Metagenome Family F076679

Overview

Basic Information

• Family ID: F076679
• Family Type: Metagenome
• Number of Sequences: 117
• Average Sequence Length: 41 residues
• Representative Sequence: HKAYHILWSQEIIPTSRVSLASTLCTQGLFTPVAGAA
• Number of Associated Samples: 59
• Number of Associated Scaffolds: 117

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 1.71 %
• % of genes near scaffold ends (potentially truncated): 100.00 %
• % of genes from short scaffolds (< 2000 bps): 100.00 %
• Associated GOLD sequencing projects: 59
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (94.017 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.727 % of family members)
• Environment Ontology (ENVO): Unclassified (96.581 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (96.581 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 38.46%
  β-sheet: 0.00%
  Coil/Unstructured: 61.54%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
All Organisms	root	All Organisms	5.98 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
cellular organisms	root	All Organisms → cellular organisms	5.98 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	5.98 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	5.13 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.85 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	5.13 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.85 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	5.13 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.85 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5.13 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.85 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	5.13 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.85 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	5.13 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.85 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	5.13 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.85 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5.13 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.85 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	5.13 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.85 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	5.13 %
Spirurina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina	0.85 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	5.13 %
Spiruromorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha	0.85 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	5.13 %
Filarioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea	0.85 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	5.13 %
Setariidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae	0.85 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	5.13 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.85 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	3.42 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.85 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	3.42 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.85 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.71 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.85 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.85 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.71 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.85 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.85 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.85 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.85 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.85 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.85 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.85 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.85 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.85 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.85 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.02 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.85 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.85 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.85 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.85 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005459|Ga0068867_102146514	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	529
3300005718|Ga0068866_11271735	Not Available	534
3300013297|Ga0157378_11212700	Not Available	794
3300015267|Ga0182122_1024113	Not Available	681
3300015269|Ga0182113_1044601	Not Available	637
3300015274|Ga0182188_1007573	Not Available	863
3300015274|Ga0182188_1025956	Not Available	632
3300015276|Ga0182170_1055260	Not Available	556
3300015277|Ga0182128_1009585	Not Available	902
3300015277|Ga0182128_1047807	Not Available	584
3300015277|Ga0182128_1048796	Not Available	580
3300015277|Ga0182128_1059300	Not Available	549
3300015279|Ga0182174_1054096	Not Available	579
3300015279|Ga0182174_1060527	Not Available	560
3300015281|Ga0182160_1059100	Not Available	558
3300015282|Ga0182124_1055640	Not Available	565
3300015282|Ga0182124_1064326	Not Available	541
3300015283|Ga0182156_1035724	Not Available	655
3300015285|Ga0182186_1063741	Not Available	544
3300015285|Ga0182186_1082449	Not Available	504
3300015286|Ga0182176_1078179	Not Available	518
3300015287|Ga0182171_1054876	Not Available	581
3300015287|Ga0182171_1079044	Not Available	520
3300015287|Ga0182171_1086824	Not Available	505
3300015288|Ga0182173_1085909	Not Available	503
3300015289|Ga0182138_1057240	Not Available	574
3300015289|Ga0182138_1074356	Not Available	532
3300015291|Ga0182125_1051887	Not Available	602
3300015294|Ga0182126_1051166	Not Available	607
3300015294|Ga0182126_1073564	Not Available	545
3300015295|Ga0182175_1036130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	677
3300015295|Ga0182175_1049874	Not Available	617
3300015295|Ga0182175_1062765	Not Available	578
3300015295|Ga0182175_1087207	Not Available	522
3300015299|Ga0182107_1063938	Not Available	586
3300015299|Ga0182107_1083021	Not Available	540
3300015300|Ga0182108_1031387	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	726
3300015302|Ga0182143_1013047	Not Available	915
3300015303|Ga0182123_1046484	Not Available	626
3300015303|Ga0182123_1056994	Not Available	591
3300015303|Ga0182123_1092795	Not Available	512
3300015304|Ga0182112_1081099	Not Available	546
3300015307|Ga0182144_1034652	Not Available	707
3300015307|Ga0182144_1067381	Not Available	583
3300015307|Ga0182144_1071501	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	573
3300015308|Ga0182142_1060283	Not Available	615
3300015313|Ga0182164_1023962	Not Available	932
3300015321|Ga0182127_1014132	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	964
3300015321|Ga0182127_1064133	Not Available	621
3300015321|Ga0182127_1109859	Not Available	524
3300015322|Ga0182110_1041686	Not Available	703
3300015322|Ga0182110_1117028	Not Available	512
3300015323|Ga0182129_1109435	Not Available	512
3300015341|Ga0182187_1020330	Not Available	1092
3300015341|Ga0182187_1030824	Not Available	957
3300015342|Ga0182109_1085868	Not Available	719
3300015342|Ga0182109_1101348	Not Available	677
3300015342|Ga0182109_1201934	Not Available	522
3300015343|Ga0182155_1218429	Not Available	508
3300015343|Ga0182155_1224102	Not Available	503
3300015344|Ga0182189_1154156	Not Available	585
3300015345|Ga0182111_1113195	Not Available	677
3300015345|Ga0182111_1176441	Not Available	571
3300015345|Ga0182111_1218324	Not Available	526
3300015345|Ga0182111_1232087	Not Available	513
3300015346|Ga0182139_1202220	Not Available	542
3300015346|Ga0182139_1202399	Not Available	542
3300015347|Ga0182177_1208780	Not Available	538
3300015351|Ga0182161_1098606	Not Available	745
3300015351|Ga0182161_1212847	Not Available	551
3300015355|Ga0182159_1056842	Not Available	1070
3300015355|Ga0182159_1194817	Not Available	650
3300015355|Ga0182159_1231966	Not Available	603
3300015355|Ga0182159_1232869	Not Available	602
3300015355|Ga0182159_1266470	Not Available	567
3300015355|Ga0182159_1283074	Not Available	552
3300015355|Ga0182159_1303517	Not Available	536
3300015355|Ga0182159_1305981	Not Available	534
3300015355|Ga0182159_1336544	Not Available	512
3300015361|Ga0182145_1089822	Not Available	652
3300015361|Ga0182145_1126515	Not Available	581
3300015361|Ga0182145_1135759	Not Available	568
3300017404|Ga0182203_1040835	Not Available	783
3300017404|Ga0182203_1133242	Not Available	539
3300017407|Ga0182220_1072412	Not Available	565
3300017411|Ga0182208_1061814	Not Available	634
3300017411|Ga0182208_1073848	Not Available	600
3300017411|Ga0182208_1079919	Not Available	586
3300017411|Ga0182208_1116895	Not Available	519
3300017413|Ga0182222_1028636	Not Available	709
3300017413|Ga0182222_1062862	Not Available	580
3300017413|Ga0182222_1067501	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	569
3300017415|Ga0182202_1079579	Not Available	602
3300017415|Ga0182202_1121759	Not Available	525
3300017424|Ga0182219_1023613	Not Available	876
3300017425|Ga0182224_1160511	Not Available	507
3300017427|Ga0182190_1077773	Not Available	651
3300017427|Ga0182190_1125362	Not Available	553
3300017430|Ga0182192_1071617	Not Available	682
3300017436|Ga0182209_1045548	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	769
3300017436|Ga0182209_1153331	Not Available	524
3300017436|Ga0182209_1154500	Not Available	522
3300017438|Ga0182191_1030038	Not Available	907
3300017438|Ga0182191_1042475	Not Available	814
3300017438|Ga0182191_1096166	Not Available	625
3300017442|Ga0182221_1143711	Not Available	531
3300017443|Ga0182193_1083247	Not Available	676
3300017443|Ga0182193_1110543	Not Available	615
3300017443|Ga0182193_1121905	Not Available	595
3300017682|Ga0182229_1068410	Not Available	609
3300017684|Ga0182225_1069380	Not Available	631
3300017684|Ga0182225_1074218	Not Available	618
3300017684|Ga0182225_1095054	Not Available	573
3300017684|Ga0182225_1115171	Not Available	540
3300017685|Ga0182227_1110767	Not Available	543
3300017690|Ga0182223_1109762	Not Available	521
3300026023|Ga0207677_11864973	Not Available	558

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.58%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.85%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.58%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.56%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.85%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.58%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.56%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.85%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	95.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.85%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.85%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068867_1021465141	3300005459	Miscanthus Rhizosphere	ANHKAYHILWCRKIIFTSRVSLASTLCSQGLFTRIAGAA*
Ga0068866_112717351	3300005718	Miscanthus Rhizosphere	PANHKALHIPWSQETIPTSRISLVSTLCTQGLFTPVAGNA*
Ga0157378_112127001	3300013297	Miscanthus Rhizosphere	ASHIPWSREIIPTSWISLASTLCTHALFTPIEGDA*
Ga0182122_10241131	3300015267	Miscanthus Phyllosphere	KKPTNHKAYHILWSREIIPTSQISLASTFCTQGLFTPVVGDA*
Ga0182113_10446011	3300015269	Miscanthus Phyllosphere	NLGNHKAYHIHRSREIIPTYLVSLASTLCTQGLFTPVAGAA*
Ga0182188_10075731	3300015274	Miscanthus Phyllosphere	HKAYHIPWSQEIIPTSQTNLASTLFSQGLFTPVAGDA*
Ga0182188_10259561	3300015274	Miscanthus Phyllosphere	LSAQKKQANYKPYHISWSQKIIPTSRISLASILCTQGLFTPVVGDA*
Ga0182170_10552601	3300015276	Miscanthus Phyllosphere	YHIPWSRESIPTSRISLTSTMCTQGLFTPIAGNV*
Ga0182128_10095851	3300015277	Miscanthus Phyllosphere	AYHMPWSRKIILTSRMSLASTLCTQGLLTPVAGTA*
Ga0182128_10478071	3300015277	Miscanthus Phyllosphere	AYHIPWSRKIIPTSRISLASTFCTQGLFTPIAGAA*
Ga0182128_10487961	3300015277	Miscanthus Phyllosphere	PVNHKAYHILWSREIIATSQVSLVSTLCTQGLFTPIASAA*
Ga0182128_10593001	3300015277	Miscanthus Phyllosphere	KRKPANHKALHIPWSQETIPTSRISLASTLCTQGLFTPVAGTA*
Ga0182174_10540961	3300015279	Miscanthus Phyllosphere	STNLKAYHIPWSREIIPTSRISLASTLCTQGLFTPIVGTS*
Ga0182174_10605271	3300015279	Miscanthus Phyllosphere	FVKRKPVNHKAYHILWSRKIIPNSRVSLASILCTQGLFTPIAGAA*
Ga0182160_10591001	3300015281	Miscanthus Phyllosphere	HKALHIPWSREIIPTSRISLASTLCTQGLFTPVAGNA*
Ga0182124_10556401	3300015282	Miscanthus Phyllosphere	NHKAYHIPWSRKIIPTSQISLASTLYTQGLFTPIAGDA*
Ga0182124_10643261	3300015282	Miscanthus Phyllosphere	HEAYHIPWSQEIIPTSRISLASTLCTQGLFTPVAGDA*
Ga0182156_10357241	3300015283	Miscanthus Phyllosphere	YHILWSREIISTSWVSLASTLCTQGLFTLIAGAA*
Ga0182186_10637411	3300015285	Miscanthus Phyllosphere	KRKPTNHQAYHIPWSRKIIPTSRISFASTLCTQGLFTPVAGNA*
Ga0182186_10824491	3300015285	Miscanthus Phyllosphere	YHIPWSREIIPTSRISLASTLCTQGLFIPVVGDA*
Ga0182176_10781791	3300015286	Miscanthus Phyllosphere	HKAYHILWSQENIPTSWVSLASTLCTHGLFTPIVGAS*
Ga0182171_10548762	3300015287	Miscanthus Phyllosphere	HKAYHILWSREVIPTSRVSLVNTLCTQGLFTPVAGAA*
Ga0182171_10790441	3300015287	Miscanthus Phyllosphere	FRKQKGNPANHKAYHILWSREVIPISRVSLASTLCTQGLFTPVAGAA*
Ga0182171_10868241	3300015287	Miscanthus Phyllosphere	HKAYHIIWSWEVIPASRVSFASTLCTQGLFTPVASAT*
Ga0182173_10859091	3300015288	Miscanthus Phyllosphere	AYHILWSREIIPTSWVSLASTLCTQGLFTPVIGAS*
Ga0182138_10572401	3300015289	Miscanthus Phyllosphere	LLQKGNPANHKAYHILWSQKIIPTSRVSLESTLCTQGLFTPVAGAA*
Ga0182138_10743561	3300015289	Miscanthus Phyllosphere	KAYHIPWSREIIPTSRISLASTLCTQGLFTPVAGAA*
Ga0182125_10518871	3300015291	Miscanthus Phyllosphere	VLLSAKRKPANHKAYHIPWSQEIIPTSRISLVSTLCTQGLFTPVAGTA*
Ga0182126_10511661	3300015294	Miscanthus Phyllosphere	QKESPANHKTYHILWSREIIPTGWVSLTSTLCAQGLFTPVAGAA*
Ga0182126_10735642	3300015294	Miscanthus Phyllosphere	GFTISIAFRKKGNPANHKAYHIPWSREIIPTSRINLTSTLCTQGLFTPIAGAA*
Ga0182175_10361302	3300015295	Miscanthus Phyllosphere	HIAYHILESREIIPTSQVSLASTLCTQGLFYPVTGAA*
Ga0182175_10498741	3300015295	Miscanthus Phyllosphere	NPANHKAYHIPWSQEIIPTSRISLASTLCTQGLFTPVAGDA*
Ga0182175_10627651	3300015295	Miscanthus Phyllosphere	GNLANHKAYHIPLSQEIIPTSWISLASTLCTQGLFTPVAGAA*
Ga0182175_10872071	3300015295	Miscanthus Phyllosphere	ANHKVYHIPWSQEIIPTSRISLVSTLSTQGLFTPVVGAA*
Ga0182107_10639381	3300015299	Miscanthus Phyllosphere	LSTQIKKPANHKALHIPWSREIIPTSRISLASILCTQGLFTPVVGNA*
Ga0182107_10830211	3300015299	Miscanthus Phyllosphere	QKGNPANHKIYHIPWSQEIIPTSRISLASILCTQGLFIPIVGAA*
Ga0182108_10313872	3300015300	Miscanthus Phyllosphere	ANHKAYHLPSSQEIIPTSRISLASTLCTQGLFTPVAGNA*
Ga0182143_10130471	3300015302	Miscanthus Phyllosphere	FLQKGNPTNHKAYHILWSQEIIPTSRVSLASTLYTQGLFTPVAGAA*
Ga0182123_10464841	3300015303	Miscanthus Phyllosphere	QKGNSAYHKAYHIPWSQEIISTSQISLASTLCTQGLFTPVVGAACGVAVV*
Ga0182123_10569941	3300015303	Miscanthus Phyllosphere	QKKGNPANHKAYHILWSREIIPTSRVSLASTLCTQGLFTPVTGAA*
Ga0182123_10927951	3300015303	Miscanthus Phyllosphere	KPANHKAYHIPWSQEIIPTSRISLASTLCTQGLFTPVAGDA*
Ga0182112_10810991	3300015304	Miscanthus Phyllosphere	KAYHIPWSQKIIPTSRISLASTLYTQGLFTPVAGTA*
Ga0182144_10346521	3300015307	Miscanthus Phyllosphere	NHKAYHILWSREIIPTSRVSLASTLCTKGLFTPVVGAA*
Ga0182144_10673811	3300015307	Miscanthus Phyllosphere	MLFLQKENQANYKAYHILWSQKSIPTSRISLTSTLCTQGLFTP
Ga0182144_10715011	3300015307	Miscanthus Phyllosphere	VFSQKGNPTNHKAYPILQSQEIILTSWVNLANTLCTQGLFTPVAGAA*
Ga0182142_10602831	3300015308	Miscanthus Phyllosphere	NHKAYHIPWSWKIIPTSQISLASTLCTQGLFTPVADTA*
Ga0182164_10239621	3300015313	Switchgrass Phyllosphere	FCLRKPASHKAYHIPWSREIIPTSRVNLTSTLCTQGLLTPVAGDA*
Ga0182127_10141321	3300015321	Miscanthus Phyllosphere	GFTISNAFLQKGNPANYKAYHILWSREIIPTSRVSLTSTLCTQGLFTPVADAA*
Ga0182127_10641331	3300015321	Miscanthus Phyllosphere	HKSYHMLWSQKINPTSRVSLASTLCTQGLFTPVVGAS*
Ga0182127_11098591	3300015321	Miscanthus Phyllosphere	PTNHKAYHILWSQEIIPTSRVSLASTLCTQGLFTPIVGVA*
Ga0182110_10416861	3300015322	Miscanthus Phyllosphere	FWQNENLANHKTYHILWSQEIIPTSRVSLASTLCTQGLFTLVTGAA*
Ga0182110_11170281	3300015322	Miscanthus Phyllosphere	LSVKRKPANHKTYHIPWSRKIIPTSWISLASTLCTQGLFTPIAGTA*
Ga0182129_11094351	3300015323	Miscanthus Phyllosphere	CFLQKGNLANHKAYHTPWSRKIIPTSRISLASILYTHGLFTHVAGNA*
Ga0182187_10203301	3300015341	Miscanthus Phyllosphere	YFLQKGNPANHKTYHILWSLEVIPTSRVSLMSTLCTQGLFTPIAGAA*
Ga0182187_10308241	3300015341	Miscanthus Phyllosphere	YHILWSREIIPTSRVSLTSILCTQGLFNPVACAA*
Ga0182109_10858681	3300015342	Miscanthus Phyllosphere	KPTNHKAYHIPWSREIIPTSRISLASTLSTQGLFTSVAGAA*
Ga0182109_11013482	3300015342	Miscanthus Phyllosphere	KHKAYHIPWSRKIIPTSRISPASTLCTQGLFTPVASAA*
Ga0182109_12019341	3300015342	Miscanthus Phyllosphere	MAFCKKNPANHKAYHIPWSREIIPTSRISLASTLCTQGLFTPVAGDA
Ga0182155_12184291	3300015343	Miscanthus Phyllosphere	AYHIPWSRKIIPTSRISLASTLCTHGLFTPIAGTA*
Ga0182155_12241021	3300015343	Miscanthus Phyllosphere	NHKALHIPWSQETIPTSRISLANTLCTQDLFTHVVGNA*
Ga0182189_11541561	3300015344	Miscanthus Phyllosphere	QKGNLAYHKAYHILWSQEIIPTSRVSLASTLCTQGLFTPVAGVT*
Ga0182111_11131951	3300015345	Miscanthus Phyllosphere	QKENPANHKAYHILWSQEIIPTSRVSLASTLCTQGLFTPVVGAA*
Ga0182111_11764411	3300015345	Miscanthus Phyllosphere	CFSQKENSANHKAYHILWSREIIPTSWVSLASTLYMQGLFTPIVGVA*
Ga0182111_12183241	3300015345	Miscanthus Phyllosphere	THKAYHILWSREIILTSWISLASTVCTQGLFTPVAGAA*
Ga0182111_12320871	3300015345	Miscanthus Phyllosphere	QKGNPANHKAYHIPWSREIIPTSRVSLVSTLCTQGLFTLVVGAT*
Ga0182139_12022201	3300015346	Miscanthus Phyllosphere	AYHIPWSRKIIPTSRISLATTLCTQGLFTPVVGNA*
Ga0182139_12023991	3300015346	Miscanthus Phyllosphere	HKVYHIPWSREIIPTSRISLASTLCTQGLFTLVAGNA*
Ga0182177_12087801	3300015347	Miscanthus Phyllosphere	KAYHILWSREIIPTSRVSLASTLCTQGLLTHVAGAA*
Ga0182161_10986061	3300015351	Miscanthus Phyllosphere	AYHIPWSQEIILTSRITLASTLCTQGLFTPVVSDA*
Ga0182161_12128471	3300015351	Miscanthus Phyllosphere	YHILWSREIIPTSRVSLASTLCTQGLFTPVARAA*
Ga0182159_10568421	3300015355	Miscanthus Phyllosphere	VYHIPWSRETIPTSQVNLASTLCTQGLFTLVVGAV*
Ga0182159_11948171	3300015355	Miscanthus Phyllosphere	NPANHKAYHIPWSREIIPTSQISLASTLCTQGLFTPVAGVA*
Ga0182159_12319661	3300015355	Miscanthus Phyllosphere	AYHIPWSRKIILTSRINLASTLCTQGLFTPVAGAA*
Ga0182159_12328691	3300015355	Miscanthus Phyllosphere	ATHKAYHIPWSREIIPTSRIRLASTLCTQGLFTPVVGTA*
Ga0182159_12664701	3300015355	Miscanthus Phyllosphere	LSAKRKLVNHKAYHIPWSQKIIPTSRISLASTLCTQGLFTPVVGDA*
Ga0182159_12830741	3300015355	Miscanthus Phyllosphere	AYHISWSWEIIPTSWISHASTLCTQGLFTPVAGNV*
Ga0182159_13035171	3300015355	Miscanthus Phyllosphere	RAYHILWSQEIIPTSQVSLASTLCTQGLFTLVASAA*
Ga0182159_13059811	3300015355	Miscanthus Phyllosphere	KAYHILWSQEIIPTSRVSLASILCTQGLFIPVIGVA*
Ga0182159_13365441	3300015355	Miscanthus Phyllosphere	KRNPANPKALHIPWSQEIIPTSWISLASTLCTQGLFTPVAG*
Ga0182145_10898221	3300015361	Miscanthus Phyllosphere	AYHIPWSQEIIPTSRISLASILCTHGLFTPVAGDA*
Ga0182145_11265151	3300015361	Miscanthus Phyllosphere	VLLSAKRKPANHKAYHIPWSRKIIPTSRINLASTLCTQGLFTPVAGDA*
Ga0182145_11357591	3300015361	Miscanthus Phyllosphere	NHKVYHIPWSREVIPTSRISLASTLCTQGLFTHVAGDA*
Ga0182203_10408351	3300017404	Miscanthus Phyllosphere	TNDKAYHILWSQEIILTSQVSHASTLCTYGLFTPVASVA
Ga0182203_11332421	3300017404	Miscanthus Phyllosphere	PQKGNLANHKAYHILWSREIISTSRVSLASTLCTQGLFTPVAGAA
Ga0182220_10724121	3300017407	Miscanthus Phyllosphere	CFSQKENPINHKTYHILWSQEIIPTSRVSLASPLCTQGLFTPIAGAA
Ga0182208_10618141	3300017411	Miscanthus Phyllosphere	PANHKALHIPWSREIIPTSRISLASTLCTQGLFTPVAGNA
Ga0182208_10738481	3300017411	Miscanthus Phyllosphere	KTYHIPWSREIILTNRISVTSTLYTQGLFTPVAGVA
Ga0182208_10799191	3300017411	Miscanthus Phyllosphere	KAYHIPWSREIIPTSRISLVSTLCTQGLFTPVAGTA
Ga0182208_11168951	3300017411	Miscanthus Phyllosphere	FSQKGNLANHKAYHILWSREIILTTRVSLVSTLCTHGLFTPIVGAA
Ga0182222_10286361	3300017413	Miscanthus Phyllosphere	ANHKAYNILWSKEIIPTSRLSLARTLCTQGLFTPITDAA
Ga0182222_10628621	3300017413	Miscanthus Phyllosphere	KGNTANQKAYHILWSQKIIPTSRVSLVSTLCTQGLFTPVVGAA
Ga0182222_10675011	3300017413	Miscanthus Phyllosphere	HITYHTPWSREIIPTSQVSLASTLCTQGLFYPIVGAA
Ga0182202_10795791	3300017415	Miscanthus Phyllosphere	ENPANHKVYHIPWSQKIIPTSRISLASTLCTQGLFTPVVGAA
Ga0182202_11217591	3300017415	Miscanthus Phyllosphere	HKAYHIHWSWENIPTSRISLVNTLCTQGLFTPVVGTA
Ga0182219_10236131	3300017424	Miscanthus Phyllosphere	YKAYYILWSQEIIPTSRVSLESTLCTQGLFTPVAGAA
Ga0182224_11605111	3300017425	Miscanthus Phyllosphere	MLYAQKKPANHKAYHVPWSREIIPTSRISLASTLCTQGLFTPVAGDA
Ga0182190_10777731	3300017427	Miscanthus Phyllosphere	CFLQKGNPVNHKAYHILWSQEIISTSQVSIASILCTQGLFTPVVGAA
Ga0182190_11253621	3300017427	Miscanthus Phyllosphere	NPTNHKAYHILWSREIIPTSQVSLVSTLCTQGLFTPVVGVA
Ga0182192_10716171	3300017430	Miscanthus Phyllosphere	KAYHIPWSREIIPTSRISLASTLCTQGLFTPVAGTA
Ga0182209_10455481	3300017436	Miscanthus Phyllosphere	HKAHHTPWSQEIIPTSWISLVSILCTQGLFTPIVGNA
Ga0182209_11533311	3300017436	Miscanthus Phyllosphere	IAFCKRKLANQKALHIPWSREAIPTSRISLASTLCTQGLFTPVAGNA
Ga0182209_11545001	3300017436	Miscanthus Phyllosphere	VLLSAKRKPANHKAYHIPWSWEIIPTSQISLASTLCTQGLFTLVAGDA
Ga0182191_10300381	3300017438	Miscanthus Phyllosphere	KKPANHKAYHIPWSQEIIPTSRISLASTLCTQGLFTPVAGTA
Ga0182191_10424751	3300017438	Miscanthus Phyllosphere	PANHKAYHILWSQEIISTSRITLASTLCTQGLFTPVAGDA
Ga0182191_10961661	3300017438	Miscanthus Phyllosphere	LANHKAYHIPWSQESIPTSRISLTSILCTQGLFTLVADNV
Ga0182221_11437111	3300017442	Miscanthus Phyllosphere	KALDIPWSWETIPTSQISLASTLCIQGLFTPVVGNA
Ga0182193_10832471	3300017443	Miscanthus Phyllosphere	LQKKKPANHKAYHIPWSRKIIPTSRISLASMLCTQGLFTPVAGTARGVAVV
Ga0182193_11105431	3300017443	Miscanthus Phyllosphere	PANHKAYHILWSQKIIPTSRVCLASILCTQGLFTPVAGAA
Ga0182193_11219051	3300017443	Miscanthus Phyllosphere	QKGNPANHKAYHILWSQEIILTSRVSLASTLCTQGLFTPIVGAA
Ga0182229_10684101	3300017682	Miscanthus Phyllosphere	FSAKRKPSSHNAYHIRWSWETIPTSRVSLTSILYTQGLFTPVAGAA
Ga0182225_10693801	3300017684	Miscanthus Phyllosphere	NHKVSHIPWSRKIIPTSQISLASTLCTQGLFTPIVGDA
Ga0182225_10742181	3300017684	Miscanthus Phyllosphere	PYCLSYPWSQETIPTSRVSFTSTLCTQGLFTPIAGAA
Ga0182225_10950541	3300017684	Miscanthus Phyllosphere	NDSLLVKLSQKENPSNHKAYHILWSREIIPTSRVSLTSTLCTQGLFMPIAGVA
Ga0182225_11151711	3300017684	Miscanthus Phyllosphere	TKRKPANHKAYYIPWSQKTILTSRISLVSTLCTQGLFTPIEGTA
Ga0182227_11107671	3300017685	Miscanthus Phyllosphere	ANHTALHIPWSWETIPTSQISLASTLCTQGLFTPVAGAA
Ga0182223_11097621	3300017690	Miscanthus Phyllosphere	HKAYHIPWSQKIIPTSRISLASTLCTQGLFTPVAGNV
Ga0207677_118649731	3300026023	Miscanthus Rhizosphere	HKAYHILWSQEIIPTSRVSLASTLCTQGLFTPVAGAA