IMG/M |
| 3300020524|Ga0208858_1026219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 859 | Open in IMG/M |
| 3300021962|Ga0222713_10436699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 797 | Open in IMG/M |
| 3300021963|Ga0222712_10019239 | All Organisms → cellular organisms → Bacteria | 5748 | Open in IMG/M |
| 3300021963|Ga0222712_10186894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1367 | Open in IMG/M |
| 3300022179|Ga0181353_1127959 | Not Available | 602 | Open in IMG/M |
| 3300022190|Ga0181354_1053933 | Not Available | 1338 | Open in IMG/M |
| 3300022190|Ga0181354_1119271 | Not Available | 849 | Open in IMG/M |
| 3300022407|Ga0181351_1099793 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300022407|Ga0181351_1225524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 604 | Open in IMG/M |
| 3300022543|Ga0212119_1043157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 714 | Open in IMG/M |
| 3300024346|Ga0244775_11087948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 627 | Open in IMG/M |
| 3300024346|Ga0244775_11516503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 512 | Open in IMG/M |
| 3300025749|Ga0256314_1033418 | Not Available | 756 | Open in IMG/M |
| 3300025889|Ga0208644_1103238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1398 | Open in IMG/M |
| 3300025889|Ga0208644_1202802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 860 | Open in IMG/M |
| 3300025896|Ga0208916_10118393 | Not Available | 1128 | Open in IMG/M |
| 3300027131|Ga0255066_1003398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2696 | Open in IMG/M |
| 3300027147|Ga0255113_1003793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3908 | Open in IMG/M |
| 3300027193|Ga0208800_1039328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 639 | Open in IMG/M |
| 3300027212|Ga0208554_1023541 | Not Available | 998 | Open in IMG/M |
| 3300027600|Ga0255117_1002456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5259 | Open in IMG/M |
| 3300027631|Ga0208133_1079424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 773 | Open in IMG/M |
| 3300027631|Ga0208133_1160768 | Not Available | 517 | Open in IMG/M |
| 3300027659|Ga0208975_1210334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 516 | Open in IMG/M |
| 3300027688|Ga0209553_1168803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 732 | Open in IMG/M |
| 3300027733|Ga0209297_1062226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1662 | Open in IMG/M |
| 3300027733|Ga0209297_1263601 | Not Available | 656 | Open in IMG/M |
| 3300027736|Ga0209190_1029877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2935 | Open in IMG/M |
| 3300027756|Ga0209444_10108718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1120 | Open in IMG/M |
| 3300027764|Ga0209134_10250981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 606 | Open in IMG/M |
| 3300027797|Ga0209107_10078715 | Not Available | 1803 | Open in IMG/M |
| 3300027797|Ga0209107_10131839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1298 | Open in IMG/M |
| 3300027797|Ga0209107_10156936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1157 | Open in IMG/M |
| 3300027808|Ga0209354_10092624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1232 | Open in IMG/M |
| 3300027808|Ga0209354_10156455 | Not Available | 929 | Open in IMG/M |
| 3300027808|Ga0209354_10285404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 658 | Open in IMG/M |
| 3300027836|Ga0209230_10467980 | Not Available | 717 | Open in IMG/M |
| 3300027900|Ga0209253_10358141 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300027900|Ga0209253_10874993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 632 | Open in IMG/M |
| 3300031746|Ga0315293_10402579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1076 | Open in IMG/M |
| 3300031746|Ga0315293_10864646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 656 | Open in IMG/M |
| 3300031772|Ga0315288_10400322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1391 | Open in IMG/M |
| 3300031857|Ga0315909_10124254 | Not Available | 2174 | Open in IMG/M |
| 3300031952|Ga0315294_10385664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1316 | Open in IMG/M |
| 3300031952|Ga0315294_10553478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1040 | Open in IMG/M |
| 3300031997|Ga0315278_11300355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 709 | Open in IMG/M |
| 3300031999|Ga0315274_10566727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1264 | Open in IMG/M |
| 3300032050|Ga0315906_10163216 | Not Available | 2138 | Open in IMG/M |
| 3300032053|Ga0315284_10684599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1207 | Open in IMG/M |
| 3300032173|Ga0315268_11142133 | Not Available | 787 | Open in IMG/M |
| 3300033233|Ga0334722_11332470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 501 | Open in IMG/M |
| 3300034050|Ga0335023_0189149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1156 | Open in IMG/M |
| 3300034050|Ga0335023_0473399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 652 | Open in IMG/M |
| 3300034062|Ga0334995_0459554 | Not Available | 778 | Open in IMG/M |
| 3300034071|Ga0335028_0502875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 670 | Open in IMG/M |
| 3300034092|Ga0335010_0313391 | Not Available | 894 | Open in IMG/M |
| 3300034200|Ga0335065_0049372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2933 | Open in IMG/M |
| 3300034200|Ga0335065_0811930 | Not Available | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 34.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.26% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.55% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.84% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.98% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.42% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.42% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.42% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.56% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.71% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.85% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.85% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.85% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.85% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025749 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25908J49247_100348183 | 3300003277 | Freshwater Lake | MGTRSIRHIVESTVATYLSTQTGLTTVSFLTGDNNATQTLPKAVVLCEA |
| JGI25909J50240_10239061 | 3300003393 | Freshwater Lake | MGTRSIRHIVESTVATYLSTQTGLTTVSFLTGDNNATQTLPKAVV |
| JGI25909J50240_10434392 | 3300003393 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTGLTTVSFLTGDNNATQTLPKA |
| Ga0049081_102438021 | 3300005581 | Freshwater Lentic | MGTASIRHIVESTLATYLSTQTGLTTVSFLTGDNAATQTLPK |
| Ga0079957_10228697 | 3300005805 | Lake | MGTKSIRHIVESTLATYLSTQTGLTTVTFLTGDSAATQT |
| Ga0070749_101817551 | 3300006802 | Aqueous | MGTKSIRHIVEATLASYLSTQTDLTTVQFLTGDSAVTQTLPKAVV |
| Ga0070749_101834201 | 3300006802 | Aqueous | MGTKSIRHIVEATLASYLSTQTDLTTVQFLTGDSAVTQ |
| Ga0075464_108861671 | 3300006805 | Aqueous | MGTKSIRHIVESTVATYLSTQTDLTTVTFLTGDSA |
| Ga0075472_101683712 | 3300006917 | Aqueous | MGTKSIRHIVESTLATYLSTQTGLTTVTFLTGDSAATQTLPK |
| Ga0075458_100312191 | 3300007363 | Aqueous | MGTKSIRHIVEATLATYLSTQTGLTTVTFLTGDSAATQT |
| Ga0102828_10354302 | 3300007559 | Estuarine | MPASIRHIVESTLATYLSTQTGLTTVSFLTGDNAATQTLP |
| Ga0102865_10485033 | 3300007639 | Estuarine | MPASIRHIVESTLATYLSTQTGLTTVSFLTGDNAATQTLPKAVVLCD |
| Ga0114363_11604451 | 3300008266 | Freshwater, Plankton | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDSAATQTLPKAVVLCDSAR |
| Ga0114981_101401521 | 3300009160 | Freshwater Lake | MGTASIRHIVEATVATYLSTQTGLTTVTFLTGDSAATQTLPKAVV |
| Ga0114966_107874152 | 3300009161 | Freshwater Lake | MGTASIRHIVEATVATYLSTQTGLTTVSFLTGDNNATQTL |
| Ga0105102_102739792 | 3300009165 | Freshwater Sediment | MGTKSIRHIVEATLATYLSTQTGLTTVTFLTGDSAA |
| Ga0114969_100624151 | 3300009181 | Freshwater Lake | MGAKSIRHIIESTVATYLATQTDLTTVTFLTGDSAATQTLPKAVVLCES |
| Ga0133913_117239103 | 3300010885 | Freshwater Lake | MGTASIRHIVESTVATYLSTQTGLTTVTFLTGDSAATQTLPKAVVLCES |
| Ga0133913_128395653 | 3300010885 | Freshwater Lake | MGTASIRHIVEATVATYLSTQTGLTTVTFLTGDNNAIQTLP |
| Ga0139557_10218042 | 3300011010 | Freshwater | MGTASIRHIVEATVATYLSTQTGLTTVSFLTGDNNATQTLPKAVVLCEAARAP |
| Ga0139556_10686671 | 3300011011 | Freshwater | MGTRSIRHIVEATVATYLSTQTGLTAVTFLTGDNAATQTLPKA |
| Ga0177922_102131082 | 3300013372 | Freshwater | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNNAIQTLPKAVVLCDSA |
| Ga0177922_102990222 | 3300013372 | Freshwater | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNA |
| Ga0177922_103754281 | 3300013372 | Freshwater | MGTKSIRHICESTLATYLSTQTGLTTVSFLTGDNAATQTLPKA |
| Ga0177922_103903762 | 3300013372 | Freshwater | MGTASIRHIVEATVATYLSTQTGLTTVTFLTGDNNAIQTLPKAVVLCDSA |
| Ga0177922_110174781 | 3300013372 | Freshwater | MGTKSIRHIVESTLATYLSTQTGLTTVTFLTGDSAATQTLPKAVVLCDSAR |
| Ga0177922_110912721 | 3300013372 | Freshwater | MGTASIRHIVESTLATYLSTQTGLTTVSFLTGDNAATQTLPKA |
| Ga0181347_10414731 | 3300017722 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTAVTFLTGDNAAIQTLPKAVVLCD |
| Ga0181347_11207192 | 3300017722 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTNLTTVSFLTGDNNATQTLPKAVVLC |
| Ga0181362_10242401 | 3300017723 | Freshwater Lake | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNAAIQTLPKAVVLCD |
| Ga0181365_10211093 | 3300017736 | Freshwater Lake | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNAAI |
| Ga0181365_10253133 | 3300017736 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTGLTTVSFLTGDNNATQTLPKAVVLCEAA |
| Ga0181365_10386711 | 3300017736 | Freshwater Lake | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNNATQTLPKAVVLCEAARAPSD |
| Ga0181344_10321741 | 3300017754 | Freshwater Lake | MGTKSIRHIVEATLATYLSTQTGLTAVTFLTGDSAATQT |
| Ga0181343_12027252 | 3300017766 | Freshwater Lake | MGTKSIRHIVESTLATYLAAQTDLTTIAFLTGDSAATQTLPKA |
| Ga0181358_10447501 | 3300017774 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNSAIQTL |
| Ga0181358_11594192 | 3300017774 | Freshwater Lake | MGTKSIRHIVEATVATYLSTQTGLTTVSFLTGDNNATQTLPKAVVLCE |
| Ga0181358_11791581 | 3300017774 | Freshwater Lake | MGTASIRHIVEYTLATYLSTQTGLTTVSFLTGDNAATQTLPKAVVLCDSARP |
| Ga0181357_11251402 | 3300017777 | Freshwater Lake | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNAAIQT |
| Ga0181357_12822231 | 3300017777 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTGLTTVSFLTGDNNATQTLPKAVV |
| Ga0181357_12970441 | 3300017777 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTNLTTVSFLTGDNNATQTLPKAVVLCEAARAP |
| Ga0181349_11641072 | 3300017778 | Freshwater Lake | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNNATQT |
| Ga0181349_12300561 | 3300017778 | Freshwater Lake | MGTASIRHIVEATVATYLSTQTGLTTVSFLTGDNN |
| Ga0181349_12579021 | 3300017778 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTGLTTVSFLTGDNNATQT |
| Ga0181346_10233441 | 3300017780 | Freshwater Lake | MGTKSIRHIVEATVATYLSTQTGLTTVSFLTGDNNATQTLPKAVVLCEAARAP |
| Ga0181348_11492962 | 3300017784 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNNATQTLPK |
| Ga0181348_11847991 | 3300017784 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNAAIQTLPKAVVLCDSA |
| Ga0181348_12563911 | 3300017784 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNAAIQTLPKAVV |
| Ga0181355_11018291 | 3300017785 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTGLTTVSFLTGNNNATQTLPK |
| Ga0181355_11214452 | 3300017785 | Freshwater Lake | MGTASIRHIVEATVATYLSTQTGLTTVSFLTGDNNATQ |
| Ga0181355_12045011 | 3300017785 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNNATQTL |
| Ga0181355_12443491 | 3300017785 | Freshwater Lake | MGTASIRHIVESTVATYLSTQTGLTTVSFLTGDNNATQTLPKAV |
| Ga0181359_10743691 | 3300019784 | Freshwater Lake | MGTKSIRHIVEATVATYLSTQTGLTTVSFLTGDNNAT |
| Ga0207193_15824872 | 3300020048 | Freshwater Lake Sediment | MGTRSIRHIVESTLATYLSAQAGLAGVALLTGDSAATQTLPKAVVLXXXXXXX |
| Ga0211733_110068983 | 3300020160 | Freshwater | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNAATQTL |
| Ga0211735_112698784 | 3300020162 | Freshwater | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDSAATQTL |
| Ga0211731_109075811 | 3300020205 | Freshwater | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNA |
| Ga0211731_114163472 | 3300020205 | Freshwater | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNAATQ |
| Ga0211731_117319031 | 3300020205 | Freshwater | MGTASIRHIVESTLATYLSTQTGLTTVTFLTGDNAATQTLPKA |
| Ga0208858_10262192 | 3300020524 | Freshwater | MGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSATIQTLPKAVVLC |
| Ga0222713_104366991 | 3300021962 | Estuarine Water | MGTKSIRHIVESTLATYLSTQTGLTSVTFLTGDSAATQTLPKAIVLCESA |
| Ga0222712_100192398 | 3300021963 | Estuarine Water | MGTKSIRHIVESTLATYLVAQTDLTSIAFLTGDSAATQTLPKAIVLC |
| Ga0222712_101868941 | 3300021963 | Estuarine Water | MGTKSIRHIVESTLATYLSTQTGLTTVQFLTGDSAATQTLPKAVVLCDSARA |
| Ga0181353_11279592 | 3300022179 | Freshwater Lake | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNAAIQTLPKAVV |
| Ga0181354_10539333 | 3300022190 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNNATQTLPKAVVL |
| Ga0181354_11192711 | 3300022190 | Freshwater Lake | MGTASIRHIVEYTLATYLSTQTGLTTVSFLTGDNAATQTLPKAV |
| Ga0181351_10997931 | 3300022407 | Freshwater Lake | MGTASIRHIVESTVATYLSTQTGLTTVTFLTGDNNATQTLP |
| Ga0181351_12255241 | 3300022407 | Freshwater Lake | MGTASIRHIVESTVATYLSTQTGLTTVSFLTGDNNA |
| Ga0212119_10431572 | 3300022543 | Freshwater | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNAATQTLPKAVVLCESARA |
| Ga0244775_110879481 | 3300024346 | Estuarine | MGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSAATQTLP |
| Ga0244775_115165032 | 3300024346 | Estuarine | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDSAATQTLPKAVVLCESAR |
| Ga0256314_10334184 | 3300025749 | Freshwater | MGTKSIRHIVESTLATYLSTQTGLTTVSFLTGDSAATQTLPKAVVLCDSA |
| Ga0208644_11032383 | 3300025889 | Aqueous | MGTKSIRHIVEATLASYLSTQTDLTTVQFLTGDSAV |
| Ga0208644_12028021 | 3300025889 | Aqueous | MGTKSIRHIVEATLATYLSTQTDLTTVQFLTGDSAVTQTLPKAVVLCDSA |
| Ga0208916_101183931 | 3300025896 | Aqueous | MGTKSIRHIVEATVATYLSTQTDLTTVTFLTGDSAATQTLPKAVVL |
| Ga0255066_10033981 | 3300027131 | Freshwater | MGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSAATQTLPKAVV |
| Ga0255113_10037931 | 3300027147 | Freshwater | MGTKSIRHIVESTLATYLSTQTGLTTVSFLTGDSAATQT |
| Ga0208800_10393282 | 3300027193 | Estuarine | MGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSAATQTLPKAVVLC |
| Ga0208554_10235411 | 3300027212 | Estuarine | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDNNATQTLPKAVVLCE |
| Ga0255117_10024567 | 3300027600 | Freshwater | MGTKSIRHIVESTLATYLSTQTGLTTVSFLTGDSAATQTLPKAVVLCDSARP |
| Ga0208133_10794241 | 3300027631 | Estuarine | MGTKSIRHIVEATVATYLSTQTGLTTVSFLTGDSNVTQTLP |
| Ga0208133_11607682 | 3300027631 | Estuarine | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDSAATQTLPKAVVLCE |
| Ga0208975_12103341 | 3300027659 | Freshwater Lentic | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDNNATQTLPKAVVL |
| Ga0209553_11688031 | 3300027688 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNNATQTLPKAVV |
| Ga0209297_10622261 | 3300027733 | Freshwater Lake | MGTRSIRHVVEATLATYLSTQTGLTTVQFLTGDSNVTQTLPKAV |
| Ga0209297_12636011 | 3300027733 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTDLTTITFLTGDSAATQTLPKAV |
| Ga0209190_10298771 | 3300027736 | Freshwater Lake | MGTASIRHIVEATVATYLSTQTGLTTVTFLTGDNNAIQT |
| Ga0209444_101087182 | 3300027756 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTGLTTVSFLTGDNNATQTLP |
| Ga0209134_102509812 | 3300027764 | Freshwater Lake | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDNN |
| Ga0209107_100787151 | 3300027797 | Freshwater And Sediment | MGTASIRHIVESTLATYLSTQTGLTTVSFLTGDNAATQTLP |
| Ga0209107_101318393 | 3300027797 | Freshwater And Sediment | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNAAIQTLPKAVVLCDSAR |
| Ga0209107_101569363 | 3300027797 | Freshwater And Sediment | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDSAAT |
| Ga0209354_100926241 | 3300027808 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNAAIQTLPKAVVLCDR |
| Ga0209354_101564552 | 3300027808 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNNATQTLPKAVVLCESARA |
| Ga0209354_102854041 | 3300027808 | Freshwater Lake | MGTKSIRHICESTLATYLSTQTGLTTVTFLTGDNSAIQ |
| Ga0209230_104679801 | 3300027836 | Freshwater And Sediment | MGTKSIRHIVESTVATYLSTQTGLTTVSFLTGDNN |
| Ga0209253_103581411 | 3300027900 | Freshwater Lake Sediment | MGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSAAT |
| Ga0209253_108749931 | 3300027900 | Freshwater Lake Sediment | MGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSAATQTL |
| Ga0315293_104025791 | 3300031746 | Sediment | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNNATQTLPK |
| Ga0315293_108646461 | 3300031746 | Sediment | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDSAATQTLP |
| Ga0315288_104003221 | 3300031772 | Sediment | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNNATQTLPKAVVL |
| Ga0315909_101242544 | 3300031857 | Freshwater | MGTKSIRHIVEATLATYLSTQTGLTTVTFLTGDSSATQ |
| Ga0315294_103856641 | 3300031952 | Sediment | MGTLSIRHIVESTVATYLSTQTGLTTVTFLTGDNAAIQT |
| Ga0315294_105534782 | 3300031952 | Sediment | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDNNA |
| Ga0315278_113003551 | 3300031997 | Sediment | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNNATQTLP |
| Ga0315274_105667273 | 3300031999 | Sediment | MPASIRHIVESTLATYLSTQTGLTTVSFLTGDNAATQTLPKAVVLCDSARP |
| Ga0315906_101632161 | 3300032050 | Freshwater | MGTKSIRHIVEATLATYLSTQTGLTTVTFLTGDSS |
| Ga0315284_106845991 | 3300032053 | Sediment | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNNATQTLPKAVVLCE |
| Ga0315268_111421332 | 3300032173 | Sediment | MGTKSIRHIVESTVATYLSTQTGLTTVTFLTGDNNATQTLPKAVV |
| Ga0334722_113324702 | 3300033233 | Sediment | MGTKSIRHIVEATVATYLSTQTGLTTVTFLTGDNNA |
| Ga0335023_0189149_1025_1156 | 3300034050 | Freshwater | MGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSAAIQTLPKAV |
| Ga0335023_0473399_3_128 | 3300034050 | Freshwater | MGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSATIQTLPK |
| Ga0334995_0459554_663_776 | 3300034062 | Freshwater | MPASIRHIVESTLATYLSTQTGLTTVSFLTGDNAATQT |
| Ga0335028_0502875_3_128 | 3300034071 | Freshwater | MGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSAATQTLPK |
| Ga0335010_0313391_3_107 | 3300034092 | Freshwater | MGTKSIRHICESTLATYLSTQTGLTSVAFLTGDSA |
| Ga0335065_0049372_3_134 | 3300034200 | Freshwater | MGTKSIRHICESTLATYLSTQTGLTTVAFLTGDSAATQTLPKAV |
| Ga0335065_0811930_3_107 | 3300034200 | Freshwater | MPASIRHIVESTLATYLSTQTGLTTVSFLTGDNAA |
| ⦗Top⦘ |