| Basic Information | |
|---|---|
| Family ID | F076960 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GGSGIVVIRYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.75 % |
| % of genes near scaffold ends (potentially truncated) | 95.73 % |
| % of genes from short scaffolds (< 2000 bps) | 82.05 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.73 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.718 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (29.060 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (87.179 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.77% Coil/Unstructured: 71.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.73 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| b.30.5.10: Rhamnogalacturonase B, RhgB, N-terminal domain | d3njxa1 | 3njx | 0.65188 |
| d.58.5.0: automated matches | d2dcla_ | 2dcl | 0.64473 |
| b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like | d2g3ma1 | 2g3m | 0.64224 |
| d.58.32.6: Alditol oxidase | d2vfra1 | 2vfr | 0.64039 |
| d.74.4.1: GAD domain | d1l0wa2 | 1l0w | 0.63966 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 12.82 |
| PF01541 | GIY-YIG | 1.71 |
| PF00622 | SPRY | 0.85 |
| PF13884 | Peptidase_S74 | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.28 % |
| Unclassified | root | N/A | 48.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c042094 | Not Available | 601 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c027145 | Not Available | 602 | Open in IMG/M |
| 3300003815|Ga0007856_1004807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
| 3300004807|Ga0007809_10046956 | Not Available | 1417 | Open in IMG/M |
| 3300004807|Ga0007809_10100738 | Not Available | 881 | Open in IMG/M |
| 3300005581|Ga0049081_10023082 | All Organisms → Viruses → Predicted Viral | 2360 | Open in IMG/M |
| 3300005581|Ga0049081_10128369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300006100|Ga0007806_1021392 | Not Available | 1356 | Open in IMG/M |
| 3300006101|Ga0007810_1011285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2214 | Open in IMG/M |
| 3300006112|Ga0007857_1086985 | Not Available | 572 | Open in IMG/M |
| 3300006115|Ga0007816_1145798 | Not Available | 510 | Open in IMG/M |
| 3300006875|Ga0075473_10192103 | Not Available | 824 | Open in IMG/M |
| 3300007550|Ga0102880_1198624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300007559|Ga0102828_1018241 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
| 3300008113|Ga0114346_1159214 | Not Available | 954 | Open in IMG/M |
| 3300008258|Ga0114840_1059643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300008259|Ga0114841_1155083 | Not Available | 899 | Open in IMG/M |
| 3300008448|Ga0114876_1086159 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
| 3300008450|Ga0114880_1107444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
| 3300009068|Ga0114973_10477091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300009151|Ga0114962_10015192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5537 | Open in IMG/M |
| 3300009154|Ga0114963_10558577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300009155|Ga0114968_10025482 | All Organisms → Viruses → Predicted Viral | 4022 | Open in IMG/M |
| 3300009160|Ga0114981_10279764 | Not Available | 907 | Open in IMG/M |
| 3300009180|Ga0114979_10019481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4337 | Open in IMG/M |
| 3300009182|Ga0114959_10440827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300009182|Ga0114959_10533692 | Not Available | 564 | Open in IMG/M |
| 3300009182|Ga0114959_10650961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300009183|Ga0114974_10016518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5271 | Open in IMG/M |
| 3300009184|Ga0114976_10288863 | Not Available | 880 | Open in IMG/M |
| 3300009502|Ga0114951_10410885 | Not Available | 673 | Open in IMG/M |
| 3300010158|Ga0114960_10246891 | Not Available | 913 | Open in IMG/M |
| 3300010160|Ga0114967_10098328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1707 | Open in IMG/M |
| 3300010334|Ga0136644_10052930 | All Organisms → cellular organisms → Bacteria | 2613 | Open in IMG/M |
| 3300010334|Ga0136644_10117194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1643 | Open in IMG/M |
| 3300010334|Ga0136644_10583433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300010885|Ga0133913_10173538 | Not Available | 5757 | Open in IMG/M |
| 3300010885|Ga0133913_10631321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2810 | Open in IMG/M |
| 3300010885|Ga0133913_11713725 | Not Available | 1578 | Open in IMG/M |
| 3300010885|Ga0133913_12860019 | Not Available | 1159 | Open in IMG/M |
| 3300010885|Ga0133913_13180555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300010970|Ga0137575_10003200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3129 | Open in IMG/M |
| 3300012013|Ga0153805_1087380 | Not Available | 529 | Open in IMG/M |
| 3300013093|Ga0164296_1145296 | Not Available | 950 | Open in IMG/M |
| 3300013093|Ga0164296_1326513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300013094|Ga0164297_10056725 | Not Available | 1863 | Open in IMG/M |
| 3300015050|Ga0181338_1003428 | All Organisms → Viruses → Predicted Viral | 2764 | Open in IMG/M |
| 3300017701|Ga0181364_1030298 | Not Available | 876 | Open in IMG/M |
| 3300017707|Ga0181363_1067072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300017716|Ga0181350_1053553 | Not Available | 1066 | Open in IMG/M |
| 3300017722|Ga0181347_1026449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1817 | Open in IMG/M |
| 3300017736|Ga0181365_1047212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
| 3300017754|Ga0181344_1080842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300017754|Ga0181344_1096787 | Not Available | 859 | Open in IMG/M |
| 3300017754|Ga0181344_1226907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300017774|Ga0181358_1226645 | Not Available | 598 | Open in IMG/M |
| 3300017777|Ga0181357_1039200 | All Organisms → Viruses → Predicted Viral | 1862 | Open in IMG/M |
| 3300017777|Ga0181357_1085126 | Not Available | 1208 | Open in IMG/M |
| 3300017777|Ga0181357_1139286 | Not Available | 900 | Open in IMG/M |
| 3300017777|Ga0181357_1173853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300017778|Ga0181349_1157958 | Not Available | 810 | Open in IMG/M |
| 3300017780|Ga0181346_1026348 | All Organisms → Viruses → Predicted Viral | 2427 | Open in IMG/M |
| 3300017780|Ga0181346_1099275 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
| 3300017780|Ga0181346_1171585 | Not Available | 799 | Open in IMG/M |
| 3300017784|Ga0181348_1075190 | Not Available | 1346 | Open in IMG/M |
| 3300017784|Ga0181348_1321651 | Not Available | 512 | Open in IMG/M |
| 3300017785|Ga0181355_1147390 | Not Available | 952 | Open in IMG/M |
| 3300017785|Ga0181355_1297152 | Not Available | 607 | Open in IMG/M |
| 3300021138|Ga0214164_1094409 | Not Available | 571 | Open in IMG/M |
| 3300021354|Ga0194047_10117840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1111 | Open in IMG/M |
| 3300021519|Ga0194048_10068852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1395 | Open in IMG/M |
| 3300021962|Ga0222713_10404449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300021963|Ga0222712_10434931 | Not Available | 790 | Open in IMG/M |
| 3300022190|Ga0181354_1075808 | Not Available | 1113 | Open in IMG/M |
| 3300022190|Ga0181354_1082665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
| 3300022190|Ga0181354_1095239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300022190|Ga0181354_1134937 | Not Available | 783 | Open in IMG/M |
| 3300022407|Ga0181351_1037271 | Not Available | 2058 | Open in IMG/M |
| 3300022407|Ga0181351_1228905 | Not Available | 597 | Open in IMG/M |
| 3300023174|Ga0214921_10186917 | All Organisms → Viruses → Predicted Viral | 1322 | Open in IMG/M |
| 3300023174|Ga0214921_10264387 | Not Available | 994 | Open in IMG/M |
| 3300024346|Ga0244775_10311315 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300024346|Ga0244775_10973176 | Not Available | 671 | Open in IMG/M |
| 3300025369|Ga0208382_1039303 | Not Available | 563 | Open in IMG/M |
| 3300025383|Ga0208250_1015287 | Not Available | 1356 | Open in IMG/M |
| 3300025387|Ga0207959_1051930 | Not Available | 616 | Open in IMG/M |
| 3300025396|Ga0208874_1051450 | Not Available | 572 | Open in IMG/M |
| 3300025450|Ga0208744_1007788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2477 | Open in IMG/M |
| 3300025778|Ga0208388_1000663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7393 | Open in IMG/M |
| 3300025781|Ga0208386_1054620 | Not Available | 533 | Open in IMG/M |
| 3300027732|Ga0209442_1135330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300027732|Ga0209442_1206061 | Not Available | 725 | Open in IMG/M |
| 3300027749|Ga0209084_1127715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
| 3300027749|Ga0209084_1197289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300027749|Ga0209084_1227437 | Not Available | 736 | Open in IMG/M |
| 3300027759|Ga0209296_1019847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3844 | Open in IMG/M |
| 3300027760|Ga0209598_10116515 | Not Available | 1230 | Open in IMG/M |
| 3300027763|Ga0209088_10226403 | Not Available | 787 | Open in IMG/M |
| 3300027763|Ga0209088_10339452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300027770|Ga0209086_10115527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1348 | Open in IMG/M |
| 3300027798|Ga0209353_10085188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
| 3300027808|Ga0209354_10026598 | All Organisms → Viruses → Predicted Viral | 2309 | Open in IMG/M |
| 3300027963|Ga0209400_1153616 | Not Available | 1000 | Open in IMG/M |
| 3300027963|Ga0209400_1270365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300028025|Ga0247723_1019301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2337 | Open in IMG/M |
| 3300028394|Ga0304730_1060988 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
| 3300028394|Ga0304730_1071852 | All Organisms → Viruses → Predicted Viral | 1592 | Open in IMG/M |
| 3300028394|Ga0304730_1149731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300031746|Ga0315293_10315346 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
| 3300031772|Ga0315288_11075759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300031784|Ga0315899_10763358 | Not Available | 890 | Open in IMG/M |
| 3300032050|Ga0315906_10548907 | Not Available | 965 | Open in IMG/M |
| 3300032173|Ga0315268_10719603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300034018|Ga0334985_0358683 | Not Available | 889 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 29.06% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 27.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 11.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.56% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.56% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.56% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.71% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.71% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.71% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.71% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.71% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.85% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.85% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.85% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0420942 | 3300000176 | Freshwater | IVVIRYPSYLKQATSTTGSPTTYIAGPWRVYVFYASGTITF* |
| TB18AUG2009E_0271452 | 3300000203 | Freshwater | IVVIRYPAYLSKAIATTGSPTTYIAGPYRVYVFYASGTITF* |
| Ga0007856_10048071 | 3300003815 | Freshwater | GGSGIVVLRYPAYLKQAASTTGSPTYYQAGGWNVYVFYASGTITF* |
| Ga0007809_100469561 | 3300004807 | Freshwater | GGSGIVVIRYPSYLKQAASTTGSPTTYIAGPYRVYVFYASGSITF* |
| Ga0007809_101007381 | 3300004807 | Freshwater | GGSGIVVIRYPAYLKQATSTTGSPTTYIAGPWRVYVFYASGTITF* |
| Ga0049081_100230821 | 3300005581 | Freshwater Lentic | SGIVILRYPSYLLPAASTTGSPETYTIGGWRVYKFVASGTITF* |
| Ga0049081_101283691 | 3300005581 | Freshwater Lentic | IRYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF* |
| Ga0007806_10213921 | 3300006100 | Freshwater | SNKLNYVYGGAGGSGVVVIRYPSYLAPAASVTGSPATYIAGPYRVYGWVVSGTITF* |
| Ga0007810_10112851 | 3300006101 | Freshwater | GGSGIVVLRYPAYLKQAASTTGSPTTYIAGPYRVYVFYASGTITF* |
| Ga0007857_10869851 | 3300006112 | Freshwater | SNGVTCYAGKGGSGIVVIRYPSYQSPAANTTGSPTTYISPPYRVYVFYASGSITF* |
| Ga0007816_11457982 | 3300006115 | Freshwater | SGGSGGSGIVVIRYPSYLAPAVSSTGSPTTYVSLGYRVYIFYASGTITF* |
| Ga0075473_101921032 | 3300006875 | Aqueous | IRYPSYLAPAASTTGSPETYITGAWRVYKFVASGTITF* |
| Ga0102880_11986242 | 3300007550 | Estuarine | SSGNNYFGGSGGSGIVVIRYPSYLAPATSTTGSPETYVTGAWRVYRFVASGTITF* |
| Ga0102828_10182411 | 3300007559 | Estuarine | GGSGIVVIRYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF* |
| Ga0114346_11592141 | 3300008113 | Freshwater, Plankton | GNGGSGIVIIRYPSYLLPAASTTGSPETYIAGQYRVYKFIASGTITF* |
| Ga0114840_10596432 | 3300008258 | Freshwater, Plankton | VILRYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF* |
| Ga0114841_11550832 | 3300008259 | Freshwater, Plankton | TAGYYGSGAGGSGIVIIRYPSYLLPAASTTGSPETYIAGQYRVYKFVANGTITF* |
| Ga0114876_10861591 | 3300008448 | Freshwater Lake | SGIVILRYPSYLAPATSTTGSPETYVSGNYRVYKFVASGTITF* |
| Ga0114880_11074441 | 3300008450 | Freshwater Lake | RYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF* |
| Ga0114973_104770913 | 3300009068 | Freshwater Lake | TSGLVGGAGGSGIVVIRYPSYLAPATSTTGSPETYVTGAWRVYRFVASGTITF* |
| Ga0114962_100151921 | 3300009151 | Freshwater Lake | NGGSGIVIVRYPSYYLQAASTTGSPVYYQISGYNIYIFYASGTITF* |
| Ga0114963_105585772 | 3300009154 | Freshwater Lake | SGAISYGAAGGSGIVVIRYPSYLSQATSTTGSPSYYQALGYNVYVFYASGTITF* |
| Ga0114968_100254826 | 3300009155 | Freshwater Lake | VIIRYPSYLAPATSTTGSPETYVTGAWRVYKFVASGTITF* |
| Ga0114981_102797643 | 3300009160 | Freshwater Lake | VVIRYPSFYAPAKSTTGSPETYVVNGWRVYEFLQSGTITF* |
| Ga0114979_100194814 | 3300009180 | Freshwater Lake | YGLAGAGGSGIVVIRYPSYLTQATSTTGSPTYYQAGGYNVYVFNASGTITF* |
| Ga0114959_104408271 | 3300009182 | Freshwater Lake | AAGGSGIVVIRYPSYLSQATSTTGSPSYYQALGYNVYVFNASGTITF* |
| Ga0114959_105336922 | 3300009182 | Freshwater Lake | YGASGAGGSGIVFIRYPSYFAQASSTTGSPNYYQASGYNVYIFYASGTITF* |
| Ga0114959_106509612 | 3300009182 | Freshwater Lake | GAAGGSGIVILRYPSYLAPATSTTGSPETYIAGAWRVYRFVASGTITF* |
| Ga0114974_1001651812 | 3300009183 | Freshwater Lake | GGGGSGVVIVRYPSYLAAAASTTGSPETYVTGFWRVYRFVANGTITF* |
| Ga0114976_102888632 | 3300009184 | Freshwater Lake | GGAGGSGIVIIRYPSYLAQATSTTGSPETYITGAWRVYKFIASGTITF* |
| Ga0114951_104108851 | 3300009502 | Freshwater | YPSYLKQAASTTGSPTYYQAGGYNVYIFYASGTITF* |
| Ga0114960_102468914 | 3300010158 | Freshwater Lake | KFAPNNAGASLGTSGAGGSGIVVIRYPSYLALAASVTGSPTTYIAGPYRVYIFNASGTITF* |
| Ga0114967_100983281 | 3300010160 | Freshwater Lake | SYLAPATSTTGSPETYVTGFWRVYRFVASGTITF* |
| Ga0136644_100529303 | 3300010334 | Freshwater Lake | GGSGIVVIRYPSYLSQATSTTGSPTYYQAGGYNVYIFYASGTITF* |
| Ga0136644_101171943 | 3300010334 | Freshwater Lake | GGSGIVVIRYPSYLSQATSTTGSPTYYQAGGYHVYVFYASGTITF* |
| Ga0136644_105834332 | 3300010334 | Freshwater Lake | GKKASGDGGSGIVVIRYPSYLSQATSTTGSPTYYQALGYNVYVFNASGTITF* |
| Ga0133913_101735381 | 3300010885 | Freshwater Lake | IVVIRYPSFYAPAKSTTGSPETYVVNGWRVYEFLQSGTITF* |
| Ga0133913_106313211 | 3300010885 | Freshwater Lake | YPSYLAPATSTTGSPEMYVAGAWRVYKFVASGTITF* |
| Ga0133913_117137251 | 3300010885 | Freshwater Lake | AGGSGIVVLRYPSILAPAVSTTGSPTTYVSLGYRVYVFYASGTITF* |
| Ga0133913_128600191 | 3300010885 | Freshwater Lake | GFVYIGGTNRFLAGGKGGSGIVVLRYPSYYAQAASTVGAPRTYIAGGYRVYIFTNSGTITF* |
| Ga0133913_131805551 | 3300010885 | Freshwater Lake | GSGIVVIRYPSYLSQATSTTGSPTYYQALGYNVYVFYASGTITF* |
| Ga0137575_100032001 | 3300010970 | Pond Fresh Water | GAGINGVTTYFPGNAGGSGIVILRYPSYLAPATSTTGNPETYVTGPWRVYRFVASGTITF |
| Ga0151620_10509571 | 3300011268 | Freshwater | SDATNLSGGSGGSGIVIIRYPANFTPARLTTGSPLTYKTGFYRVYVFNASGTITF* |
| Ga0153805_10873801 | 3300012013 | Surface Ice | GYNGTLLAQNAGNAGGSGIVIIRYPAYQVPATSTTGGPEMYVAGAWRVYKFVASGTITF* |
| Ga0153805_10930911 | 3300012013 | Surface Ice | GGAGGSGIVVLRYPANFAPARLTTGSPLTYKTGFYRVYVFNASGTITF* |
| Ga0164296_11452962 | 3300013093 | Freshwater | SGIVVIRYPAYLKQATSTTGSPTTYIAGPWRVYVFYASGTITF* |
| Ga0164296_13265132 | 3300013093 | Freshwater | GGEAGEAGGSGIVVLPSPAYLAPAASTTGSPTTYIAGPYRVYIFYASGTITF* |
| Ga0164297_100567252 | 3300013094 | Freshwater | GSGIVVIRYPATLAPAIATTGSPTTYVSLGYRVYIFYASGTITF* |
| Ga0181338_10034286 | 3300015050 | Freshwater Lake | GSSPSAGAPGGSGIVVIRYPSYLAPATLTTGSPETYVSGNYRVYKFVASGTITF* |
| Ga0181364_10302982 | 3300017701 | Freshwater Lake | GGAGGSGIVVIRYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF |
| Ga0181363_10670722 | 3300017707 | Freshwater Lake | IIRYPSYLAPATSTTGNPETYVTGPWRVYKFVASGTITF |
| Ga0181350_10535531 | 3300017716 | Freshwater Lake | PSYQVPATSTTGSPEMYVANAWRVYTFLQSGTITF |
| Ga0181347_10264492 | 3300017722 | Freshwater Lake | NGGSGIVVIRYPSYLAQATSTTGSPETYVSGNYRVYKFVASGTITF |
| Ga0181365_10472123 | 3300017736 | Freshwater Lake | VIRYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF |
| Ga0181344_10808422 | 3300017754 | Freshwater Lake | GDGPAGNGGSGIVVIRYPAYLAQATSTTGSPTYYQAVGYNVYVFNASGTITF |
| Ga0181344_10967871 | 3300017754 | Freshwater Lake | GSGIVIIRYPSYLLPAASTTGSPETYIAGQYRVYKFVANGTITF |
| Ga0181344_12269072 | 3300017754 | Freshwater Lake | GAGGSGIVIIRYPSYLAQATSTTGSPLTYIAGTWRVYEFITSGTITF |
| Ga0181358_12266452 | 3300017774 | Freshwater Lake | IVVIRYPSYLAPATSTTGSPEMIIAGAWRVYTFVASGTITF |
| Ga0181357_10392003 | 3300017777 | Freshwater Lake | AAGGSGIVVIRYPSYQAAARVTTGGPQTYVAGPWRVYVFTVSGTITF |
| Ga0181357_10851263 | 3300017777 | Freshwater Lake | AGGSGIVIIRYPSYQVPATSTTGSPEMYVANAWRVYTFLQSGTITF |
| Ga0181357_11392861 | 3300017777 | Freshwater Lake | GAGGSGIVILRFPSYLAPATSTTASTETYVTGFWRVYKFVASGTITF |
| Ga0181357_11738531 | 3300017777 | Freshwater Lake | AAGGSGIVVIRYPSYQAAARVTTGGPQTYVAGPWRVYVFTASGTITF |
| Ga0181349_11579581 | 3300017778 | Freshwater Lake | IRYPSYLAQATSTTGSPEIYVTGGWRVYKFVASGTITF |
| Ga0181346_10263483 | 3300017780 | Freshwater Lake | YPSYLAPATSTTGSPETYVSGNYRVYRFVASGTITF |
| Ga0181346_10992751 | 3300017780 | Freshwater Lake | SKSGGNGGSGIVVIRYPSYLAPATSTTGGPEMYVAGAWRVYKFVASGTITF |
| Ga0181346_11715852 | 3300017780 | Freshwater Lake | GGSGIVILRHLAYLPQATSTTGSPEMYTTGGWRVYKFLQSGTITF |
| Ga0181348_10751903 | 3300017784 | Freshwater Lake | ESGSGASGIVIIRYPSYQVPATSTTGSPEMYVAGAWRVYKFVASGTITF |
| Ga0181348_13216511 | 3300017784 | Freshwater Lake | AGGSGIIIIRYPSYLAQATSTTGSPEIYVTGGWRVYKFVASGTITF |
| Ga0181355_11473902 | 3300017785 | Freshwater Lake | GAGGSGVIILRYPSYLAPATSTTGSPEMYVAGAWRVYKFVASGTITF |
| Ga0181355_12971521 | 3300017785 | Freshwater Lake | YPSYQSAAKATTGNPQTYVAGPWRVYVFTASGTITF |
| Ga0211734_105519101 | 3300020159 | Freshwater | GGSGADTVSGEVGANGGSGIVVLRYPANFAPARLTTGSPLTYKTGFYRVYVFNASGTITF |
| Ga0214164_10944091 | 3300021138 | Freshwater | NNLAGGAGGSGIVVIRYPAYLKQATSTTGSPTTYIAGPYRVYIFYASGTITF |
| Ga0194047_101178401 | 3300021354 | Anoxic Zone Freshwater | WIYAAGTNGGSGIVVIRYPSYLSQATSTTGSPTTYIAGPYRVYVFKASGTITF |
| Ga0194048_100688521 | 3300021519 | Anoxic Zone Freshwater | RYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF |
| Ga0222713_104044491 | 3300021962 | Estuarine Water | GAGGSGIVVIRYPAFYAPARSTTGSPNTYITGFWRVYEFNASGTITF |
| Ga0222712_104349312 | 3300021963 | Estuarine Water | TSGAGGSGIVILRYPSYLAPATSTTGSPEMYVAGAWRVYKFVASGTITF |
| Ga0181354_10758081 | 3300022190 | Freshwater Lake | AGGSGIVILRYPSYLAPATSTTGGPEMYVAGAWRVYKFVASGTITF |
| Ga0181354_10826651 | 3300022190 | Freshwater Lake | PSYLAQATSTTGSPETYVTGFWRVYRFIASGTITF |
| Ga0181354_10952392 | 3300022190 | Freshwater Lake | TGGQAGGSGIVILRYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF |
| Ga0181354_11349372 | 3300022190 | Freshwater Lake | VILRYPSYLAPATSTTGGPEMYVAGAWRVYKFVASGTITF |
| Ga0181351_10372711 | 3300022407 | Freshwater Lake | SGLGGNGGSGIVVIRYPSYLPTAASTTGSPETYIKNGWRVYKFFASGTITF |
| Ga0181351_12289051 | 3300022407 | Freshwater Lake | GSGIVVIRYPAYLAAASSTTGAPATYVTKQWRVYIFYASGTITF |
| Ga0214921_101869172 | 3300023174 | Freshwater | IVVIRYPSYLAPATSTTGSPETYIAGGWRVYKFVASGTITF |
| Ga0214921_102643872 | 3300023174 | Freshwater | GSQGGGGSGVVIIRYPSYLGQAASVTGSPQTYVTGMWRVYIWTSSGTITF |
| Ga0244775_103113153 | 3300024346 | Estuarine | GGTGGSGIVVIRYPSYLAQATSTTGSPETYVTGFWRVYRFVASGTITF |
| Ga0244775_109731761 | 3300024346 | Estuarine | TSAFTGGAGGSGIVIIRYPSYLLPAASTTGSPETYVSGQYRVYKFIANGTITF |
| Ga0208382_10393031 | 3300025369 | Freshwater | VVLRYPAYLKQAASTTGSPTTYIAGPYRVYVFYASGTITF |
| Ga0208250_10152871 | 3300025383 | Freshwater | SNKLNYVYGGAGGSGVVVIRYPSYLAPAASVTGSPATYIAGPYRVYGWVVSGTITF |
| Ga0207959_10519301 | 3300025387 | Freshwater | WQYTAGGAGGSGIVAIRYPGYLAPATSVTGSPTTYIAGPYRVYSWVASGSITF |
| Ga0208874_10514501 | 3300025396 | Freshwater | SNGVTCYAGKGGSGIVVIRYPSYQSPAANTTGSPTTYISPPYRVYVFYASGSITF |
| Ga0208744_10077881 | 3300025450 | Freshwater | GAGGSGIVVIRYPSYLSQATSTTGSPTYYQALGYNVYVFKASGTITF |
| Ga0208388_100066311 | 3300025778 | Freshwater | IRYPAYLSQATSTTGSPTYYQALGYNVYVFKASGTITF |
| Ga0208386_10546201 | 3300025781 | Freshwater | VIRYPAYLKQATSTTGSPTYYQALGYNVYVFYASGTITF |
| Ga0209442_11353302 | 3300027732 | Freshwater Lake | ANTPIGGAGGSGIVVIRYPSYLAPATSTTGSPETYVTGLWRVYRFVASGTITF |
| Ga0209442_12060611 | 3300027732 | Freshwater Lake | SGGYTLTWTGVGGSGIVILRHLAYLPQATSTTGSPEMYTTGGWRVYKFLQSGTITF |
| Ga0209084_11277152 | 3300027749 | Freshwater Lake | RAGSNGGSGIVIVRYPSYYLQAASTTGSPVYYQISGYNIYIFYASGTITF |
| Ga0209084_11972891 | 3300027749 | Freshwater Lake | SGGSGIVVIRYPSYLLQATSTTGSPTTYIAGGYRVYIFYASGTITF |
| Ga0209084_12274371 | 3300027749 | Freshwater Lake | SGIVIIRYPSYLLPAASTTGSPETYIAGQYRVYKFVANGTITF |
| Ga0209296_10198471 | 3300027759 | Freshwater Lake | IVRYPSYLAAAASTTGSPETYVTGFWRVYRFVANGTITF |
| Ga0209598_101165151 | 3300027760 | Freshwater Lake | SGGSGIVVIRYPSYLAPATQTTGSPQTYVAGAWRVYVFTSSGTIKF |
| Ga0209088_102264031 | 3300027763 | Freshwater Lake | IRYPNYLAAATSTTGSPRTYIDGTWRVYVFVASGTITF |
| Ga0209088_103394522 | 3300027763 | Freshwater Lake | GAGGSGIVVLRYPAYLAQAVSTTGSPTYYQAVGYNVYVFNSSGTITF |
| Ga0209086_101155273 | 3300027770 | Freshwater Lake | VSGRTSKSGGNGGSGIVVIRYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF |
| Ga0209353_100851881 | 3300027798 | Freshwater Lake | IIRYPSYLAPATSTTGSPEMVVSGGWRVYTFVASGTITF |
| Ga0209354_100265981 | 3300027808 | Freshwater Lake | IVILRYPSYLAPATSTTGSPETYVTGFWRVYRFVASGTITF |
| Ga0209400_11536162 | 3300027963 | Freshwater Lake | RYPSYLLPAASTTGSPETYIAGQYRVYKFVASGTITF |
| Ga0209400_12703651 | 3300027963 | Freshwater Lake | VIIRYPSYLAPATSTTGSPETYVTGAWRVYKFVASGTITF |
| Ga0247723_10193011 | 3300028025 | Deep Subsurface Sediment | YINRTFGLSGGAGGSGVVVIRYPSFLAAARSTTGNPETYIAGAWRVYRWTSSGTITF |
| Ga0304730_10609882 | 3300028394 | Freshwater Lake | IIRYPSYLAPATSTTGSPETYVTGAWRVYKFVASGTITF |
| Ga0304730_10718521 | 3300028394 | Freshwater Lake | VDTTQSSGGSGIVIIRYPSYLAPATSTTGSPETYTTGGWRVYKWITSGTITF |
| Ga0304730_11497311 | 3300028394 | Freshwater Lake | SAGGSGIVVIRYPSYLAPATSTTGSPETYIAGNYRVYKFVASGTITF |
| Ga0315293_103153461 | 3300031746 | Sediment | RGSAGGSGIVILRYPSYLAPATSTTGSPETYVTGAWRVYRFVASGTITF |
| Ga0315288_110757591 | 3300031772 | Sediment | NLVNTFGTAGGSGIVILRYPSYLALATSTTGSPETYVTGAWRVYRFVASGTITF |
| Ga0315899_107633581 | 3300031784 | Freshwater | VGDAGAGGSGIVIIRYPAYLAVAASTTGSPETYITGYWRVYQWVSSGTITF |
| Ga0315906_105489071 | 3300032050 | Freshwater | AGGSGIVIIRYPSYLLPAASTTGSPETYIAGQYRVYKFVANGTITF |
| Ga0315268_107196031 | 3300032173 | Sediment | ANFTTGSSGNNYFGGAGGSGIVILRYPSYLAPATSTTGSPETYVTGAWRVYRFVASGTIT |
| Ga0334985_0358683_3_113 | 3300034018 | Freshwater | YPSYLAPAKSTTGSPEMIVTGGWRVYTFVASGTITF |
| ⦗Top⦘ |