Metagenome Family F076708

Basic Information
Family ID	F076708
Family Type	Metagenome
Number of Sequences	117
Average Sequence Length	41 residues
Representative Sequence	VSRKEGKKELSVICVEVMVQGTRGNEGTERSGVHDEE
Number of Associated Samples	12
Number of Associated Scaffolds	117

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	82.05 %
% of genes near scaffold ends (potentially truncated)	13.68 %
% of genes from short scaffolds (< 2000 bps)	88.03 %
Associated GOLD sequencing projects	12
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Most Common Taxonomy
Group	Bacteria (60.684 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms (100.000 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF00078	RVT_1	3.42
PF11107	FANCF	0.85
PF13912	zf-C2H2_6	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.94 %
Unclassified	root	N/A	29.06 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	69.23 %
Unclassified	root	N/A	29.06 %
Viruses	superkingdom	All Organisms → Viruses	1.71 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	60.68 %
Unclassified	root	N/A	29.06 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	8.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	60.68 %
Unclassified	root	N/A	29.06 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	8.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	60.68 %
Unclassified	root	N/A	29.06 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	60.68 %
Unclassified	root	N/A	29.06 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	2.56 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %

Name	Rank	Taxonomy	Distribution
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	59.83 %
Unclassified	root	N/A	29.06 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.85 %
Cnidaria	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria	0.85 %

Name	Rank	Taxonomy	Distribution
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.85 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.85 %

Name	Rank	Taxonomy	Distribution
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.85 %
Echinodermata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata	0.85 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Eleutherozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa	0.85 %
Tenacibaculum	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum	0.85 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
unclassified Tenacibaculum	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum	0.85 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.85 %
Echinozoa	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Holothuroidea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.85 %
Aspidochirotacea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Crustacea	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea	0.85 %
Aspidochirotida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Branchiopoda	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda	0.85 %
Stichopodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Apostichopus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus	0.85 %
Phyllopoda	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	0.85 %
Diplostraca	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Cladocera	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera	0.85 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Anomopoda	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda	0.85 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Daphniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae	0.85 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.83 %
Unclassified	root	N/A	29.06 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.71 %
Daphnia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	0.85 %
Apostichopus japonicus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	0.85 %
Tenacibaculum sp.	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	0.85 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300010290\|Ga0126333_1042816	Not Available	2240	Open in IMG/M
3300010290\|Ga0126333_1055814	Not Available	1989	Open in IMG/M
3300010290\|Ga0126333_1149631	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1128	Open in IMG/M
3300010290\|Ga0126333_1192743	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	931	Open in IMG/M
3300010290\|Ga0126333_1202975	Not Available	893	Open in IMG/M
3300010290\|Ga0126333_1212747	Not Available	859	Open in IMG/M
3300010290\|Ga0126333_1261092	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	716	Open in IMG/M
3300010290\|Ga0126333_1282866	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	664	Open in IMG/M
3300010290\|Ga0126333_1299801	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	628	Open in IMG/M
3300010290\|Ga0126333_1304919	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia	617	Open in IMG/M
3300010290\|Ga0126333_1321302	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	586	Open in IMG/M
3300010290\|Ga0126333_1356449	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	526	Open in IMG/M
3300010292\|Ga0126326_1103090	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1417	Open in IMG/M
3300010292\|Ga0126326_1105895	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1396	Open in IMG/M
3300010292\|Ga0126326_1129093	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1241	Open in IMG/M
3300010292\|Ga0126326_1196946	Not Available	934	Open in IMG/M
3300010292\|Ga0126326_1226450	Not Available	838	Open in IMG/M
3300010292\|Ga0126326_1231883	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	822	Open in IMG/M
3300010292\|Ga0126326_1234038	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	816	Open in IMG/M
3300010292\|Ga0126326_1262708	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	741	Open in IMG/M
3300010292\|Ga0126326_1277464	Not Available	707	Open in IMG/M
3300010292\|Ga0126326_1284172	Not Available	693	Open in IMG/M
3300010292\|Ga0126326_1319810	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	623	Open in IMG/M
3300010292\|Ga0126326_1356882	Not Available	563	Open in IMG/M
3300010292\|Ga0126326_1370464	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	543	Open in IMG/M
3300010292\|Ga0126326_1388061	Not Available	520	Open in IMG/M
3300010292\|Ga0126326_1398517	Not Available	507	Open in IMG/M
3300010292\|Ga0126326_1401937	Not Available	503	Open in IMG/M
3300010294\|Ga0126332_10007113	Not Available	5033	Open in IMG/M
3300010294\|Ga0126332_10033858	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2856	Open in IMG/M
3300010294\|Ga0126332_10048059	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2444	Open in IMG/M
3300010294\|Ga0126332_10088357	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1779	Open in IMG/M
3300010294\|Ga0126332_10134541	Not Available	1360	Open in IMG/M
3300010294\|Ga0126332_10146137	Not Available	1283	Open in IMG/M
3300010294\|Ga0126332_10240402	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Echinodermata → Eleutherozoa → Echinozoa → Holothuroidea → Aspidochirotacea → Aspidochirotida → Stichopodidae → Apostichopus → Apostichopus japonicus	857	Open in IMG/M
3300010294\|Ga0126332_10280574	Not Available	743	Open in IMG/M
3300010294\|Ga0126332_10330591	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	634	Open in IMG/M
3300010294\|Ga0126332_10333013	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	629	Open in IMG/M
3300010294\|Ga0126332_10386267	All Organisms → cellular organisms → Eukaryota → Opisthokonta	546	Open in IMG/M
3300010294\|Ga0126332_10409091	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	517	Open in IMG/M
3300010294\|Ga0126332_10410514	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	516	Open in IMG/M
3300010295\|Ga0126334_10056685	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2141	Open in IMG/M
3300010295\|Ga0126334_10245352	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	842	Open in IMG/M
3300010295\|Ga0126334_10258047	Not Available	806	Open in IMG/M
3300010295\|Ga0126334_10332127	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	642	Open in IMG/M
3300010295\|Ga0126334_10354768	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	605	Open in IMG/M
3300010295\|Ga0126334_10388764	All Organisms → cellular organisms → Eukaryota → Opisthokonta	557	Open in IMG/M
3300010295\|Ga0126334_10417139	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	523	Open in IMG/M
3300010295\|Ga0126334_10433569	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	506	Open in IMG/M
3300010298\|Ga0126325_10030744	Not Available	2693	Open in IMG/M
3300010298\|Ga0126325_10058339	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp.	2050	Open in IMG/M
3300010298\|Ga0126325_10172118	Not Available	1123	Open in IMG/M
3300010298\|Ga0126325_10259462	Not Available	833	Open in IMG/M
3300010298\|Ga0126325_10298611	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	744	Open in IMG/M
3300010298\|Ga0126325_10305159	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	731	Open in IMG/M
3300010298\|Ga0126325_10331434	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	683	Open in IMG/M
3300010298\|Ga0126325_10363039	Not Available	634	Open in IMG/M
3300010298\|Ga0126325_10365022	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	631	Open in IMG/M
3300010298\|Ga0126325_10427245	Not Available	554	Open in IMG/M
3300010298\|Ga0126325_10428029	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	553	Open in IMG/M
3300010298\|Ga0126325_10432891	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	548	Open in IMG/M
3300010298\|Ga0126325_10463480	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	518	Open in IMG/M
3300010314\|Ga0126331_1093573	Not Available	1575	Open in IMG/M
3300010314\|Ga0126331_1134139	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1246	Open in IMG/M
3300010314\|Ga0126331_1169837	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1046	Open in IMG/M
3300010314\|Ga0126331_1173626	Not Available	1028	Open in IMG/M
3300010314\|Ga0126331_1244261	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	765	Open in IMG/M
3300010314\|Ga0126331_1245365	Not Available	762	Open in IMG/M
3300010314\|Ga0126331_1315664	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	594	Open in IMG/M
3300010314\|Ga0126331_1327193	Not Available	572	Open in IMG/M
3300010314\|Ga0126331_1328938	Not Available	569	Open in IMG/M
3300010314\|Ga0126331_1345122	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	541	Open in IMG/M
3300010314\|Ga0126331_1352414	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	530	Open in IMG/M
3300010315\|Ga0136654_1133747	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1271	Open in IMG/M
3300010315\|Ga0136654_1207129	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	915	Open in IMG/M
3300010315\|Ga0136654_1226324	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	849	Open in IMG/M
3300010315\|Ga0136654_1243097	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	796	Open in IMG/M
3300010315\|Ga0136654_1267136	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	729	Open in IMG/M
3300010315\|Ga0136654_1346294	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	564	Open in IMG/M
3300010315\|Ga0136654_1346383	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	564	Open in IMG/M
3300010315\|Ga0136654_1361244	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	540	Open in IMG/M
3300010377\|Ga0126328_10167626	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1123	Open in IMG/M
3300010377\|Ga0126328_10202567	Not Available	972	Open in IMG/M
3300010377\|Ga0126328_10228810	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	879	Open in IMG/M
3300010377\|Ga0126328_10333997	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	625	Open in IMG/M
3300010377\|Ga0126328_10366426	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	573	Open in IMG/M
3300010377\|Ga0126328_10378713	All Organisms → cellular organisms → Eukaryota → Opisthokonta	555	Open in IMG/M
3300010377\|Ga0126328_10393004	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	536	Open in IMG/M
3300010378\|Ga0126330_10050857	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2225	Open in IMG/M
3300010378\|Ga0126330_10062457	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2017	Open in IMG/M
3300010378\|Ga0126330_10092501	All Organisms → Viruses → Predicted Viral	1642	Open in IMG/M
3300010378\|Ga0126330_10236366	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	857	Open in IMG/M
3300010378\|Ga0126330_10253650	Not Available	806	Open in IMG/M
3300010378\|Ga0126330_10297471	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	699	Open in IMG/M
3300010378\|Ga0126330_10349773	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	602	Open in IMG/M
3300010378\|Ga0126330_10398937	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	534	Open in IMG/M
3300010378\|Ga0126330_10417441	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	513	Open in IMG/M
3300011190\|Ga0126327_10055637	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2004	Open in IMG/M
3300011190\|Ga0126327_10067181	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1836	Open in IMG/M
3300011190\|Ga0126327_10236860	Not Available	837	Open in IMG/M
3300011190\|Ga0126327_10270728	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	749	Open in IMG/M
3300011190\|Ga0126327_10296591	Not Available	693	Open in IMG/M
3300011190\|Ga0126327_10300564	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	685	Open in IMG/M
3300011190\|Ga0126327_10389403	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	542	Open in IMG/M
3300011190\|Ga0126327_10409851	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	517	Open in IMG/M
3300012273\|Ga0126329_10032357	All Organisms → Viruses → Predicted Viral	2634	Open in IMG/M
3300012273\|Ga0126329_10048388	Not Available	2225	Open in IMG/M
3300012273\|Ga0126329_10059559	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2023	Open in IMG/M
3300012273\|Ga0126329_10149560	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	1217	Open in IMG/M
3300012273\|Ga0126329_10208423	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	963	Open in IMG/M
3300012273\|Ga0126329_10219548	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	926	Open in IMG/M
3300012273\|Ga0126329_10232809	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	885	Open in IMG/M
3300012273\|Ga0126329_10370851	Not Available	598	Open in IMG/M
3300012273\|Ga0126329_10387363	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	576	Open in IMG/M
3300012273\|Ga0126329_10407738	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	551	Open in IMG/M
3300012273\|Ga0126329_10437825	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	518	Open in IMG/M
3300012887\|Ga0126335_1017889	Not Available	4753	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0126333_10428163	3300010290	Marine Gutless Worms	MEGKEELSIISVEVMVYGTRGNEGTERSGVHDEE*
Ga0126333_10558141	3300010290	Marine Gutless Worms	VSRKEGKKELCVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126333_11496311	3300010290	Marine Gutless Worms	VSRKEGKKELSVICVEVMVYGTRGNEGTERSGVHDEE*
Ga0126333_11927431	3300010290	Marine Gutless Worms	VSRKEGKKELSVICIEVMVYGAKGNECTERSGVHDEE*
Ga0126333_12029751	3300010290	Marine Gutless Worms	VKVIYAGVEVSRKEGKKKLSVICVEVMVLGTRGNEGTERSGVHDEE*
Ga0126333_12127471	3300010290	Marine Gutless Worms	VSKKEGKKELSVICVEVMVQGTRGNEGTEMSGVDDEE*
Ga0126333_12610921	3300010290	Marine Gutless Worms	VKVIHVGVEVSRKEGKKELSVICVEVVVKGTRGNEGTERSGVHDEE*
Ga0126333_12828662	3300010290	Marine Gutless Worms	VSRKEGKKELSVICIELMVLVTRGNEGTERSGVHDEE*
Ga0126333_12998011	3300010290	Marine Gutless Worms	VSRKEGKKELSVFCVEVMVQGTRGNEGTERSGVHAKE*
Ga0126333_13049191	3300010290	Marine Gutless Worms	VSRKEGKKELSVICIEVMVYGTRGNEGTERSGVPQEDVYQEDR*
Ga0126333_13213021	3300010290	Marine Gutless Worms	VSRKEGKKEQSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126333_13564491	3300010290	Marine Gutless Worms	VKVIYAGVEVSRKEGKKELSVICVEVMVQGTRGNEAAERSGVHDEE*
Ga0126326_11030902	3300010292	Marine Gutless Worms	VSRKEGKKELSVICVKVMVQGTTGNEGTKRSGVNNEE*
Ga0126326_11058951	3300010292	Marine Gutless Worms	VKVIYAGVEVSRKEGKKEMSVICIEVMVWGTRGNEGTARSGVHDEE*
Ga0126326_11290933	3300010292	Marine Gutless Worms	VSRKEGKKELSVFCVEVMVQGTRGNEGTERSGVHAEE*
Ga0126326_11969461	3300010292	Marine Gutless Worms	VSRKEGKKKLSVICIEVMVQGTRGNEGTERSGVHDED*
Ga0126326_12264502	3300010292	Marine Gutless Worms	VKVIYAGVEVSRKEGKKKLSAICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126326_12318833	3300010292	Marine Gutless Worms	VKVLYAGVEVSRKEGKKEMSVICIEVVVKGTRGNEGTERSGVHD
Ga0126326_12340381	3300010292	Marine Gutless Worms	VKVIHVGVEVSRKEGKKELSVICVEVVVKGTRGTEGTERSGVHGEE*
Ga0126326_12627081	3300010292	Marine Gutless Worms	VSRKEGKKELNVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126326_12774642	3300010292	Marine Gutless Worms	VSRKEGKKELSVICVEVMVQGTRGNEGTERNGVHDEE*
Ga0126326_12841721	3300010292	Marine Gutless Worms	EVSRKEGKKKLSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126326_13198101	3300010292	Marine Gutless Worms	VSRKEGKKELSVICVEMMVQGTRGNEGAERSGVHDEE*
Ga0126326_13568822	3300010292	Marine Gutless Worms	KEGKKELSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126326_13704642	3300010292	Marine Gutless Worms	VSKKQGKKELSVICVEVMVQGTRGNEGTEMSGVDDEE*
Ga0126326_13880611	3300010292	Marine Gutless Worms	VSQKEGKKELSVICVEVMVLGTRGNEGTERSGVHDEE*
Ga0126326_13985172	3300010292	Marine Gutless Worms	VKAIYAGVEVSRKEGKKKLSVICVEVMVWRTRGNEGTERSGVHDE
Ga0126326_14019371	3300010292	Marine Gutless Worms	VSRKEGKKELSVICIEVMVYGTRGNEGTERSGVHDKE*
Ga0126332_100071131	3300010294	Marine Gutless Worms	VSRKEGQKELSVICVEVMVYETRGNEGTERSGVHDEE*
Ga0126332_100338583	3300010294	Marine Gutless Worms	MQSSTEEIRVKVIHVGVEVSRKEGKKELSVICVEVVVKGTRGNEGTERSGVHDEE*
Ga0126332_100480594	3300010294	Marine Gutless Worms	KEGKKKLSVICVDVMVKRTRGNEGTERSGVHDEE*
Ga0126332_100883572	3300010294	Marine Gutless Worms	VKVIYAGVEVSRKEGKKELSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126332_101345413	3300010294	Marine Gutless Worms	VSRKEGKKELSVICVEVMVQGTRGNEGTERIGVHDEV*
Ga0126332_101461372	3300010294	Marine Gutless Worms	VSRKEGKKELSIICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126332_102404022	3300010294	Marine Gutless Worms	GVEVSRKEGKKKLSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126332_102805741	3300010294	Marine Gutless Worms	VIYAGVEVSRKEGKKELSVICVEVMVQGTRGNEAAERSGVHDEE*
Ga0126332_103305911	3300010294	Marine Gutless Worms	VSRKEGKKELSVFCVEVMVQGTRGNEGTERSGVHAEK*
Ga0126332_103330131	3300010294	Marine Gutless Worms	VKVIYAGVEVSRKEGIKKLSAICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126332_103862671	3300010294	Marine Gutless Worms	VSRKEGKKELSVICIEVMVYGTRGNEGTERSGVPKEDVYQEDR*
Ga0126332_104090911	3300010294	Marine Gutless Worms	VSRKEGKKELSVICVDVMVQGTRGNEGTERSGVHDEE*
Ga0126332_104105142	3300010294	Marine Gutless Worms	VSRKEGKKELSVICIEVMVQGTTGNEGTERSGVHDEE*
Ga0126334_100566852	3300010295	Marine Gutless Worms	VKVICAGVEVSRKEGKKKLSVICVVVMVLGTRGNEGTEKSGIHDEE*
Ga0126334_102453521	3300010295	Marine Gutless Worms	VSRKEGKKELSVICEEVMVQGTRGNEGTERSGVHDEE*
Ga0126334_102580471	3300010295	Marine Gutless Worms	VSRKEGKKELSVICIEVMVQGTRGNEGTERSGIHDEE*
Ga0126334_103321271	3300010295	Marine Gutless Worms	VEVSRKEGEKKLSVICVEVMVYGTRGNEGTERSGVHDEE*
Ga0126334_103547682	3300010295	Marine Gutless Worms	VKVIYARVYVSRKEGKKELSVICVEVMVWGTRGNEGTERSGIHEEE*
Ga0126334_103887641	3300010295	Marine Gutless Worms	VKVIYAGVEVSRKEGKKKLSVICVEVMVQRTRGNEGTERSGVHEEE*
Ga0126334_104171391	3300010295	Marine Gutless Worms	VSRKEGRKELSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126334_104335691	3300010295	Marine Gutless Worms	SMLSLSREGGKKELSVICVEVMASGTRGNEGTQRSGVHDEE*
Ga0126325_100307441	3300010298	Marine Gutless Worms	VSRKEGKKELSVICVEVMVYETRGNEGTERSGVHDEE*
Ga0126325_100583393	3300010298	Marine Gutless Worms	VSRKELKKELSVICVEVMVQGTRGYEGTERSGVHDEE*
Ga0126325_101721182	3300010298	Marine Gutless Worms	VKVIYARVLVSWKEGKKELSVICVEVTVQGTRKNEGIERSGVHDEE*
Ga0126325_102594622	3300010298	Marine Gutless Worms	VSRKEGRKELSVICIEVMVQGTRGNEGTERSGVHENRAMDTKPG*
Ga0126325_102986111	3300010298	Marine Gutless Worms	VKVIYARVEVSRKEGKKKLSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126325_103051591	3300010298	Marine Gutless Worms	VKVIYARVYVSRKEGKKELSVICVEVMVQGTRGNEVAERSGVRDEE*
Ga0126325_103314342	3300010298	Marine Gutless Worms	VSRKKGKKKLSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126325_103630391	3300010298	Marine Gutless Worms	VKVIYVGVEVSRKEGKKKLSVICVEVMVSGTRGNEDTERSGVGPT*
Ga0126325_103650221	3300010298	Marine Gutless Worms	VKVIYAGVEVSRKEGKKEMSVICIEVVVQGTRGNEGTERSGVHDEE*
Ga0126325_104272451	3300010298	Marine Gutless Worms	VSRKEGKKELSVICVEVMVKGTRGNEGTERCGVHDEE*
Ga0126325_104280291	3300010298	Marine Gutless Worms	MEGTEELSIISVEVMVYGTRGNDGTERSGVHDEE*
Ga0126325_104328912	3300010298	Marine Gutless Worms	MSRKEGKKEPSVICVEVTVYGTRGNEGAERSGVHDEE*
Ga0126325_104634802	3300010298	Marine Gutless Worms	VKVIYAGVEVRRKEGNKKLSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126331_10935732	3300010314	Marine Gutless Worms	VSRKELKKELSVICVEVMVQGTRGYKGTERSGVHDEE*
Ga0126331_11341393	3300010314	Marine Gutless Worms	VSQKEGKKELSVICVEVMVFGTRGNEGTERSGVHDEE*
Ga0126331_11698371	3300010314	Marine Gutless Worms	VKVIYAGVEVSRKEGKKELSVICVEVVVLRTRGNEGAERSGVHDEE*
Ga0126331_11736262	3300010314	Marine Gutless Worms	MSRKEGKEELSVICVKVMVYGTGGNEITEKRGVRDEE*
Ga0126331_12442612	3300010314	Marine Gutless Worms	VGRKEGKKELSVICVEVMVQGTRGNEGAERSGVHDEE*
Ga0126331_12453651	3300010314	Marine Gutless Worms	VKEIYAGVEVSRKEGKKELSVICVEVMVQGTRGNEAAERSGVHDEE*
Ga0126331_13156642	3300010314	Marine Gutless Worms	VSRKEGKKELSVICVEVMVQETRGNEGTERSGVHDEE*
Ga0126331_13271931	3300010314	Marine Gutless Worms	VEVSLKEGKKELSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126331_13289381	3300010314	Marine Gutless Worms	VSKKEGKKELSVMCVEVMVQRTRGNEGTEMSGVDDESSDRYRF*
Ga0126331_13451221	3300010314	Marine Gutless Worms	VKVIYAGVKVSRKEGKKELSIICVEVTVLGTRGNEGTERSGVHDEE*
Ga0126331_13524142	3300010314	Marine Gutless Worms	VIYAGVKVSRKEGKKELSVICIEVVVYGTRGNAGTERSGVHDEE*
Ga0136654_11337471	3300010315	Marine Gutless Worms	VKVLYAGAEVSRKEGKKEMSVICIEVVVKGTRGNEGTERSGVHDEE*
Ga0136654_12071291	3300010315	Marine Gutless Worms	VSRKEGNKELSVICVEVMVKGTRGNEGTERSGVHDEE*
Ga0136654_12263242	3300010315	Marine Gutless Worms	VSRKERKKELSVIYVEVMVQGTRGNEGTERSGVHDEE*
Ga0136654_12430971	3300010315	Marine Gutless Worms	VSRKEGKKELSVICVEVMVQGTRGNEVAERSGVREEE*
Ga0136654_12671362	3300010315	Marine Gutless Worms	MLESKSVERKERKSCVICIKVMVYGTRGNEGTERSGVHDEE*
Ga0136654_13462942	3300010315	Marine Gutless Worms	VSKKEGKKELSVICVEVMVQRTRGNEGTEMSGVDDEE*
Ga0136654_13463832	3300010315	Marine Gutless Worms	VKVIYVGVEVSRKEGLKELSVICIEVVVKGTRGNEGAERSGVHEEEEWTNDRALGD
Ga0136654_13612441	3300010315	Marine Gutless Worms	VKVIYARVKVSRKEGKKELRVICEEVMVYGTRGNEGTERSGVHDEE*
Ga0126328_101676262	3300010377	Marine Gutless Worms	VKVIYAGVEVSRKEGKKEMSVICIEVMVWGTRGNEGTARSGVQDEE*
Ga0126328_102025671	3300010377	Marine Gutless Worms	VKVIYAGVKVSRKEGKKELSIICVEVTVLGTRGNESTERSGVHDEE*
Ga0126328_102288101	3300010377	Marine Gutless Worms	VKVLYAGVEVSRKEGKKEMSVICIEVVVKGTRGNDGTERSGVHDEE*
Ga0126328_103339972	3300010377	Marine Gutless Worms	VKEGKKELSVICVEVMVWGTRGNEGTERSGVHDEE*
Ga0126328_103664261	3300010377	Marine Gutless Worms	MSRKEGKKELSVICVEVTVYGTRGNEGAERSGVHDEE*
Ga0126328_103787131	3300010377	Marine Gutless Worms	RDSVQSIVKVIYAGVEVSRKEGKKKLSVICVEVMVLGTRGNEGTERSGVHDEE*
Ga0126328_103930042	3300010377	Marine Gutless Worms	VSRKEGKKELSVICVEVMVQGTRGNEVAERSGVRDEE*
Ga0126330_100508573	3300010378	Marine Gutless Worms	VKVIYAGVEVSRKEGKKKLSVICVEVMVYGTRGNEGTERSGVHDEE
Ga0126330_100624571	3300010378	Marine Gutless Worms	KEGEKKLSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126330_100925013	3300010378	Marine Gutless Worms	VVYAGVKVSRKEGKKELSVICIEVMVYGTRGNESTERSGVHDEE*
Ga0126330_102363662	3300010378	Marine Gutless Worms	VSKKEGKKELSVICVEVMVQGTRGNEGTEMNGVDDEE*
Ga0126330_102536501	3300010378	Marine Gutless Worms	VKVIYAGVEVSLKEGKKELSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126330_102974711	3300010378	Marine Gutless Worms	VSRKEGKKELNVICVEVMVKGTRGNEGTERSGVHDEE*
Ga0126330_103497731	3300010378	Marine Gutless Worms	VIYAGVYVSRKEGKKELSVICVEVMVSGTRGNEGTERSGVHDEE*
Ga0126330_103989372	3300010378	Marine Gutless Worms	VKVIYAGVEVSRKEGKKKLSVFCVEVVVQGTRGNEGTERSGVHDEE*
Ga0126330_104174412	3300010378	Marine Gutless Worms	MLESESEGKKKLSVICVEVMVYGTRGNEGTERSGVHDEE*
Ga0126327_100556372	3300011190	Marine Gutless Worms	VSRKKGKKELSVICVEVMVQGTRGNEGTERSGVHDDE*
Ga0126327_100671813	3300011190	Marine Gutless Worms	VLESMLVGRKESVICVEVMVCGTRGNEGTEMIGVHDEE*
Ga0126327_102368602	3300011190	Marine Gutless Worms	VKVIYAGVEVSRKEGKKKLSVICVEVMVLGTRGNEGTERSGVHAEE*
Ga0126327_102707281	3300011190	Marine Gutless Worms	VNVIYAGVEVSRKEGKKELGVTCVEVMVYGTRGNEGTERSGVHDEE*
Ga0126327_102965911	3300011190	Marine Gutless Worms	VNVIHVGVEVSRKEGKKELSVICVEVVVKGTRGNKGTERSGVHDEE*
Ga0126327_103005641	3300011190	Marine Gutless Worms	VSRKEGKKELSVICIEVMVQGTRGNEVAERSGVRDEE*
Ga0126327_103894031	3300011190	Marine Gutless Worms	VSRKEGKKELSVICVEMMFQGTRGNEGAERSGVHDEE*
Ga0126327_104098511	3300011190	Marine Gutless Worms	VSRKEGKKKLSVICEEVMVQGTRGNEGTERSGVHDEE*
Ga0126329_100323573	3300012273	Marine Gutless Worms	SRKEGKKKLSVICVEVMVKGTRGNEGTERSGVHDEE*
Ga0126329_100483881	3300012273	Marine Gutless Worms	VKVIYAGVKVSRKEGKKEMSIICVEVTVLGTRGNEGTERSGVHDEE*
Ga0126329_100595592	3300012273	Marine Gutless Worms	VIYAGVEVSRKEGNKELSVIYVELMVQGTRGNESTERSGVHDEQ*
Ga0126329_101495601	3300012273	Marine Gutless Worms	VSRKEGKKELSVICVEVMVQGTRGNEGTERSGVGLHDEK*
Ga0126329_102084232	3300012273	Marine Gutless Worms	VKVIYAGVEVSRKEGKKELSVICVEVMVQGTGGNQGTERSGVHDEE*
Ga0126329_102195482	3300012273	Marine Gutless Worms	MKVIYAGVEVSRKEGKKKLSAICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126329_102328091	3300012273	Marine Gutless Worms	VSRKEGKKELSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126329_103708512	3300012273	Marine Gutless Worms	VSRKEGKKELSVVCVEVMVHGTRGNEGNERSAVHDEE*
Ga0126329_103873632	3300012273	Marine Gutless Worms	VSRKEAKKELSVICVEVMVQGTRGNEGTERGGVHDEE*
Ga0126329_104077381	3300012273	Marine Gutless Worms	VSRKEGKKKLSVICVEVMVQGTRGNEGTERSGVHDEE*
Ga0126329_104378252	3300012273	Marine Gutless Worms	VIYAGVEVSRKEGKKKLSVICAEVMVYGTRGNEGTERSGVHDEE*
Ga0126335_10178895	3300012887	Marine Gutless Worms	VSQKEGKKELSVICVEVVVYGTRGNESTERCSVHDEE*

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F076708

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300010290	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG	Host-Associated	Open in IMG/M
3300010292	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG	Host-Associated	Open in IMG/M
3300010294	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-42 metaG	Host-Associated	Open in IMG/M
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated	Open in IMG/M
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated	Open in IMG/M
3300010314	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG	Host-Associated	Open in IMG/M
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated	Open in IMG/M
3300010377	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG	Host-Associated	Open in IMG/M
3300010378	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG	Host-Associated	Open in IMG/M
3300011190	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG	Host-Associated	Open in IMG/M
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated	Open in IMG/M
3300012887	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Olavius sp. 1 OAHU.JWI-45 metaG	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign