NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F076923

Metagenome Family F076923

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076923
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 117 residues
Representative Sequence MAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
Number of Associated Samples 47
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 35.04 %
% of genes near scaffold ends (potentially truncated) 28.21 %
% of genes from short scaffolds (< 2000 bps) 52.99 %
Associated GOLD sequencing projects 42
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(62.393 % of family members)
Environment Ontology (ENVO) Unclassified
(96.581 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(96.581 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.22%    β-sheet: 22.03%    Coil/Unstructured: 34.75%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF13651EcoRI_methylase 6.03
PF00145DNA_methylase 3.45
PF01555N6_N4_Mtase 2.59
PF00589Phage_integrase 2.59
PF14511RE_EcoO109I 2.59
PF01844HNH 2.59
PF13408Zn_ribbon_recom 1.72
PF08238Sel1 1.72
PF08305NPCBM 1.72
PF09195Endonuc-BglII 0.86
PF00520Ion_trans 0.86
PF01476LysM 0.86
PF07589PEP-CTERM 0.86
PF13541ChlI 0.86
PF13391HNH_2 0.86
PF13250DUF4041 0.86
PF09565RE_NgoFVII 0.86
PF02384N6_Mtase 0.86
PF01078Mg_chelatase 0.86
PF00581Rhodanese 0.86
PF01790LGT 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 3.45
COG0863DNA modification methylaseReplication, recombination and repair [L] 2.59
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 2.59
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 2.59
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001968|GOS2236_1032692All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium911Open in IMG/M
3300007212|Ga0103958_1103123All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1111Open in IMG/M
3300007214|Ga0103959_1058742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3070Open in IMG/M
3300009068|Ga0114973_10714497All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium509Open in IMG/M
3300009152|Ga0114980_10529075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium670Open in IMG/M
3300009154|Ga0114963_10043134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2920Open in IMG/M
3300009154|Ga0114963_10185452All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1213Open in IMG/M
3300009155|Ga0114968_10305373All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium889Open in IMG/M
3300009158|Ga0114977_10414501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium748Open in IMG/M
3300009159|Ga0114978_10439754All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium775Open in IMG/M
3300009159|Ga0114978_10714911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium570Open in IMG/M
3300009180|Ga0114979_10176373All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1302Open in IMG/M
3300009180|Ga0114979_10214705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1161Open in IMG/M
3300009184|Ga0114976_10072122All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2001Open in IMG/M
3300009184|Ga0114976_10280101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium897Open in IMG/M
3300009185|Ga0114971_10114634All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1641Open in IMG/M
3300009187|Ga0114972_10367759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium836Open in IMG/M
3300009684|Ga0114958_10207716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium977Open in IMG/M
3300010334|Ga0136644_10009051All Organisms → cellular organisms → Bacteria6998Open in IMG/M
3300010334|Ga0136644_10029849All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3629Open in IMG/M
3300010334|Ga0136644_10126699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1568Open in IMG/M
3300012000|Ga0119951_1001927All Organisms → cellular organisms → Bacteria11896Open in IMG/M
3300012000|Ga0119951_1006222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium5508Open in IMG/M
3300012000|Ga0119951_1015711All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2868Open in IMG/M
3300012000|Ga0119951_1024899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2058Open in IMG/M
3300012000|Ga0119951_1056423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1093Open in IMG/M
3300012006|Ga0119955_1159029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium589Open in IMG/M
3300013006|Ga0164294_10040560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3667Open in IMG/M
3300013006|Ga0164294_10054866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3076Open in IMG/M
3300013006|Ga0164294_10060773All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2894Open in IMG/M
3300013014|Ga0164295_10199137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1494Open in IMG/M
3300013014|Ga0164295_10604547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium844Open in IMG/M
3300013014|Ga0164295_10928333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium675Open in IMG/M
(restricted) 3300013131|Ga0172373_10095291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2273Open in IMG/M
(restricted) 3300014720|Ga0172376_10052201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3251Open in IMG/M
3300018790|Ga0187842_1008466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3742Open in IMG/M
3300018790|Ga0187842_1013058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2866Open in IMG/M
3300018815|Ga0187845_1070352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1195Open in IMG/M
3300018868|Ga0187844_10040765All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2237Open in IMG/M
3300018868|Ga0187844_10063782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1715Open in IMG/M
3300018868|Ga0187844_10091847All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1378Open in IMG/M
3300018868|Ga0187844_10092158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1375Open in IMG/M
3300022752|Ga0214917_10003274All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales18881Open in IMG/M
3300022752|Ga0214917_10008689All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales9905Open in IMG/M
3300022752|Ga0214917_10010058All Organisms → cellular organisms → Bacteria8951Open in IMG/M
3300022752|Ga0214917_10010627All Organisms → cellular organisms → Bacteria8614Open in IMG/M
3300022752|Ga0214917_10010838All Organisms → cellular organisms → Bacteria8492Open in IMG/M
3300022752|Ga0214917_10019502All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium5631Open in IMG/M
3300022752|Ga0214917_10026716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium4482Open in IMG/M
3300022752|Ga0214917_10026754All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium4476Open in IMG/M
3300022752|Ga0214917_10040621All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3307Open in IMG/M
3300022752|Ga0214917_10054340All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2672Open in IMG/M
3300022752|Ga0214917_10075799All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2084Open in IMG/M
3300022752|Ga0214917_10086057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1897Open in IMG/M
3300022752|Ga0214917_10088137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1863Open in IMG/M
3300022752|Ga0214917_10115953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1510Open in IMG/M
3300022752|Ga0214917_10233539All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium873Open in IMG/M
3300023174|Ga0214921_10015611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium8638Open in IMG/M
3300023174|Ga0214921_10015611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium8638Open in IMG/M
3300023174|Ga0214921_10019459All Organisms → cellular organisms → Bacteria → Proteobacteria7350Open in IMG/M
3300023174|Ga0214921_10064399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3060Open in IMG/M
3300023174|Ga0214921_10076165All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2692Open in IMG/M
3300023174|Ga0214921_10083517All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2507Open in IMG/M
3300023174|Ga0214921_10087167All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2425Open in IMG/M
3300023174|Ga0214921_10117510All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1924Open in IMG/M
3300023174|Ga0214921_10239792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1077Open in IMG/M
3300023174|Ga0214921_10366838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium756Open in IMG/M
3300023179|Ga0214923_10028012All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium4774Open in IMG/M
3300023179|Ga0214923_10143335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1509Open in IMG/M
3300023179|Ga0214923_10152303All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1443Open in IMG/M
3300023179|Ga0214923_10223340All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1087Open in IMG/M
3300023179|Ga0214923_10396876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium709Open in IMG/M
3300023179|Ga0214923_10500329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium597Open in IMG/M
3300023184|Ga0214919_10022414All Organisms → cellular organisms → Bacteria6976Open in IMG/M
3300023184|Ga0214919_10066582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3289Open in IMG/M
3300027518|Ga0208787_1091979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium748Open in IMG/M
(restricted) 3300027728|Ga0247836_1016394All Organisms → cellular organisms → Bacteria5966Open in IMG/M
(restricted) 3300027728|Ga0247836_1024929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium4206Open in IMG/M
(restricted) 3300027728|Ga0247836_1025270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium4161Open in IMG/M
(restricted) 3300027728|Ga0247836_1053174All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2306Open in IMG/M
(restricted) 3300027730|Ga0247833_1081079All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1526Open in IMG/M
(restricted) 3300027730|Ga0247833_1149966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium936Open in IMG/M
(restricted) 3300027730|Ga0247833_1216637All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium703Open in IMG/M
3300027741|Ga0209085_1068497All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1611Open in IMG/M
3300027746|Ga0209597_1205898All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium802Open in IMG/M
3300027747|Ga0209189_1099144All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1307Open in IMG/M
3300027747|Ga0209189_1158223All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium964Open in IMG/M
3300027763|Ga0209088_10025891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2985Open in IMG/M
3300027763|Ga0209088_10069450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1669Open in IMG/M
3300027763|Ga0209088_10221575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium799Open in IMG/M
3300027763|Ga0209088_10411944All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium519Open in IMG/M
(restricted) 3300027970|Ga0247837_1029862All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3919Open in IMG/M
(restricted) 3300027970|Ga0247837_1081166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1682Open in IMG/M
(restricted) 3300027970|Ga0247837_1126570All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1185Open in IMG/M
(restricted) 3300027970|Ga0247837_1214463All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium787Open in IMG/M
3300027971|Ga0209401_1081399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1376Open in IMG/M
(restricted) 3300027977|Ga0247834_1109448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1209Open in IMG/M
(restricted) 3300027977|Ga0247834_1110713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1198Open in IMG/M
(restricted) 3300028114|Ga0247835_1111930All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1044Open in IMG/M
(restricted) 3300028553|Ga0247839_1026932All Organisms → cellular organisms → Bacteria3973Open in IMG/M
(restricted) 3300028553|Ga0247839_1036358All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3101Open in IMG/M
(restricted) 3300028553|Ga0247839_1168806All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium928Open in IMG/M
(restricted) 3300028557|Ga0247832_1020210All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium4824Open in IMG/M
(restricted) 3300028557|Ga0247832_1047523All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2299Open in IMG/M
(restricted) 3300028559|Ga0247831_1258094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium605Open in IMG/M
(restricted) 3300028569|Ga0247843_1025933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium4266Open in IMG/M
(restricted) 3300028569|Ga0247843_1149377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium961Open in IMG/M
(restricted) 3300028571|Ga0247844_1025590All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium4349Open in IMG/M
(restricted) 3300028571|Ga0247844_1041125All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2874Open in IMG/M
(restricted) 3300028581|Ga0247840_10032491All Organisms → cellular organisms → Bacteria4663Open in IMG/M
(restricted) 3300028581|Ga0247840_10039532All Organisms → cellular organisms → Bacteria3973Open in IMG/M
(restricted) 3300028581|Ga0247840_10424460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium640Open in IMG/M
(restricted) 3300029268|Ga0247842_10379170All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium739Open in IMG/M
(restricted) 3300029286|Ga0247841_10039878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium4646Open in IMG/M
(restricted) 3300029286|Ga0247841_10100119All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2395Open in IMG/M
(restricted) 3300029286|Ga0247841_10153870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1769Open in IMG/M
(restricted) 3300029286|Ga0247841_10581196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium697Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater62.39%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake23.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.11%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.71%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.85%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001968Marine microbial communities from Lake Gatun, Panama - GS020EnvironmentalOpen in IMG/M
3300007212Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projectsEnvironmentalOpen in IMG/M
3300007214Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300012006Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101BEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300018790Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41EnvironmentalOpen in IMG/M
3300018815Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68EnvironmentalOpen in IMG/M
3300018868Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50EnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300027518Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027747Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300029268 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19mEnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GOS2236_103269223300001968MarineMERVKIVQRSLKHGEYYKFPLKLIKLLEFNKINIHSLYIYLLVQDYLFNAETSIIYLNEIELAYKIHPTRFMESLELLRVQKLIIYKRITENRVAVGFLGFNTDPEVEVELPYHS*
Ga0103958_110312323300007212Freshwater LakeMNRPPSGCEELQPRVQHWEAVGGVITGMAEVKIVQRSLKHGEYYKFPLKALKLLEFNKINIHSLYIYLLIQDYLYESDKSIIYLNEIELAYKIHPTRFIESLEMLRIHKLLIYKRISENKVAVGFIGFNTSPEVEVEVSGHTLREMR*
Ga0103959_105874223300007214Freshwater LakeMNRPPSGCEELQPRVQHWEAVGGVITGMAEVKIVQRSLKHGEYYKFPLKALKLLEFNKINIHSLYIYLLIQDYLYESDKSIIYLNEIELAYKIHPYRFMESLELLRVHKLLIYKRISENKVAVGFIGFNTSPEVEVEVSGHTLREMR*
Ga0114973_1071449723300009068Freshwater LakeHGEYYKFPLKLLKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIATSRFLESLELLRLQKLLIFKRIGSDKVIIGFEGFNTGPEAEIEVSGHKFLI*
Ga0114980_1052907513300009152Freshwater LakeMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKITPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTNPEAE
Ga0114963_1004313413300009154Freshwater LakeMAEVKIVQRSLKRGEYYKFLFKSLKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTCPEAEIEVSGHKLLT*
Ga0114963_1018545223300009154Freshwater LakeMERVKIVQRTLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLIQDYLFNAETSIIYLNEIELAYKIEPTRFMESLELLRVQKLIIYKRITENRVAVGFLGYNTDPEVEVELPYHS*
Ga0114968_1030537323300009155Freshwater LakeMAEVKIVQRSLKHGEYYKLPLKSLKILEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGSDKVIIGFEGFNTGPEAEIEVSGHKLLT*
Ga0114977_1041450113300009158Freshwater LakeMAEVKIVQRSLKHGEYYKFPLKLLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIASSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI*
Ga0114978_1043975413300009159Freshwater LakeMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLCESDQSIIYLRDIELAYKITPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT*
Ga0114978_1071491113300009159Freshwater LakeMAEVKIVQRSLKHGEYYKFPLKLLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGSDKVIIGFEGFNTGPEAEIEVSGHKLLI*
Ga0114979_1017637313300009180Freshwater LakeMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKITPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT*
Ga0114979_1021470513300009180Freshwater LakeMAEVKIVQRSLKLGEYYKFPLKSLKILEFNKINIHSLYIYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT*
Ga0114976_1007212243300009184Freshwater LakeMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI*
Ga0114976_1028010113300009184Freshwater LakeMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYIYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT*
Ga0114971_1011463423300009185Freshwater LakeMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT*
Ga0114972_1036775923300009187Freshwater LakeMAEVKIVQRSLKHGEYYKFPLKLLKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGSDKVVIGFEGFNTGPEAEIEVSGHKLLT*
Ga0114958_1020771623300009684Freshwater LakeMAEVKIVQRSLKHGEYYKFPLKSLKLLEFNKINIHSLYIYLLIQDYLFNAETSIIYLNEIELAYKIEPTRFMESLELLRVQKLIIYKRITENRVAVGFLGYNTDPEVEVELPYHS*
Ga0136644_1000905163300010334Freshwater LakeMAEVKIVQRSLKHGEYYKFPLKLLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDFELAYKIAPSRFLEALELLRLQKLLIFKRIGTDKVIIGFEGFNTGPEAEIEVSGHKLLI*
Ga0136644_1002984963300010334Freshwater LakeMAEVKIVQRSLKYGEYYKFPLKLIKLLEFNKINIHSLYIYLLIQDYLFNAETSIIYLNEIELAYKIEPTRFMESLELLRVQKLIIYKRITENRVAVGFLGYNTDPEVEVELPYHS*
Ga0136644_1012669923300010334Freshwater LakeMGQIKIVQRSLKHGEFYKFPLKLLKLLELNKINIHSLYIYLMIQDYLFEADKSMIYLNDIELAYKIAPSRFIESLEILRLHKLLFYQKIKENRVLVGFEGFNTDPEVEVEVPNYKL*
Ga0119951_1001927143300012000FreshwaterMAGVKIVQRSLKMGEFYKFPLKALKLFEFNKINIHSLYIYLLIQDYLFEGEKSIIYLNEIELAYKIHPTRLMESLELLRVHKLLIYKRITENKVAVGFLGFNTDPEVEVEVGVTSSLP*
Ga0119951_100622223300012000FreshwaterMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFQGFNTGPEAEIEVSGHKFLI*
Ga0119951_101571143300012000FreshwaterMGQIKIVQRSLKHGEYYKFPLKLLKLLELNKINIHSLYIYLLVQDYLFESNKSMIYLNDIELAYKIAPSRFIESLEILRLHKLLFYQKIKENRVLVGFEGFNTDPEVEVEVPNYKL*
Ga0119951_102489933300012000FreshwaterMERVKIVQRSLKYGEYYKLPLKLIKLLEFNKINIYSLYIYLLVQDYLFNAETSIIYLNEIELAYKIHPTRFMESLELLRVQKLIIFKRITENKVAVGFLGFNTDPEVEVELPYHS*
Ga0119951_105642313300012000FreshwaterMGQIKIVQRSLKHGEYYKFPLKLLKLLELNKINIHSLYIYLLVQDYLFEADKSVIYLNEIELAYKLHPSRFLESLELLQVQKLIVYKRIGENRVAIGFLGFNTDPEVEVEVGVTGSSPSYGQDRSHWSGK*
Ga0119955_115902923300012006FreshwaterMAEIKIVQRSLKIGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLFESDKSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFMGFNTDPEAEIEVSGHKLLI*
Ga0164294_1004056043300013006FreshwaterMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT*
Ga0164294_1005486613300013006FreshwaterIWIMAEVKIVQRSLKHGEYYKFPLKLLKILESNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNMEPEVEVEISS*
Ga0164294_1006077323300013006FreshwaterMAEVKIVQRSLKHGEYYKFPLKLLKILEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTNPEAEIEVSGHKLLI*
Ga0164295_1019913723300013014FreshwaterMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGSDKVIIGFEGFNTGPEAEIEVSGHKFLI*
Ga0164295_1060454713300013014FreshwaterIGGATKGSKWRGKGEGYSVSGGVIWIMADVKIVQRSLKHGEYYKFPLKLLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNMEPEVEVEISS*
Ga0164295_1092833313300013014FreshwaterMAEVKIVQRSLKHGEYYKFPLKLLKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTNPEAEIEVSGHKLLI*
(restricted) Ga0172373_1009529143300013131FreshwaterMRGTATAGTALEVAGGVISGMADVKIVQRSLKHGEYYKFPLKALKLLEFNKINIHSLYIYLLIQDYLYESDKSIIYLNEIELAYKIHPSRFIESLEMLRIHKLLIYKRISENKVAVGFIGFNTSPEVEVEVSGHTLREMR*
(restricted) Ga0172376_1005220123300014720FreshwaterMNRPPSGCEELQPRVQHWEVVGGVITGMAEVKIVQRSLKHGEYYKFPLKALKLLEFNKINIHSLYIYLLIQDYLYESDKSIIYLNEIELAYKIHPSRFIESLEMLRIHKLLIYKRISENKVAVGFIGFNTSPEVEVEVSGHTLREMR*
Ga0187842_100846653300018790FreshwaterMGQIKIVQRTLKLGEYYKFPLKLLKLLEFNKISIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNMEPEVEVEISS
Ga0187842_101305853300018790FreshwaterMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGSDKVIIGFEGFNTGPEAEIEVSGHKLLI
Ga0187845_107035213300018815FreshwaterMVVIGGATKGSKWRGKGEGYSVSGGVIWIMADVKIVQRSLKHGEYYKFPLKLLKILEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKISPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLI
Ga0187844_1004076513300018868FreshwaterMERVKIVQRTLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLFESDQSIIYLRDIELAYKITPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT
Ga0187844_1006378223300018868FreshwaterMAEVKIVQRSLKHGEYYKFPLKLLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNMEPEVEVEISS
Ga0187844_1009184723300018868FreshwaterMVVIGGATKGSKWRGKGEGYSVSGGVIWIMADVKIVQRSLKHGEYYKFPLKLLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKISPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVPGHKFLI
Ga0187844_1009215823300018868FreshwaterMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYIYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGSDKVVVGFQGFNTGPEAEIEVSGHKFLI
Ga0214917_10003274223300022752FreshwaterMAEIKIVQRSLKIGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLFESDKSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFMGFNTDPEAEIEVSGHKLLI
Ga0214917_1000868953300022752FreshwaterMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGSDKVIVGFEGFNTDPEVEIEVSGHKLLI
Ga0214917_1001005833300022752FreshwaterMGQIKIVQRSLKHGEYYKFPLKLLKLLELNKINIHSLYIYLLVQDYLFEADKSVIYLNEIELAYKLHPTRFLESLELLQVQKLIIYKRIGENRVAIGFLGFNTDPEVEVEVGVTGSSPSYGQDRSHWSGK
Ga0214917_1001062783300022752FreshwaterMERVKIVQRSLKYGEFYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT
Ga0214917_1001083873300022752FreshwaterMERVKIVQRSLKYGEYYKLPLKLIKLLEFNKINIYSLYIYLLVQDYLFNAETSIIYLNEIELAYKIHPTRFMESLELLRVQKLIIFKRITENKVAVGFLGFNTDPEVEVELPYHS
Ga0214917_1001950273300022752FreshwaterMGEFYKFPLKALKLFEFNKINIHSLYIYLLIQDYLFEGEKSIIYLNEIELAYKIHPTRLMESLELLRVHKLLIYKRITENKVAVGFLGFNTDPEVEVEVGVTSSLP
Ga0214917_1002671613300022752FreshwaterMERVKIVQRSLKYGEYYKFPLKLIKLLEFNKINIHSLYIYLLIQDYLFNSETSIIYLNEIELAYKIQPTRFMESLELLKVQKLIIYKRITENRVAVGFLGYNTDPEVEVELPYHS
Ga0214917_1002675433300022752FreshwaterMAEVKIVQRSLKHGEYYKFPLKLLKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTNPEAEIEVSGHKLLI
Ga0214917_1004062123300022752FreshwaterMGEFYKFPLKALKLLEFNKINIHSLYIYLLIQDYLFEGEKSIIYLNEIELAYKIHPTRFMESLELLRVHKLLLYNRININKVAVGFTGFNTGPEVEVEVGVTSSSP
Ga0214917_1005434033300022752FreshwaterMGEFYKFPLKALKLFEFNKINIHSLYIYLLIQDYLFEGEKSIIYLNEIELAYKIHPTRFMESLELLRVHKLLIYKRITENKVAVGFLGFNTDPEVEVEVGVTSSSP
Ga0214917_1007579943300022752FreshwaterMAEVKIVQRSLKHGEYYKFPLKLLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDFELAYKIAPSRFLESLELLRLQKLLIFKRIGTDKVIIGFEGFNTGPEAEIEVSGHKLLI
Ga0214917_1008605733300022752FreshwaterMAEIKIVQRSLKLGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELGYKIAPSRFLESLELLRLQKLLIFKRIGSDKVVIGFEGFNTGPEAEIEVSGHKFLI
Ga0214917_1008813713300022752FreshwaterMGQIKIVQSSLKHGEYYKFPLKLLKLLELNKINIHSLYIYLLIQDYLFESNKSMIYLNDIELAYKIAPSRFIESLEILRLHKLLFYQKIKENRVLVGFEGFNTDPEVEVEVPNYKL
Ga0214917_1011595333300022752FreshwaterMADVKIVQRSLKHGEYYKFPLKLLKILEFNKINIHSLYIYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVMIGFEGFNTDPEVEVVVGDQRL
Ga0214917_1023353913300022752FreshwaterMERVKIVQRSLKYGEYYKLPLKLIKILEFNKINIHSLYIYLLVQDYLFNAETSIIYLNEIELAYKIHPTRFMESLELLRVQKLIIFKRITENRVAVGFLGFNTDPEVEVELPYHS
Ga0214921_1001561113300023174FreshwaterMAEVKIVQRSLKHGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFQGFNTGPEAEIEVSGHKFLI
Ga0214921_10015611113300023174FreshwaterMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELGYKIAPSRFLESLELLRLQKLLIFKRIGSDKVVIGFEGFNTGPEAEIEVSGHKFLI
Ga0214921_1001945933300023174FreshwaterMAEIKIVQRSLKLGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVMIGFEGFNTDPEVEVVVGDQRL
Ga0214921_1006439953300023174FreshwaterMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT
Ga0214921_1007616553300023174FreshwaterMGEFYKFPLKALKLFEFNKINIHSLYIYLLIQDYLFEGEKSIIYLNEIELAYKIHPTRLMESLELLRVHKLLIYKRITENKVAVGFLGFNTDPEVEVEVGVTSSLT
Ga0214921_1008351723300023174FreshwaterMAEVKIVQRSLKHGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKISPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLI
Ga0214921_1008716753300023174FreshwaterMERVKIVQRTLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKISPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVPGHKFLI
Ga0214921_1011751043300023174FreshwaterMADVKIVQRSLKHGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLYETDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGSDKVIIGFEGFNTGPEAEIEVSGHKFLI
Ga0214921_1023979213300023174FreshwaterMGQIKIVQRSLKHGEYYKFPLKLLKLLELNKINIHSLYIYLLVQDYLFEADKSVIYLNEIELAYKLHPSRFLESLELLQVQKLIIYKRIGENRVAIGFLGFNTDPEVE
Ga0214921_1036683823300023174FreshwaterMGQIKIVQRSLKHGEYYKFPLKLLKLLEHNKINIHSLYIYLLIQDYLFEADKSMIYLNDIELAYKIAPSRFIESLEILRLHKLLFYQKIKENRVLVGFEGFNTDPEVEVEVPNYKL
Ga0214923_1002801253300023179FreshwaterMAEVKIVQRSLKNGEYYKFPLKALKLLEFNKINIHSLYIYLLIQDYLFESDKSIIYLNEIELAYKLHPSRFMESLELLRVHNLLIYKRITENRVAVGFLGFNTDPEVEVQVGVKGLKP
Ga0214923_1014333543300023179FreshwaterMGQIKIVQRSLKHGEFYKFPLKSLKLFELNRISSHVLYIYLLIQDYLTEADKSIIYLNEIELAYKISPTCFMQSLELLSIHKLLIYKRITDNRVAVGFLGFNTDHEVEVEVPNYKL
Ga0214923_1015230313300023179FreshwaterLLKLLELNKINIHSLYIYLLVQDYLFEADKSVIYLNEIELAYKLHPSRFLESLELLQVQKLIVYKRIGENRVAIGFLGFNTDPEVEVEVGVTGSSPSYGQDRSHWSGK
Ga0214923_1022334023300023179FreshwaterMGQIKIVQRSLKHGEYYKFPLKLLKLLELNKINIHSLYIYLLVQDYLFEADKSVIYLNEIELAYKLHPTRFLESLELLQVQKMIIYKRIGEKRVAIGFLGFNTDPEVEVEVGTTGSMT
Ga0214923_1039687613300023179FreshwaterMAQVKIVQRSLKLGEYYKFPLKSLKILEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFQGFNTGPEAEIEVSGHKFLI
Ga0214923_1050032913300023179FreshwaterMGQIKIVQRSLKHGEFYKFPLRLLKLLELNKINTHSLYIYLLIQDYLFEADKSMIYLNDIELAYKIAPSRFIESLEILRLHKLLFYQKIKENRVLVGFEGFNTDPEVEVEVPNYKL
Ga0214919_1002241443300023184FreshwaterMGEIKIVQRSLKHGEYYKFPLKLLKLLEFNKISIHSLYIYLLVQDYLYESDQSIIHLRDIELAYKIDPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNIDPEVEVEISS
Ga0214919_1006658213300023184FreshwaterMERVKIVQRTLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLFESDQSIIYLRDIELAYKITPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLI
Ga0208787_109197913300027518Deep SubsurfaceMGEFYKFPLKALKLLEFNKINIHSLYIYLLIQDYLFEGEKSIIYLNEIELAYKIHPTRFMESLELLRVHKLLIYKRINENRVAVGFLGFNTDPEVEVEVQGNTLMEMR
(restricted) Ga0247836_101639473300027728FreshwaterMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
(restricted) Ga0247836_102492953300027728FreshwaterKIVQRTLKLGEYYKFPLKALKLLEFNKISIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIEPTRFLESLEMLRLQKLLIFKRIGTDKVIIGFEGFNMDADVEVEISS
(restricted) Ga0247836_102527063300027728FreshwaterMAEVKIVQRTLKLGEYYKFPLKALKLLEFNKINIHSLYVYLLVQDYLIDHDSTIIYLKDFELAYSLYPLRLMDSLEMLRIHKLIIYKKISENAVAINFLGFNTDADVEVEIEDQVLSAK
(restricted) Ga0247836_105317413300027728FreshwaterMAEVKIVQRTLKLGEYYKFPLKALKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
(restricted) Ga0247833_108107913300027730FreshwaterMAEVKIVQRTLKLGEYYKFPLKALKLLEFNKISIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIEPTRFLESLEMLRLQKLLIFKRIGTDKVIIGFEGFNMDADVEVEISS
(restricted) Ga0247833_114996613300027730FreshwaterYKFPLKSLKILEFNKINIHSLYVYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI
(restricted) Ga0247833_121663713300027730FreshwaterWIMAEVKIVQRTLKLGEYYKFPLKALKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
Ga0209085_106849733300027741Freshwater LakeYKFPLKLLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVMIGFEGFNTDPEVEVVVGDQRL
Ga0209597_120589813300027746Freshwater LakeMERVKIVQRTLKLGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT
Ga0209189_109914413300027747Freshwater LakeMGQIKIVQRSLKHGEFYKFPLKLLKLLELNKINIHSLYIYLMIQDYLFEADKSMIYLNDIELAYKIAPSRFIESLEILRLHKLLFYQKIKENRVLVGFEGFNTDPEVEVEVPNYKL
Ga0209189_115822323300027747Freshwater LakeKRGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVMIGFEGFNTDPEVEVVVGDQRL
Ga0209088_1002589113300027763Freshwater LakeMAEVKIVQRSLKHGEYYKFPLKLLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGTDRVIIGFEGFNTGPEAEIEVSGHKLLI
Ga0209088_1006945023300027763Freshwater LakeMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKITPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLT
Ga0209088_1022157513300027763Freshwater LakeHGEYYKFPLKLLKILEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIDPSRFLDSLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKLLI
Ga0209088_1041194413300027763Freshwater LakeMAEVKIVQRSLKLGEYYKFPLKSLKILEFNKINIHSLYIYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEI
(restricted) Ga0247837_102986253300027970FreshwaterMAEVKIVQRTLKLGEYYKFPLKALKLLEFNKINIHSLYIYLLVQDYLIDHDSTIIYLKDFELAYSLYPLRLMDSLEMLRIHKLIIYKKISENAVAINFLGFNTDADVEVEIEDQVLSAK
(restricted) Ga0247837_108116613300027970FreshwaterMAEVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI
(restricted) Ga0247837_112657023300027970FreshwaterMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLVDHDSTIIYLKDFELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
(restricted) Ga0247837_121446323300027970FreshwaterVQRTLKLGEYYKFPLKSLKILEFNKINIHSLYVYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI
Ga0209401_108139943300027971Freshwater LakeYYKFPLKLLKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGSDKVIIGFEGFNTGPEAEIEVSGHKFLI
(restricted) Ga0247834_110944813300027977FreshwaterIVQRSLKLGEYYKFPLKSLKLLESNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI
(restricted) Ga0247834_111071313300027977FreshwaterRSLKMGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLIDHDSTVIYLKDFELAYSLYPLRLMDSLEMLRIHKLIIYKKISENTVAINFLGFNTDADVEVEIEDQVLSAKRLIGSSEML
(restricted) Ga0247835_111193023300028114FreshwaterMAEVKIVQRSLKLGEYYKFPLKSLKLLESNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI
(restricted) Ga0247839_102693213300028553FreshwaterYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
(restricted) Ga0247839_103635863300028553FreshwaterYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI
(restricted) Ga0247839_116880613300028553FreshwaterAEVKIVQRSLKLGEYYKFPLKSLKLLESNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI
(restricted) Ga0247832_102021013300028557FreshwaterQRSLKMGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLIDHDSTVIYLKDFELAYSLYPLRLMDSLEMLRIHKLIIYKKISENTVAINFLGFNTDADVEVEIEDQVLSAKRLIGSSEMLK
(restricted) Ga0247832_104752343300028557FreshwaterGCVTWIMAEVKIVQRTLKLGEYYKFPLKALKLLEFNKISIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIEPTRFLESLEMLRLQKLLIFKRIGTDKVIIGFEGFNMDADVEVEISS
(restricted) Ga0247831_125809423300028559FreshwaterGEYYKFPLKALKLLEFNKINIHSLYIYLLVQDYLIDHDSTIIYLKDFELAYSLYPLRLMDSLEMLRIHKLIIYKKISENTVAINFLGFNTDADVEVEIEDQVLSAKRLIGSSEMLK
(restricted) Ga0247843_102593343300028569FreshwaterMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLFESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
(restricted) Ga0247843_114937733300028569FreshwaterRSLKLGEYYKFPLKSLKLLEFNKINIHSLYVYLLVQDYLVDHDSTIIYLKDFELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
(restricted) Ga0247844_102559053300028571FreshwaterTLKLGEYYKFPLKALKLLEFNKISIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIEPTRFLESLEMLRLQKLLIFKRIGTDKVIIGFEGFNMDADVEVEISS
(restricted) Ga0247844_104112553300028571FreshwaterMAEVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIYSLYVYLLVQDYLIDHDSTIIYLKDFELAYSFYPLRLMDSLEMLRIHKLIIYKKISENTVAINFLGFNTDADVEVEIEDQVLSAKRLIGSSEMLK
(restricted) Ga0247840_1003249133300028581FreshwaterMAQVKIVQRSLKLGEYYKFPLKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTGPEAEIEVSGHKFLI
(restricted) Ga0247840_1003953213300028581FreshwaterKSLKLLEFNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
(restricted) Ga0247840_1042446023300028581FreshwaterGCVTWIMAEVKIVQRTLKLGEYYKFPLKALKLLEFNKINIHSLYVYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLESLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
(restricted) Ga0247842_1037917023300029268FreshwaterMAEVKIVQRTLKLGEYYKFPLKALKLLEFNKINIHSLYIYLLVQDYLIDHDSTIIYLKDFELAYSLYPLRLMDSLEMLRIHKLIIYKKISENTVAINFLGFNTDADVEVEIEDQVLSAKRLIGSSEMLK
(restricted) Ga0247841_1003987863300029286FreshwaterVQRTLKLGEYYKFPLKALKLLEFNKISIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIEPTRFLESLEMLRLQKLLIFKRIGTDKVIIGFEGFNMDADVEVEISS
(restricted) Ga0247841_1010011913300029286FreshwaterVQRTLKLGEYYKFPLKALKLLEFNKINIHSLYVYLLVQDYLIDHDSTIIYLKDFELAYSLYPLRLMDSLEMLRIHKLIIYKKISENTVAINFLGFNTDADVEVEIEDQVLSAKRLIGSSEMLK
(restricted) Ga0247841_1015387043300029286FreshwaterLKSLKLLESNKINIHSLYIYLLVQDYLYESDQSIIYLRDIELAYKIAPSRFLETLELLRLQKLLIFKRIGADKVIIGFEGFNTDPEAEIEVSGHKLLI
(restricted) Ga0247841_1058119613300029286FreshwaterMAEVKIVQRTLKLGEYYKFPLKALKLLEFNKINIHSLYIYLLVQDYLIDHDSTIIYLKDFELAYSFYPLRLMDSLEMLRIHKLIIYKKISENTVAINFLGFNTDADVEVEIEDQVLSAKRLIGSSEMLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.