| Basic Information | |
|---|---|
| Family ID | F076789 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 117 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MVIIALFGGLVAGGALFAILKNSGSKSTESKYTKLDIG |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.32 % |
| % of genes near scaffold ends (potentially truncated) | 13.68 % |
| % of genes from short scaffolds (< 2000 bps) | 64.96 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.120 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (14.530 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.735 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (41.026 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF00248 | Aldo_ket_red | 14.53 |
| PF11138 | DUF2911 | 12.82 |
| PF08547 | CIA30 | 12.82 |
| PF00092 | VWA | 3.42 |
| PF01569 | PAP2 | 3.42 |
| PF07090 | GATase1_like | 3.42 |
| PF05635 | 23S_rRNA_IVP | 1.71 |
| PF00871 | Acetate_kinase | 1.71 |
| PF00420 | Oxidored_q2 | 1.71 |
| PF00849 | PseudoU_synth_2 | 1.71 |
| PF06439 | 3keto-disac_hyd | 0.85 |
| PF00326 | Peptidase_S9 | 0.85 |
| PF13188 | PAS_8 | 0.85 |
| PF07690 | MFS_1 | 0.85 |
| PF13374 | TPR_10 | 0.85 |
| PF02746 | MR_MLE_N | 0.85 |
| PF01252 | Peptidase_A8 | 0.85 |
| PF00005 | ABC_tran | 0.85 |
| PF13701 | DDE_Tnp_1_4 | 0.85 |
| PF13525 | YfiO | 0.85 |
| PF00793 | DAHP_synth_1 | 0.85 |
| PF13432 | TPR_16 | 0.85 |
| PF13519 | VWA_2 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG5426 | Uncharacterized protein STM3548, contains class I glutamine amidotransferase domain | General function prediction only [R] | 3.42 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 1.71 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 1.71 |
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.71 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 1.71 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 1.71 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.12 % |
| Unclassified | root | N/A | 41.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100439853 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300005541|Ga0070733_10493769 | Not Available | 818 | Open in IMG/M |
| 3300009167|Ga0113563_10458597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1378 | Open in IMG/M |
| 3300009547|Ga0116136_1061616 | Not Available | 1027 | Open in IMG/M |
| 3300009549|Ga0116137_1002972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9523 | Open in IMG/M |
| 3300009552|Ga0116138_1000028 | All Organisms → cellular organisms → Bacteria | 110224 | Open in IMG/M |
| 3300009643|Ga0116110_1129448 | Not Available | 843 | Open in IMG/M |
| 3300009839|Ga0116223_10338529 | Not Available | 892 | Open in IMG/M |
| 3300010324|Ga0129297_10087589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1473 | Open in IMG/M |
| 3300010341|Ga0074045_10163709 | Not Available | 1505 | Open in IMG/M |
| 3300010341|Ga0074045_10734816 | Not Available | 626 | Open in IMG/M |
| 3300010343|Ga0074044_10008564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7960 | Open in IMG/M |
| 3300010343|Ga0074044_11029819 | Not Available | 540 | Open in IMG/M |
| 3300010379|Ga0136449_100546709 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300010391|Ga0136847_11048274 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300012931|Ga0153915_10071045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3623 | Open in IMG/M |
| 3300012931|Ga0153915_11739487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300012964|Ga0153916_10121100 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
| 3300014153|Ga0181527_1009885 | All Organisms → cellular organisms → Bacteria | 7098 | Open in IMG/M |
| 3300014153|Ga0181527_1228563 | Not Available | 761 | Open in IMG/M |
| 3300014155|Ga0181524_10191435 | Not Available | 1011 | Open in IMG/M |
| 3300014169|Ga0181531_10577755 | Not Available | 696 | Open in IMG/M |
| 3300014199|Ga0181535_10030550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4021 | Open in IMG/M |
| 3300014201|Ga0181537_10765121 | Not Available | 656 | Open in IMG/M |
| 3300014490|Ga0182010_10063201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1789 | Open in IMG/M |
| 3300014491|Ga0182014_10047352 | All Organisms → cellular organisms → Bacteria | 3007 | Open in IMG/M |
| 3300014492|Ga0182013_10388863 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300014498|Ga0182019_11053764 | Not Available | 592 | Open in IMG/M |
| 3300014499|Ga0182012_10063209 | All Organisms → cellular organisms → Bacteria | 2915 | Open in IMG/M |
| 3300014502|Ga0182021_11685107 | Not Available | 763 | Open in IMG/M |
| 3300014502|Ga0182021_12270627 | Not Available | 653 | Open in IMG/M |
| 3300014502|Ga0182021_12709108 | Not Available | 596 | Open in IMG/M |
| 3300014502|Ga0182021_13055012 | Not Available | 560 | Open in IMG/M |
| 3300014654|Ga0181525_10515504 | Not Available | 662 | Open in IMG/M |
| 3300014839|Ga0182027_10219575 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300016705|Ga0181507_1315815 | Not Available | 516 | Open in IMG/M |
| 3300016728|Ga0181500_1041381 | Not Available | 676 | Open in IMG/M |
| 3300017929|Ga0187849_1000626 | All Organisms → cellular organisms → Bacteria | 45810 | Open in IMG/M |
| 3300017929|Ga0187849_1069846 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300017934|Ga0187803_10011197 | All Organisms → cellular organisms → Bacteria | 3583 | Open in IMG/M |
| 3300017935|Ga0187848_10215497 | Not Available | 820 | Open in IMG/M |
| 3300017940|Ga0187853_10059646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1938 | Open in IMG/M |
| 3300017940|Ga0187853_10256140 | Not Available | 802 | Open in IMG/M |
| 3300017943|Ga0187819_10566666 | Not Available | 645 | Open in IMG/M |
| 3300017946|Ga0187879_10829538 | Not Available | 517 | Open in IMG/M |
| 3300017948|Ga0187847_10239459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 988 | Open in IMG/M |
| 3300017970|Ga0187783_10004324 | All Organisms → cellular organisms → Bacteria | 10519 | Open in IMG/M |
| 3300017972|Ga0187781_10094225 | Not Available | 2075 | Open in IMG/M |
| 3300017972|Ga0187781_10476421 | Not Available | 895 | Open in IMG/M |
| 3300017975|Ga0187782_10178733 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300017975|Ga0187782_10278561 | Not Available | 1260 | Open in IMG/M |
| 3300017975|Ga0187782_10284413 | Not Available | 1246 | Open in IMG/M |
| 3300017975|Ga0187782_10511197 | Not Available | 919 | Open in IMG/M |
| 3300017975|Ga0187782_11092768 | Not Available | 622 | Open in IMG/M |
| 3300017988|Ga0181520_10008756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14244 | Open in IMG/M |
| 3300017998|Ga0187870_1060250 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300018014|Ga0187860_1395713 | Not Available | 519 | Open in IMG/M |
| 3300018062|Ga0187784_11302197 | Not Available | 576 | Open in IMG/M |
| 3300018088|Ga0187771_10459771 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300018088|Ga0187771_10462021 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300018090|Ga0187770_10414119 | Not Available | 1060 | Open in IMG/M |
| 3300018090|Ga0187770_11124844 | Not Available | 634 | Open in IMG/M |
| 3300019256|Ga0181508_1609088 | Not Available | 773 | Open in IMG/M |
| 3300022551|Ga0212089_10056622 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300027825|Ga0209039_10006523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7703 | Open in IMG/M |
| 3300027896|Ga0209777_10040059 | All Organisms → cellular organisms → Bacteria | 4337 | Open in IMG/M |
| 3300027896|Ga0209777_10611156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300029922|Ga0311363_11238858 | Not Available | 625 | Open in IMG/M |
| 3300031261|Ga0302140_10093427 | All Organisms → cellular organisms → Bacteria | 3048 | Open in IMG/M |
| 3300031524|Ga0302320_11344218 | Not Available | 717 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1133910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 980 | Open in IMG/M |
| 3300031707|Ga0315291_10043908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5098 | Open in IMG/M |
| 3300031772|Ga0315288_10077434 | All Organisms → cellular organisms → Bacteria | 3868 | Open in IMG/M |
| 3300031862|Ga0315280_10000511 | All Organisms → cellular organisms → Bacteria | 71961 | Open in IMG/M |
| 3300031862|Ga0315280_10005716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17586 | Open in IMG/M |
| 3300031862|Ga0315280_10011156 | All Organisms → cellular organisms → Bacteria | 11103 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1067222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1635 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1125730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
| 3300031949|Ga0214473_11881832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300031952|Ga0315294_10035149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5398 | Open in IMG/M |
| 3300031965|Ga0326597_10040458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5889 | Open in IMG/M |
| 3300031965|Ga0326597_12189835 | Not Available | 506 | Open in IMG/M |
| 3300032046|Ga0315289_10253011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1867 | Open in IMG/M |
| 3300032070|Ga0315279_10000227 | All Organisms → cellular organisms → Bacteria | 122351 | Open in IMG/M |
| 3300032156|Ga0315295_12274704 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032160|Ga0311301_10127591 | All Organisms → cellular organisms → Bacteria | 4749 | Open in IMG/M |
| 3300032160|Ga0311301_10348174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2321 | Open in IMG/M |
| 3300032160|Ga0311301_11457235 | Not Available | 848 | Open in IMG/M |
| 3300032163|Ga0315281_12123657 | Not Available | 534 | Open in IMG/M |
| 3300032173|Ga0315268_10006939 | All Organisms → cellular organisms → Bacteria | 11995 | Open in IMG/M |
| 3300032173|Ga0315268_12411961 | Not Available | 540 | Open in IMG/M |
| 3300032401|Ga0315275_11706219 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300032770|Ga0335085_10061108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5032 | Open in IMG/M |
| 3300032782|Ga0335082_10887862 | Not Available | 754 | Open in IMG/M |
| 3300032783|Ga0335079_10081605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3674 | Open in IMG/M |
| 3300032783|Ga0335079_11809521 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300032805|Ga0335078_10681788 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300032805|Ga0335078_11540532 | Not Available | 740 | Open in IMG/M |
| 3300032805|Ga0335078_12483628 | Not Available | 535 | Open in IMG/M |
| 3300032892|Ga0335081_10352089 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
| 3300032892|Ga0335081_10410263 | Not Available | 1739 | Open in IMG/M |
| 3300032895|Ga0335074_11208082 | Not Available | 636 | Open in IMG/M |
| 3300033233|Ga0334722_10010319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8681 | Open in IMG/M |
| 3300033402|Ga0326728_10008750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 24877 | Open in IMG/M |
| 3300033402|Ga0326728_10122225 | All Organisms → cellular organisms → Bacteria | 2986 | Open in IMG/M |
| 3300033402|Ga0326728_10508388 | Not Available | 976 | Open in IMG/M |
| 3300033402|Ga0326728_11000685 | Not Available | 579 | Open in IMG/M |
| 3300033402|Ga0326728_11014501 | Not Available | 573 | Open in IMG/M |
| 3300033405|Ga0326727_10009416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 24062 | Open in IMG/M |
| 3300033405|Ga0326727_10153439 | All Organisms → cellular organisms → Bacteria | 2706 | Open in IMG/M |
| 3300033486|Ga0316624_10005459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5916 | Open in IMG/M |
| 3300033513|Ga0316628_100418432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1709 | Open in IMG/M |
| 3300033755|Ga0371489_0000128 | All Organisms → cellular organisms → Bacteria | 156782 | Open in IMG/M |
| 3300033977|Ga0314861_0000186 | All Organisms → cellular organisms → Bacteria | 107017 | Open in IMG/M |
| 3300033977|Ga0314861_0106977 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300033977|Ga0314861_0151774 | Not Available | 1131 | Open in IMG/M |
| 3300034091|Ga0326724_0054790 | All Organisms → cellular organisms → Bacteria | 2864 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 14.53% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 11.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.26% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 7.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.84% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 5.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.42% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 3.42% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.56% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.56% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.56% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.71% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.71% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.85% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022551 | Boni_combined assembly | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031587 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
| 3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1004398531 | 3300004152 | Bog Forest Soil | PMVIIALFGGLVAGGALFAILRNSGGKASDSKYTKLNIG* |
| Ga0070733_104937692 | 3300005541 | Surface Soil | MVIFALFGSLVCGGALFAFVRNAGAKASDSQYTKLDIN* |
| Ga0113563_104585972 | 3300009167 | Freshwater Wetlands | MVVVAIFGGLVLGGVIFAALKNSGKSEGKSISKLNIGR* |
| Ga0116136_10616162 | 3300009547 | Peatland | MVIIAVFGGLVVGGALFAILKNSGGKSTDDKYTKLDIG* |
| Ga0116137_10029729 | 3300009549 | Peatland | MVIIAVFGGLVIGGALFAVLKNSGSKSADSRYTKLDIG* |
| Ga0116138_100002848 | 3300009552 | Peatland | MVIIAVFGGLVIGGAIFAVVKNSGGRATNSKYTKLDIG* |
| Ga0116110_11294482 | 3300009643 | Peatland | MVIIALFGSLVVGGAIFAVLKNSGGKGKESKYTKLDIG* |
| Ga0116223_103385292 | 3300009839 | Peatlands Soil | MVIIALFGGLVIGGALFAVLKNSGNKSAEGKYTKLDIG* |
| Ga0129297_100875891 | 3300010324 | Lake Sediment | MVVIAILGGLFVGGAIFAALKNTGKASSSKYTKLNIG* |
| Ga0074045_101637092 | 3300010341 | Bog Forest Soil | MVIIALFGGLVVGGALFAILKNSGNKAAESKYTKLDIG* |
| Ga0074045_107348161 | 3300010341 | Bog Forest Soil | MVIIAVFGGLVVGGALFAVLKNAGSKASDDKYTKLDIG* |
| Ga0074044_100085646 | 3300010343 | Bog Forest Soil | MVIIALFGGLVVGGALLAILKNSGSKGTDSKYTKLNIG* |
| Ga0074044_110298192 | 3300010343 | Bog Forest Soil | MVIIAMVGGLVVGGALFAILKNSGSNSKESKYTKLDIG* |
| Ga0136449_1005467092 | 3300010379 | Peatlands Soil | VVIIAMFGGLVLGGAIFAVLKNSVGGAKENKPIKLNIG* |
| Ga0136847_110482743 | 3300010391 | Freshwater Sediment | MVIVAVLGGLIAGGAIFAVVKNSGKSSDDKYTKLKIG* |
| Ga0153915_100710453 | 3300012931 | Freshwater Wetlands | MVIIAVFGGLVAGGAIFAFLKNSGRKARASYTKLNIV* |
| Ga0153915_117394871 | 3300012931 | Freshwater Wetlands | MVILAVAGGLFIGGALFAVLKNSGGSDKKYTKLNIG* |
| Ga0153916_101211002 | 3300012964 | Freshwater Wetlands | MVLIAVVGGLLVGGALFAVLKNSGGSDKKYTKLNIG* |
| Ga0181527_10098856 | 3300014153 | Bog | MVIIGLFGGLVIGGALFAILRNSGSKSTESKYTKLDIG* |
| Ga0181527_12285631 | 3300014153 | Bog | MVIIAVFGGLVVGGALFAILKNSGGQSTDDKYTKLDIG* |
| Ga0181524_101914352 | 3300014155 | Bog | MVIIALFGGLVVGGALFAVLKNAGGKSAESKYTKLDIG* |
| Ga0181531_105777551 | 3300014169 | Bog | MVIIALFGGLVVGGALFAILKNAGGKSAETKYTKLDIG* |
| Ga0181535_100305504 | 3300014199 | Bog | MVIIAVFGGLVVGGAIFAVLKNSGGKSTEDKYTKLDIG* |
| Ga0181537_107651212 | 3300014201 | Bog | MVIVALFGSLVAGGALFAFIRNAGAKAAESKYTKLDIG* |
| Ga0182010_100632012 | 3300014490 | Fen | MVIIALFGGLVVGGALFAILKSAGGKSAESKYTKLDIG* |
| Ga0182014_100473522 | 3300014491 | Bog | MVIIAMVGGLVVGGALFAILKNAGGKSSESKYTKLDIG* |
| Ga0182013_103888632 | 3300014492 | Bog | MVIIALFGGLVVGGAVFAILKNTGGKSTESKYTKLDIG* |
| Ga0182019_110537641 | 3300014498 | Fen | VLLNPMVIIALFGGLVAGGALFAILKNASGRSAESKYTKLDIG* |
| Ga0182012_100632092 | 3300014499 | Bog | MVIIAMVGGLVVGGALFALLKNAGSKSSESKYTKLDIG* |
| Ga0182021_116851071 | 3300014502 | Fen | MVIIAVFGGLVIGGAIFAALKNSTAKSDDKVTKLRIG* |
| Ga0182021_122706272 | 3300014502 | Fen | MVIIAVFGGLVVGGALFAILKNNGSKSAESKYTKLDIG* |
| Ga0182021_127091082 | 3300014502 | Fen | MVIIAMVGGLFAGGALFAILKNAGNKSSESKYTKLDTG* |
| Ga0182021_130550121 | 3300014502 | Fen | MVIIALFGSLVAGGAFFAFVRNAGAKSAETQYTKLDIG* |
| Ga0181525_105155042 | 3300014654 | Bog | MVIIALFGSLVAGGALFAILKNASGKTSESKYTKLDIG* |
| Ga0182027_102195752 | 3300014839 | Fen | MVIIALFGGLVVGGALFAVLKNTGNKSSEGKYTKLDIG* |
| Ga0181507_13158151 | 3300016705 | Peatland | FDPMVIIALFGGLVVGGAVFAILKNTGSKATESKYTKLDIG |
| Ga0181500_10413812 | 3300016728 | Peatland | FFGGFIRPMVIIAAFGGLVVVGALFAILKNSGSKSSDDKYTKLDIG |
| Ga0187849_10006269 | 3300017929 | Peatland | MVIIAVFGGLVIGGALFAVLKNSGSKSADSRYTKLDIG |
| Ga0187849_10698461 | 3300017929 | Peatland | MVIIAVFGGLVIGGAIFAVVKNSGGRATNSKYTKLDIG |
| Ga0187803_100111974 | 3300017934 | Freshwater Sediment | MVIIAMVGGLVVGGALFAILKNMGGKSTESKVTKLDIG |
| Ga0187848_102154971 | 3300017935 | Peatland | MVIIALFGSLVVGGAIFAVLKNSGGKGKESKYTKLDIG |
| Ga0187853_100596462 | 3300017940 | Peatland | MVIIAVFGGLVVGGALFAILKNSGGKSTDDKYTKLDIG |
| Ga0187853_102561402 | 3300017940 | Peatland | MFSFNPMVIIAVFGGLVVGGALFAILKNNGSKSAESKYTKLDIG |
| Ga0187819_105666662 | 3300017943 | Freshwater Sediment | MVIIALFGGLVIGGALFAVLKNSGNKSAEGKYTKLDIG |
| Ga0187879_108295382 | 3300017946 | Peatland | MEVSSDPMVIIALFGGLVVGGAVFAILKNTGGKSTESKYTKLDIG |
| Ga0187847_102394591 | 3300017948 | Peatland | MVIIALFGGLVVGGAVFAILKNTGGKSTESKYTKLDIG |
| Ga0187783_100043249 | 3300017970 | Tropical Peatland | MVMIALLGGLVAGGAVFAILKNSGVKSTENKYTKLDLG |
| Ga0187781_100942252 | 3300017972 | Tropical Peatland | MVIIAVFGGLVVGGALFAVLKNSGSKSAEGKYTKLDIG |
| Ga0187781_104764212 | 3300017972 | Tropical Peatland | MVIIALFGGLVVGGALFAILKNSGSKATDSKYTKLNIG |
| Ga0187782_101787332 | 3300017975 | Tropical Peatland | EVLLDPMVIIALFGGLVVGGALFAVLKNSGSKSAEGKYTKLDIG |
| Ga0187782_102785612 | 3300017975 | Tropical Peatland | MVIIALFGGLVVGGALFAILKNSGSKATESKYTKLNIG |
| Ga0187782_102844131 | 3300017975 | Tropical Peatland | MVILGLFGGLVVGGALFAILKNSGGKSSDSKYTKLNIG |
| Ga0187782_105111972 | 3300017975 | Tropical Peatland | MIIIVVFGGLVIGGALFAVLKNSGGKSDNKYTKLDIG |
| Ga0187782_110927682 | 3300017975 | Tropical Peatland | MVIIALFGGLVVGGALFAILKNSGSKAAESKYTKLNIG |
| Ga0181520_100087564 | 3300017988 | Bog | MVIIAVFGGLVVGGAIFAVLKNSGGKSTEDKYTKLDIG |
| Ga0187870_10602501 | 3300017998 | Peatland | MVIIAVFGGLVIGGAIFAVLKNSGGRATNSTYTKLDIG |
| Ga0187860_13957131 | 3300018014 | Peatland | MVIIALFGGLVAGGALFAILKNSGNKAAESKYTKLDI |
| Ga0187784_113021972 | 3300018062 | Tropical Peatland | MIIIVVFGGLVIGGALFAVLKNSGGNSDNKYTKLDIG |
| Ga0187771_104597712 | 3300018088 | Tropical Peatland | MVIIAVFGGLVVGGALLAVIKNSGSKAKESNYTKLDIG |
| Ga0187771_104620211 | 3300018088 | Tropical Peatland | MVIIVVFGGLIAGGALLAMLKNSSAKSKDGRYTKLNIG |
| Ga0187770_104141191 | 3300018090 | Tropical Peatland | MVIIAVFGGLVIGGALFAVLKNSGDKSAVSKYTKLDIG |
| Ga0187770_111248442 | 3300018090 | Tropical Peatland | MVIIALFGGLVVGGALFAILKNSGGKAAESKYTKLNIV |
| Ga0181508_16090882 | 3300019256 | Peatland | EVYFFGGFIRPMVIIAAFGGLVVVGALFAILKNSGSKSSDDKYTKLDIG |
| Ga0212089_100566222 | 3300022551 | Lake Sediment | MVVIAILGGLFVGGAIFAALKNTGKASSSKYTKLNIG |
| Ga0209039_100065234 | 3300027825 | Bog Forest Soil | MVIIALFGGLVAGGALFAILRNSGGKASDSKYTKLNIG |
| Ga0209777_100400593 | 3300027896 | Freshwater Lake Sediment | MVIIAVFGGLVVGGALFAILKNNGSKSADSKYTKLDIG |
| Ga0209777_106111561 | 3300027896 | Freshwater Lake Sediment | MVIIAVFGGLVIGGAIFAAVKNTTSKADDKYTKLKIG |
| Ga0311363_112388582 | 3300029922 | Fen | FIPGGLFNPMVIIAMVGGLVVGGALFALLKNAGGKSSESKYTKLDIG |
| Ga0302140_100934272 | 3300031261 | Bog | MVIIAMVGGLVVGGALFALLKNAGSKSSESKYTKLDIG |
| Ga0302320_113442181 | 3300031524 | Bog | MVIIAMVGGLVVGGALFALLKNAGGKSSERKYTKLDIG |
| (restricted) Ga0315308_11339102 | 3300031587 | Sediment | MVVIAILGGLFVGGAIFAALKNTGKASSSRYTKLNIG |
| Ga0315291_100439083 | 3300031707 | Sediment | MVILAVAGGLFIGGALFAVLKNSGGSDKKYTKLNIG |
| Ga0315288_100774345 | 3300031772 | Sediment | MVLIAVAGGLFLGGALFALLKNSGGSDKKYTKLNIG |
| Ga0315280_1000051146 | 3300031862 | Sediment | MVIIAVFSGLVIGGVIFAALKNTGKSASQSKYTKLDIG |
| Ga0315280_100057164 | 3300031862 | Sediment | MVIIAIVGGLVAGGALFAMLKNAGSSAKSKYTKLNIG |
| Ga0315280_100111567 | 3300031862 | Sediment | MVIIAVFGGLVIGGAIFAALKNAGSKSDDKYTKLKIG |
| (restricted) Ga0315314_10672223 | 3300031877 | Sediment | MVVIAVLGGLFVGGAIFAALKNTGKASSSKYTKLNIG |
| (restricted) Ga0315314_11257301 | 3300031877 | Sediment | MVIIAVSGGLVIGGAIFAALKSAGSKSDDKYTKLKIG |
| Ga0214473_118818322 | 3300031949 | Soil | QEQQKTMVILAVAGGLFIGGALFAVLKNSGGLDKKYTKLNIG |
| Ga0315294_100351493 | 3300031952 | Sediment | MVLIAVGGGLFLGGALFALLKNSGGSDKKYTKLNIG |
| Ga0326597_100404584 | 3300031965 | Soil | MVIFAVLGGLIAGGAIFAFVKNSGKSSDEKYTKLKIG |
| Ga0326597_121898351 | 3300031965 | Soil | MVIFAVLGGLIAGGAIFAFVKNSGKSSEEKYTKLKIG |
| Ga0315289_102530111 | 3300032046 | Sediment | MVIIAVFGGLVIGGAIFAALKNTASKSGDKVTKLRIG |
| Ga0315279_1000022736 | 3300032070 | Sediment | MVIIVVFGGLVVGGVIFAALKNSGKSTSQSKYTKLNIG |
| Ga0315295_122747042 | 3300032156 | Sediment | MVLIAVAGGLFVGGALFALLKNSGGSDKKYTKLNIG |
| Ga0311301_101275912 | 3300032160 | Peatlands Soil | MVIIALFGGLVAGGALFAILRNSGGKASESKYTKLNIG |
| Ga0311301_103481742 | 3300032160 | Peatlands Soil | VVIIAMFGGLVLGGAIFAVLKNSVGGAKENKPIKLNIG |
| Ga0311301_114572352 | 3300032160 | Peatlands Soil | MVIIAMFGGLVIGGALFAILKNSGSKSGESKYTKLDIG |
| Ga0315281_121236571 | 3300032163 | Sediment | MVIIAVFGGLVIGGAIFAALKNTTGKSDDKYTKLRIG |
| Ga0315268_100069395 | 3300032173 | Sediment | MVIIAVFGGLVAGGAIFAFLKNSGKKADKRYTKLNIG |
| Ga0315268_124119612 | 3300032173 | Sediment | MVIIAVFGGLVIGGAIFAALKNTTSKSDDKYTKLKIG |
| Ga0315275_117062191 | 3300032401 | Sediment | MVLIAVAGGLFLGGALFAVLKNSGGSDKKYTKLNIG |
| Ga0335085_100611081 | 3300032770 | Soil | EVSFDPMVIIGLFGGLVIGGALFAILKNSGSKSTESKYTKLDIG |
| Ga0335082_108878621 | 3300032782 | Soil | MVIIALFGGLVVGGALFALLKNGGSKSAESKYTKLDIG |
| Ga0335079_100816052 | 3300032783 | Soil | MVIIAMVGGLVVGGALFAILKNAGSKSTESKVTKLDIG |
| Ga0335079_118095212 | 3300032783 | Soil | MVIIAVFGGLVVGGALLAVIRNSGSKEKESNYTKLDIG |
| Ga0335078_106817882 | 3300032805 | Soil | MVIVAVFGGLVVGGALFAILKNSGGKPAEDKYTKLDIG |
| Ga0335078_115405321 | 3300032805 | Soil | MVIITALGCLVAGGALLAIFKNSGSKSKESKYTKLDLG |
| Ga0335078_124836281 | 3300032805 | Soil | LHMVIIYLFGGLVVGGALFAILKNSGAKSTQSNYTKLDIG |
| Ga0335081_103520892 | 3300032892 | Soil | MVIIALFGGLVVGGALFAILKNTGGKSAESKYTKLDIG |
| Ga0335081_104102632 | 3300032892 | Soil | MVIIALFGALVAGGALFALFKNTGSKSVESKYTKLDIG |
| Ga0335074_112080821 | 3300032895 | Soil | MVILALFGGLVVVGVIFALLKNTGHKATESKYTKLNIG |
| Ga0334722_100103197 | 3300033233 | Sediment | MVIIAVAGGLFIGGALFAVLKNRGGADKKYTKLNIG |
| Ga0326728_1000875010 | 3300033402 | Peat Soil | MVIIALLGGLVAGGALFAILKNSGNKAAESKYTKLDIG |
| Ga0326728_101222254 | 3300033402 | Peat Soil | MVIIALFGGLVVGGALFAVLKNTGNKSSEGKYTKLDIG |
| Ga0326728_105083882 | 3300033402 | Peat Soil | MVIIALFGGLVISGALFAILRNSSSKAKESKYTKLDIG |
| Ga0326728_110006852 | 3300033402 | Peat Soil | MVIIALFSGPVAGGALFAILKNSGNKSKESKYTKSNIG |
| Ga0326728_110145011 | 3300033402 | Peat Soil | MVIIALFGGLVAGGALFAILKNSGSKSTESKYTKLDIG |
| Ga0326727_1000941614 | 3300033405 | Peat Soil | MVIIALFGGLVAGGALFAILKNSGSKSTESKYTKLNIG |
| Ga0326727_101534392 | 3300033405 | Peat Soil | MVIIAVFGGLVIGGALFAAIKNSGSKSADSRFTKLDIG |
| Ga0316624_100054591 | 3300033486 | Soil | HQEQQRTMVILAVAGGLFIGGALFAVLKNSGGSDKKYTKLNIG |
| Ga0316628_1004184321 | 3300033513 | Soil | PWSTRGIMVLIAVAGGLFVGGALFALLKNSGGSDKKYTKLNIS |
| Ga0371489_0000128_20151_20267 | 3300033755 | Peat Soil | MVIIAVFGGLVIGGALFAVLKNSGSKSADSRFTKLNIG |
| Ga0314861_0000186_17272_17388 | 3300033977 | Peatland | MVIIAVFGGLVIGGAIFAVVKNSGGRATSSKVTKLDIG |
| Ga0314861_0106977_1067_1183 | 3300033977 | Peatland | MVIIALFGGLVVGGALFAILKNSGNKATESKYTKLDIG |
| Ga0314861_0151774_817_933 | 3300033977 | Peatland | MVIIAVFGGLVIGGALFAVLKSSSSKSSDSNYTKLDIG |
| Ga0326724_0054790_1550_1666 | 3300034091 | Peat Soil | MVIIALFGGLVVGGALFAILKNSGSKASESKYTKLNIG |
| ⦗Top⦘ |