| Basic Information | |
|---|---|
| Family ID | F076858 |
| Family Type | Metagenome |
| Number of Sequences | 117 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MSEIAEFLRALNGALGLIAIAFCVYFLACIISGGGDK |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 88.89 % |
| % of genes near scaffold ends (potentially truncated) | 12.82 % |
| % of genes from short scaffolds (< 2000 bps) | 63.25 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.410 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.205 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.103 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.23% β-sheet: 0.00% Coil/Unstructured: 50.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF13203 | DUF2201_N | 5.98 |
| PF11775 | CobT_C | 5.13 |
| PF07728 | AAA_5 | 4.27 |
| PF03237 | Terminase_6N | 3.42 |
| PF00004 | AAA | 2.56 |
| PF01612 | DNA_pol_A_exo1 | 1.71 |
| PF00092 | VWA | 1.71 |
| PF13384 | HTH_23 | 1.71 |
| PF10765 | Phage_P22_NinX | 1.71 |
| PF13481 | AAA_25 | 0.85 |
| PF13662 | Toprim_4 | 0.85 |
| PF01258 | zf-dskA_traR | 0.85 |
| PF12705 | PDDEXK_1 | 0.85 |
| PF06067 | DUF932 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.41 % |
| All Organisms | root | All Organisms | 43.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005527|Ga0068876_10013616 | Not Available | 5268 | Open in IMG/M |
| 3300005581|Ga0049081_10026571 | All Organisms → Viruses → Predicted Viral | 2199 | Open in IMG/M |
| 3300005581|Ga0049081_10030013 | All Organisms → Viruses → Predicted Viral | 2065 | Open in IMG/M |
| 3300005582|Ga0049080_10016058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2604 | Open in IMG/M |
| 3300005582|Ga0049080_10081722 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300005662|Ga0078894_10010766 | All Organisms → Viruses | 7189 | Open in IMG/M |
| 3300005662|Ga0078894_10034002 | All Organisms → Viruses → Predicted Viral | 4223 | Open in IMG/M |
| 3300005662|Ga0078894_10748557 | Not Available | 859 | Open in IMG/M |
| 3300005805|Ga0079957_1013289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6083 | Open in IMG/M |
| 3300005805|Ga0079957_1069530 | All Organisms → Viruses → Predicted Viral | 2041 | Open in IMG/M |
| 3300008107|Ga0114340_1000495 | Not Available | 63059 | Open in IMG/M |
| 3300008107|Ga0114340_1023403 | All Organisms → Viruses → Predicted Viral | 2887 | Open in IMG/M |
| 3300008111|Ga0114344_1203790 | Not Available | 623 | Open in IMG/M |
| 3300008116|Ga0114350_1004461 | Not Available | 7102 | Open in IMG/M |
| 3300008116|Ga0114350_1007642 | Not Available | 5822 | Open in IMG/M |
| 3300008116|Ga0114350_1007792 | Not Available | 5880 | Open in IMG/M |
| 3300008116|Ga0114350_1085636 | Not Available | 1034 | Open in IMG/M |
| 3300008116|Ga0114350_1095293 | Not Available | 953 | Open in IMG/M |
| 3300008116|Ga0114350_1116072 | Not Available | 814 | Open in IMG/M |
| 3300008116|Ga0114350_1165625 | Not Available | 592 | Open in IMG/M |
| 3300008120|Ga0114355_1218340 | Not Available | 593 | Open in IMG/M |
| 3300008259|Ga0114841_1026719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6302 | Open in IMG/M |
| 3300008266|Ga0114363_1001985 | Not Available | 11753 | Open in IMG/M |
| 3300008266|Ga0114363_1005418 | Not Available | 8742 | Open in IMG/M |
| 3300008266|Ga0114363_1012642 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3926 | Open in IMG/M |
| 3300008266|Ga0114363_1013797 | Not Available | 3719 | Open in IMG/M |
| 3300008266|Ga0114363_1039340 | All Organisms → Viruses → Predicted Viral | 1941 | Open in IMG/M |
| 3300008266|Ga0114363_1046368 | Not Available | 1750 | Open in IMG/M |
| 3300008266|Ga0114363_1170017 | Not Available | 1035 | Open in IMG/M |
| 3300008267|Ga0114364_1187719 | Not Available | 522 | Open in IMG/M |
| 3300008448|Ga0114876_1090984 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300008450|Ga0114880_1243239 | Not Available | 567 | Open in IMG/M |
| 3300009085|Ga0105103_10070410 | Not Available | 1787 | Open in IMG/M |
| 3300009168|Ga0105104_10015519 | Not Available | 4601 | Open in IMG/M |
| 3300009168|Ga0105104_10029785 | All Organisms → Viruses → Predicted Viral | 3082 | Open in IMG/M |
| 3300010354|Ga0129333_10648624 | Not Available | 912 | Open in IMG/M |
| 3300010354|Ga0129333_10696772 | Not Available | 874 | Open in IMG/M |
| 3300010354|Ga0129333_10700027 | Not Available | 871 | Open in IMG/M |
| 3300010354|Ga0129333_11087127 | Not Available | 668 | Open in IMG/M |
| 3300010370|Ga0129336_10004919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8269 | Open in IMG/M |
| 3300013005|Ga0164292_10368162 | Not Available | 966 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10012903 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 8642 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10020584 | Not Available | 6235 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10694327 | Not Available | 537 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10180304 | Not Available | 1626 | Open in IMG/M |
| 3300015050|Ga0181338_1034524 | Not Available | 764 | Open in IMG/M |
| 3300017707|Ga0181363_1071210 | Not Available | 602 | Open in IMG/M |
| 3300017747|Ga0181352_1026840 | All Organisms → Viruses → Predicted Viral | 1754 | Open in IMG/M |
| 3300017747|Ga0181352_1035105 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
| 3300017747|Ga0181352_1057856 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300017747|Ga0181352_1175071 | Not Available | 559 | Open in IMG/M |
| 3300017747|Ga0181352_1206234 | Not Available | 504 | Open in IMG/M |
| 3300017754|Ga0181344_1012208 | All Organisms → Viruses → Predicted Viral | 2740 | Open in IMG/M |
| 3300017754|Ga0181344_1104952 | Not Available | 819 | Open in IMG/M |
| 3300017754|Ga0181344_1160208 | Not Available | 640 | Open in IMG/M |
| 3300017754|Ga0181344_1208433 | Not Available | 547 | Open in IMG/M |
| 3300017761|Ga0181356_1087276 | Not Available | 1029 | Open in IMG/M |
| 3300017774|Ga0181358_1055265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1492 | Open in IMG/M |
| 3300017777|Ga0181357_1059550 | All Organisms → Viruses → Predicted Viral | 1479 | Open in IMG/M |
| 3300017780|Ga0181346_1071210 | Not Available | 1382 | Open in IMG/M |
| 3300017785|Ga0181355_1013792 | All Organisms → Viruses → Predicted Viral | 3550 | Open in IMG/M |
| 3300017785|Ga0181355_1099590 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300017785|Ga0181355_1323145 | Not Available | 574 | Open in IMG/M |
| 3300019784|Ga0181359_1032213 | Not Available | 2027 | Open in IMG/M |
| 3300021961|Ga0222714_10068896 | All Organisms → Viruses → Predicted Viral | 2353 | Open in IMG/M |
| 3300021961|Ga0222714_10110844 | All Organisms → Viruses → Predicted Viral | 1714 | Open in IMG/M |
| 3300021963|Ga0222712_10106318 | All Organisms → Viruses → Predicted Viral | 1955 | Open in IMG/M |
| 3300022179|Ga0181353_1047673 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300022179|Ga0181353_1062339 | Not Available | 963 | Open in IMG/M |
| 3300022179|Ga0181353_1077695 | Not Available | 841 | Open in IMG/M |
| 3300022179|Ga0181353_1118000 | Not Available | 637 | Open in IMG/M |
| 3300022190|Ga0181354_1149667 | Not Available | 731 | Open in IMG/M |
| 3300022407|Ga0181351_1085187 | Not Available | 1251 | Open in IMG/M |
| 3300027608|Ga0208974_1036476 | Not Available | 1462 | Open in IMG/M |
| 3300027608|Ga0208974_1037875 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300027659|Ga0208975_1131066 | Not Available | 710 | Open in IMG/M |
| 3300027697|Ga0209033_1219227 | Not Available | 561 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1280463 | Not Available | 606 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1049316 | All Organisms → Viruses → Predicted Viral | 2295 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1117654 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300027743|Ga0209593_10156691 | Not Available | 816 | Open in IMG/M |
| 3300027804|Ga0209358_10271000 | Not Available | 846 | Open in IMG/M |
| 3300027816|Ga0209990_10001293 | Not Available | 21375 | Open in IMG/M |
| 3300027816|Ga0209990_10005606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter → Spiribacter sp. C176 | 8502 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1138309 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300028025|Ga0247723_1054968 | All Organisms → Viruses → Predicted Viral | 1122 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1126741 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1047584 | All Organisms → Viruses → Predicted Viral | 2464 | Open in IMG/M |
| 3300031758|Ga0315907_10007442 | Not Available | 11408 | Open in IMG/M |
| 3300031758|Ga0315907_10012485 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 8285 | Open in IMG/M |
| 3300031857|Ga0315909_10006450 | Not Available | 13238 | Open in IMG/M |
| 3300031857|Ga0315909_10056624 | All Organisms → Viruses → Predicted Viral | 3589 | Open in IMG/M |
| 3300031857|Ga0315909_10109162 | All Organisms → Viruses → Predicted Viral | 2366 | Open in IMG/M |
| 3300031857|Ga0315909_10114229 | All Organisms → Viruses → Predicted Viral | 2297 | Open in IMG/M |
| 3300031857|Ga0315909_10242304 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
| 3300031857|Ga0315909_10303207 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
| 3300031857|Ga0315909_10464334 | Not Available | 886 | Open in IMG/M |
| 3300031857|Ga0315909_10467620 | Not Available | 881 | Open in IMG/M |
| 3300031857|Ga0315909_10540636 | Not Available | 794 | Open in IMG/M |
| 3300031857|Ga0315909_10577983 | Not Available | 756 | Open in IMG/M |
| 3300031951|Ga0315904_10883846 | Not Available | 724 | Open in IMG/M |
| 3300031951|Ga0315904_10901113 | Not Available | 714 | Open in IMG/M |
| 3300031951|Ga0315904_10935358 | Not Available | 695 | Open in IMG/M |
| 3300031963|Ga0315901_10656574 | Not Available | 786 | Open in IMG/M |
| 3300032116|Ga0315903_10407539 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300033488|Ga0316621_10122409 | All Organisms → Viruses → Predicted Viral | 1507 | Open in IMG/M |
| 3300033981|Ga0334982_0033611 | All Organisms → Viruses → Predicted Viral | 2915 | Open in IMG/M |
| 3300034012|Ga0334986_0056197 | All Organisms → Viruses → Predicted Viral | 2478 | Open in IMG/M |
| 3300034023|Ga0335021_0161554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1269 | Open in IMG/M |
| 3300034061|Ga0334987_0636824 | Not Available | 623 | Open in IMG/M |
| 3300034062|Ga0334995_0037727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4077 | Open in IMG/M |
| 3300034092|Ga0335010_0056162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2801 | Open in IMG/M |
| 3300034106|Ga0335036_0002476 | Not Available | 16097 | Open in IMG/M |
| 3300034106|Ga0335036_0078973 | All Organisms → Viruses → Predicted Viral | 2452 | Open in IMG/M |
| 3300034106|Ga0335036_0321910 | Not Available | 1020 | Open in IMG/M |
| 3300034106|Ga0335036_0429116 | Not Available | 842 | Open in IMG/M |
| 3300034116|Ga0335068_0194573 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 17.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 14.53% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.98% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.42% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.71% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068876_100136165 | 3300005527 | Freshwater Lake | MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDK* |
| Ga0049081_100265713 | 3300005581 | Freshwater Lentic | MTEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDK* |
| Ga0049081_100300132 | 3300005581 | Freshwater Lentic | MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDDK* |
| Ga0049080_100160588 | 3300005582 | Freshwater Lentic | EIAEFLRALNGALGLIVVAICVYFLACMIIGRGDK* |
| Ga0049080_100817225 | 3300005582 | Freshwater Lentic | MTEIAEFLRALNGALGLIAIAFCVYFLASMFMGKGDK* |
| Ga0078894_1001076611 | 3300005662 | Freshwater Lake | MSVIAEVLKGLNAALGLICIAFCVYFLACIISGGDDK* |
| Ga0078894_100340026 | 3300005662 | Freshwater Lake | MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK* |
| Ga0078894_107485571 | 3300005662 | Freshwater Lake | MSEIAEFLRALNGALGLIAIAFCVYFLACILTSKGDKE* |
| Ga0079957_10132896 | 3300005805 | Lake | MDEIAEFLRALNGALGLIAIAFCVYFLACMFIGRNDK* |
| Ga0079957_10695304 | 3300005805 | Lake | MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGDKE* |
| Ga0114340_100049536 | 3300008107 | Freshwater, Plankton | MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGDGE* |
| Ga0114340_10234032 | 3300008107 | Freshwater, Plankton | MVEIAEFLRALNGALGLICIAFCVYFLACLLSGGDDK* |
| Ga0114344_12037903 | 3300008111 | Freshwater, Plankton | GKMAEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK* |
| Ga0114350_100446112 | 3300008116 | Freshwater, Plankton | MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDKE* |
| Ga0114350_10076424 | 3300008116 | Freshwater, Plankton | MAEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK* |
| Ga0114350_10077925 | 3300008116 | Freshwater, Plankton | MREFAEFLRMFNDALGLILIAFCVYFLACLFMGRSNDNE* |
| Ga0114350_10856363 | 3300008116 | Freshwater, Plankton | MNEIAEFLRALNGALGLICIAIAVYFLACIVMGKGGDK* |
| Ga0114350_10952933 | 3300008116 | Freshwater, Plankton | MDEIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK* |
| Ga0114350_11160723 | 3300008116 | Freshwater, Plankton | MDEIAEFLRSLNGALGLIVVAICVYFLACMIMVRGDK* |
| Ga0114350_11656254 | 3300008116 | Freshwater, Plankton | MEEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE* |
| Ga0114355_12183404 | 3300008120 | Freshwater, Plankton | MSEIVEILRALNGALGVICIAFCVYFLACIISGGDK* |
| Ga0114841_10267198 | 3300008259 | Freshwater, Plankton | MDEIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDDK* |
| Ga0114363_100198522 | 3300008266 | Freshwater, Plankton | MREFAEFLRMLNDALGLIAIAFCVYFLACILTSKGDKE* |
| Ga0114363_100541814 | 3300008266 | Freshwater, Plankton | MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDDK* |
| Ga0114363_10126427 | 3300008266 | Freshwater, Plankton | MSEIAEALRMLNGALGLICIAFCVYFLACMLMGRGDDE* |
| Ga0114363_10137975 | 3300008266 | Freshwater, Plankton | MSEIAEFLRALNGALGLICIAFCVYFLACIISGGDDK* |
| Ga0114363_10393408 | 3300008266 | Freshwater, Plankton | MSEIAEFLRALNGALGLICIAFCVYFLACLISGGDDK* |
| Ga0114363_10463687 | 3300008266 | Freshwater, Plankton | MDEIAEFLRALNGALGLIVVAICVYFLACIIIGRGDDK* |
| Ga0114363_11700174 | 3300008266 | Freshwater, Plankton | MSEIAEILRALNGALGLICIAFCVYFLACIISGGDK* |
| Ga0114364_11877192 | 3300008267 | Freshwater, Plankton | MNEIAEFLRALNGALGLICIAVAVYFLACIVMGKGDDK* |
| Ga0114876_10909842 | 3300008448 | Freshwater Lake | MSEIAEFLRALNGALGLICIAFCVYFLACLISGGGDE* |
| Ga0114880_12432391 | 3300008450 | Freshwater Lake | MDEIAEFLRALNGALGLIAIAFCVYFLACIIIGRGDDK* |
| Ga0105103_100704106 | 3300009085 | Freshwater Sediment | MSEIAEFLRALNGALGLICIAFCVYFLACIVMGRGDKE* |
| Ga0105104_100155197 | 3300009168 | Freshwater Sediment | MSEIAEFLRALNGALGLIAIAFCVYFLACIISGGGDK* |
| Ga0105104_100297853 | 3300009168 | Freshwater Sediment | MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDKE* |
| Ga0129333_106486244 | 3300010354 | Freshwater To Marine Saline Gradient | MREFAELLRMFNDALGLILIAFCVYFLACIVMGRGDKE* |
| Ga0129333_106967723 | 3300010354 | Freshwater To Marine Saline Gradient | MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDKE* |
| Ga0129333_107000272 | 3300010354 | Freshwater To Marine Saline Gradient | MNEVAEFLRALNGALGLIAIAFCVYFLACMFIGRGDK* |
| Ga0129333_110871273 | 3300010354 | Freshwater To Marine Saline Gradient | MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGEDK* |
| Ga0129336_1000491913 | 3300010370 | Freshwater To Marine Saline Gradient | MAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDDK* |
| Ga0164292_103681622 | 3300013005 | Freshwater | MREFAEFLRMLNEALGLIAIAFCVYFLACMFIGRGDKE* |
| (restricted) Ga0172367_100129039 | 3300013126 | Freshwater | MNEIAEVLKGLNAALGLICIAFCVYLIACILSGGDDK* |
| (restricted) Ga0172367_100205842 | 3300013126 | Freshwater | MVEIAEFLRALNGALGLICIAIAVYFLACIVIGKGGDK* |
| (restricted) Ga0172367_106943272 | 3300013126 | Freshwater | MVEIAEFLRALNGALGLICIAFCVYLLACILSGGKDK* |
| (restricted) Ga0172372_101803041 | 3300013132 | Freshwater | MVEIAEFLRALNGALGLICIAFCVYFLACLLSGGKDK* |
| Ga0181338_10345244 | 3300015050 | Freshwater Lake | MDEIAEFLRSLNGALGLIVVAICVYFLACMIIGRGEK* |
| Ga0181363_10712103 | 3300017707 | Freshwater Lake | MDEIAEFLRLLNGALGLIVVAICVYFLACIIIGRGDDK |
| Ga0181352_10268405 | 3300017747 | Freshwater Lake | MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDKE |
| Ga0181352_10351052 | 3300017747 | Freshwater Lake | MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDK |
| Ga0181352_10578563 | 3300017747 | Freshwater Lake | MSEIAEVLRALNGALGLICIAFCVYFLACIVMGRGDKE |
| Ga0181352_11750712 | 3300017747 | Freshwater Lake | MSEIAEFLRMFNDALGLILIAFCVYFLACIVMGRGGDE |
| Ga0181352_12062341 | 3300017747 | Freshwater Lake | MREFAEFLRMLNDALGLIAIAFCVYFLACILTSRGDKE |
| Ga0181344_10122085 | 3300017754 | Freshwater Lake | MSEVAEFLQKLNGALGLIVVAICVYFLACMIIGRGDKE |
| Ga0181344_11049521 | 3300017754 | Freshwater Lake | GPVSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDDK |
| Ga0181344_11602081 | 3300017754 | Freshwater Lake | LYRCPCDRRGRRTMREFAEFLQMLNSALGLIAIAFCVYFLACILTSKGDKE |
| Ga0181344_12084333 | 3300017754 | Freshwater Lake | MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE |
| Ga0181356_10872767 | 3300017761 | Freshwater Lake | NEVAEFLQKLNGALGLIVVAICVYFLACMVIGRGDK |
| Ga0181358_10552651 | 3300017774 | Freshwater Lake | MDDIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK |
| Ga0181357_10595502 | 3300017777 | Freshwater Lake | MSEVAEFLQKLNGALGLIVVAICVYFLACMIIGRGDKK |
| Ga0181346_10712105 | 3300017780 | Freshwater Lake | MDEIAEFLRALNGALGLIAVAFCVYFLACMIIGRGDK |
| Ga0181355_10137924 | 3300017785 | Freshwater Lake | MSEIAEILRALNGALGLICIAFCVYFLACIISGGDDK |
| Ga0181355_10995902 | 3300017785 | Freshwater Lake | MSAIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK |
| Ga0181355_13231452 | 3300017785 | Freshwater Lake | MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDKE |
| Ga0181359_10322133 | 3300019784 | Freshwater Lake | MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK |
| Ga0222714_100688965 | 3300021961 | Estuarine Water | MSEIAEFLRALNGALGLICIAFCVYFLACILSGGDDK |
| Ga0222714_101108443 | 3300021961 | Estuarine Water | MSEIVEILRALNGALGLICIAFCVYFLACIISGGDK |
| Ga0222712_101063188 | 3300021963 | Estuarine Water | MSEIAEFLRALNGALGLICIAFCVYFLACLLTGGDDK |
| Ga0181353_10476733 | 3300022179 | Freshwater Lake | MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDKK |
| Ga0181353_10623393 | 3300022179 | Freshwater Lake | MNEIAEFLRSLNGALGLICIAIAVYFLACIVMGKGGDK |
| Ga0181353_10776952 | 3300022179 | Freshwater Lake | MNEVAEFLQKLNGALGLIVVAICVYFLACMIIGRGDK |
| Ga0181353_11180001 | 3300022179 | Freshwater Lake | MVDIAEFLRALNGALGLICIAFCVYFLACILSGGDDK |
| Ga0181354_11496672 | 3300022190 | Freshwater Lake | MSAIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDKE |
| Ga0181351_10851875 | 3300022407 | Freshwater Lake | MDEIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK |
| Ga0208974_10364761 | 3300027608 | Freshwater Lentic | MDEIAEFLRALNGALGLIVVAICVYFLACMIIGRGDK |
| Ga0208974_10378754 | 3300027608 | Freshwater Lentic | MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDDK |
| Ga0208975_11310663 | 3300027659 | Freshwater Lentic | MDEIAEFLRSLNGALGLIVVAICVYFLACIIIGRGDK |
| Ga0209033_12192272 | 3300027697 | Freshwater Lake | MVEIAEFLRALNGALGLICIAFCVYFLACILSGGDDK |
| (restricted) Ga0247836_12804633 | 3300027728 | Freshwater | PMSEIAEVLRALNGALGLICIAICVYFLACIVIGRGDKE |
| (restricted) Ga0247833_10493164 | 3300027730 | Freshwater | MSEIAEILRALNGALGLICIAFCVYFLACIVIGRGDK |
| (restricted) Ga0247833_11176543 | 3300027730 | Freshwater | MSEIAEVLRALNGALGLICIAICVYFLACIVIGRGDKE |
| Ga0209593_101566911 | 3300027743 | Freshwater Sediment | MSEIAEFLRALNGALGLIAIAFCVYFLACIISGGG |
| Ga0209358_102710004 | 3300027804 | Freshwater Lake | YRRGMRMAEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE |
| Ga0209990_1000129334 | 3300027816 | Freshwater Lake | MAEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK |
| Ga0209990_100056066 | 3300027816 | Freshwater Lake | MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDK |
| (restricted) Ga0247837_11383092 | 3300027970 | Freshwater | MSEIAEILRALNGALGLICIAICVYFLACIVIGRGDKE |
| Ga0247723_10549682 | 3300028025 | Deep Subsurface Sediment | MSEVAEVLRALNGALGLICIAFCVYFLACIISGGDK |
| (restricted) Ga0247839_11267413 | 3300028553 | Freshwater | MSEIAEILRALNGALGLICIAFCVYFLACIISGGGK |
| (restricted) Ga0247843_10475847 | 3300028569 | Freshwater | MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGEDK |
| Ga0315907_1000744210 | 3300031758 | Freshwater | MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDDK |
| Ga0315907_100124856 | 3300031758 | Freshwater | MSEIAEFLRALNGALGLICIAFCVYFLACIISGGDDK |
| Ga0315909_100064505 | 3300031857 | Freshwater | MEEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE |
| Ga0315909_100566249 | 3300031857 | Freshwater | MREFAEFLRMFNDALGLILIAFCVYFLACLFMGRSNDNE |
| Ga0315909_101091624 | 3300031857 | Freshwater | MVEIAEFLRALNGALGLICIAFCVYFLACLLSGGDDK |
| Ga0315909_101142294 | 3300031857 | Freshwater | MSEIVEILRALNGALGVICIAFCVYFLACIISGGDK |
| Ga0315909_102423044 | 3300031857 | Freshwater | MSEIAEFLRALNGALGLICIAFCVYFLACLISGGDDK |
| Ga0315909_103032075 | 3300031857 | Freshwater | MSEIAEALRMLNGALGLICIAFCVYFLACMLMGRGDDE |
| Ga0315909_104643343 | 3300031857 | Freshwater | MREIAEFLRMFNDALGLILIAFCVYFLACIVMGRGDKE |
| Ga0315909_104676201 | 3300031857 | Freshwater | MREFAEFLRMLNEALGLIAIAFCVYFLACIVMGRGDKE |
| Ga0315909_105406364 | 3300031857 | Freshwater | VSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRG |
| Ga0315909_105779833 | 3300031857 | Freshwater | MSEIAEALRMLNGALGLICIAVAVYFLACIVMGKGDDE |
| Ga0315904_108838462 | 3300031951 | Freshwater | MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDKE |
| Ga0315904_109011133 | 3300031951 | Freshwater | MDEIAEFLRALNGALGLIVVAICVYFLACIIIGRGDK |
| Ga0315904_109353582 | 3300031951 | Freshwater | MDEIAEFLRALNGALGLIAIAFCVYFLACIIIGRGDDK |
| Ga0315901_106565743 | 3300031963 | Freshwater | MDEIAEFLRSLNGALGLIVVAICVYFLACIIIGRGDDK |
| Ga0315903_104075394 | 3300032116 | Freshwater | MREFAEFLRMLNDALGLIAIAFCVYFLACIVMGRGDKE |
| Ga0316621_101224093 | 3300033488 | Soil | MSVIAEVLKGLNAALGLICIAFCVYFLACIISGGDDK |
| Ga0334982_0033611_1662_1778 | 3300033981 | Freshwater | MREFAEFLRMLNEALGLIAIAFCVYFLACIIIGRGDKE |
| Ga0334986_0056197_432_548 | 3300034012 | Freshwater | MSEVAEFLRALNGALGLIAIAFCVYFLACMIIGRGDKE |
| Ga0335021_0161554_588_701 | 3300034023 | Freshwater | MSEIAEFLRALNGALGLIAIAFCVYFLACILSGGDDK |
| Ga0334987_0636824_3_110 | 3300034061 | Freshwater | MDEIAEFLRSLNGALGLIVVAICVYFLACIIIGRGD |
| Ga0334995_0037727_1102_1218 | 3300034062 | Freshwater | MNWIAEALQTLNGALGLIVIAFCVYFLACMIIGKGDKK |
| Ga0335010_0056162_3_131 | 3300034092 | Freshwater | HGESMNWIAEALQTLNGALGLIVIAFCVYFLACMIIGKGDKK |
| Ga0335036_0002476_6253_6369 | 3300034106 | Freshwater | MSEIAEFLRMLNEALGLIAIAFCVYFLACIVMGRGDKE |
| Ga0335036_0078973_1760_1873 | 3300034106 | Freshwater | MSVIAEVLRALNGALGLICIAFCVYFLACIISGGDDK |
| Ga0335036_0321910_208_324 | 3300034106 | Freshwater | MSEIAEFLRALNGALGLIAIAFCVYFLACILTSKGDKE |
| Ga0335036_0429116_2_112 | 3300034106 | Freshwater | AEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK |
| Ga0335068_0194573_2_109 | 3300034116 | Freshwater | MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGD |
| ⦗Top⦘ |