| Basic Information | |
|---|---|
| Family ID | F076646 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DNPLLLPYPTLRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.93 % |
| % of genes near scaffold ends (potentially truncated) | 90.68 % |
| % of genes from short scaffolds (< 2000 bps) | 87.29 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (12.712 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.356 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.068 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.65% β-sheet: 0.00% Coil/Unstructured: 51.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF03641 | Lysine_decarbox | 28.81 |
| PF02581 | TMP-TENI | 5.08 |
| PF16491 | Peptidase_M48_N | 4.24 |
| PF13181 | TPR_8 | 2.54 |
| PF00474 | SSF | 0.85 |
| PF04055 | Radical_SAM | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 28.81 |
| COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 5.08 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001098|JGI12633J13313_103507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 760 | Open in IMG/M |
| 3300001170|JGI12704J13340_1002187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2208 | Open in IMG/M |
| 3300001356|JGI12269J14319_10343687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 527 | Open in IMG/M |
| 3300001593|JGI12635J15846_10900101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 505 | Open in IMG/M |
| 3300004080|Ga0062385_10008021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3455 | Open in IMG/M |
| 3300004080|Ga0062385_10744709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 636 | Open in IMG/M |
| 3300004082|Ga0062384_100124529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
| 3300005172|Ga0066683_10737924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 579 | Open in IMG/M |
| 3300005445|Ga0070708_100314712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1475 | Open in IMG/M |
| 3300006046|Ga0066652_101274823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 694 | Open in IMG/M |
| 3300006050|Ga0075028_100204721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1067 | Open in IMG/M |
| 3300006050|Ga0075028_101058256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 507 | Open in IMG/M |
| 3300006102|Ga0075015_100341245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 833 | Open in IMG/M |
| 3300006102|Ga0075015_100952808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300006162|Ga0075030_101611456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300006173|Ga0070716_100411985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 975 | Open in IMG/M |
| 3300006174|Ga0075014_100770103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 566 | Open in IMG/M |
| 3300006354|Ga0075021_11192294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
| 3300006864|Ga0066797_1050180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1468 | Open in IMG/M |
| 3300009038|Ga0099829_10680591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 855 | Open in IMG/M |
| 3300009088|Ga0099830_10653442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300009618|Ga0116127_1098796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300009629|Ga0116119_1174817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300009641|Ga0116120_1086161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300009645|Ga0116106_1039368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1603 | Open in IMG/M |
| 3300009646|Ga0116132_1195640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300009683|Ga0116224_10509272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300009698|Ga0116216_10945179 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009824|Ga0116219_10200984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1141 | Open in IMG/M |
| 3300009839|Ga0116223_10545249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300010339|Ga0074046_10895168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 516 | Open in IMG/M |
| 3300010341|Ga0074045_10176520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1440 | Open in IMG/M |
| 3300010379|Ga0136449_103438558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300011269|Ga0137392_10953765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 705 | Open in IMG/M |
| 3300012205|Ga0137362_10856499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 777 | Open in IMG/M |
| 3300012208|Ga0137376_10840335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 789 | Open in IMG/M |
| 3300012208|Ga0137376_10937952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 742 | Open in IMG/M |
| 3300012917|Ga0137395_10946696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 620 | Open in IMG/M |
| 3300012925|Ga0137419_11972886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 501 | Open in IMG/M |
| 3300012927|Ga0137416_11512678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 610 | Open in IMG/M |
| 3300014156|Ga0181518_10049823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2526 | Open in IMG/M |
| 3300014200|Ga0181526_11090733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 501 | Open in IMG/M |
| 3300014490|Ga0182010_10918700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
| 3300014839|Ga0182027_10184388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2433 | Open in IMG/M |
| 3300015193|Ga0167668_1017613 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300015241|Ga0137418_10536622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300017926|Ga0187807_1205741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 638 | Open in IMG/M |
| 3300017935|Ga0187848_10484833 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300017938|Ga0187854_10468626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300017946|Ga0187879_10569180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300018002|Ga0187868_1177486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300018005|Ga0187878_1049266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1910 | Open in IMG/M |
| 3300018014|Ga0187860_1120537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300018016|Ga0187880_1114342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1311 | Open in IMG/M |
| 3300018019|Ga0187874_10365611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 583 | Open in IMG/M |
| 3300018023|Ga0187889_10302184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 708 | Open in IMG/M |
| 3300018034|Ga0187863_10640607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 599 | Open in IMG/M |
| 3300018034|Ga0187863_10879006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 509 | Open in IMG/M |
| 3300018042|Ga0187871_10040125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2871 | Open in IMG/M |
| 3300018042|Ga0187871_10088215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1799 | Open in IMG/M |
| 3300018042|Ga0187871_10105708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
| 3300018057|Ga0187858_10343285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
| 3300018062|Ga0187784_10871161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300019785|Ga0182022_1332635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1184 | Open in IMG/M |
| 3300020580|Ga0210403_10613628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 877 | Open in IMG/M |
| 3300020583|Ga0210401_10236121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1687 | Open in IMG/M |
| 3300021168|Ga0210406_10107409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2367 | Open in IMG/M |
| 3300021170|Ga0210400_11239356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 600 | Open in IMG/M |
| 3300021181|Ga0210388_10343052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
| 3300021407|Ga0210383_10159219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1922 | Open in IMG/M |
| 3300021478|Ga0210402_10154293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2093 | Open in IMG/M |
| 3300021559|Ga0210409_10283899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1494 | Open in IMG/M |
| 3300023250|Ga0224544_1007292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1488 | Open in IMG/M |
| 3300023259|Ga0224551_1002107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3331 | Open in IMG/M |
| 3300024240|Ga0224522_1143390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 547 | Open in IMG/M |
| 3300024295|Ga0224556_1128315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 620 | Open in IMG/M |
| 3300025454|Ga0208039_1050404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 769 | Open in IMG/M |
| 3300025939|Ga0207665_10641191 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 832 | Open in IMG/M |
| 3300026310|Ga0209239_1096624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1259 | Open in IMG/M |
| 3300026446|Ga0257178_1057828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300026552|Ga0209577_10721949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 561 | Open in IMG/M |
| 3300027381|Ga0208983_1095453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 552 | Open in IMG/M |
| 3300027545|Ga0209008_1014056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1885 | Open in IMG/M |
| 3300027568|Ga0208042_1017863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1832 | Open in IMG/M |
| 3300027609|Ga0209221_1000437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17668 | Open in IMG/M |
| 3300027633|Ga0208988_1098806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300027676|Ga0209333_1008060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3322 | Open in IMG/M |
| 3300027729|Ga0209248_10191650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300027853|Ga0209274_10289150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 841 | Open in IMG/M |
| 3300027879|Ga0209169_10475906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 656 | Open in IMG/M |
| 3300027894|Ga0209068_10990078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300027898|Ga0209067_10378620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 789 | Open in IMG/M |
| 3300027903|Ga0209488_11079218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
| 3300027908|Ga0209006_10477030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300027911|Ga0209698_10182363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1706 | Open in IMG/M |
| 3300027911|Ga0209698_10763620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300028673|Ga0257175_1056778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 725 | Open in IMG/M |
| 3300028780|Ga0302225_10018490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3544 | Open in IMG/M |
| 3300029910|Ga0311369_10115073 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
| 3300029917|Ga0311326_10036108 | All Organisms → cellular organisms → Bacteria | 2933 | Open in IMG/M |
| 3300029943|Ga0311340_10535821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
| 3300030507|Ga0302192_10045261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2291 | Open in IMG/M |
| 3300030519|Ga0302193_10004195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11457 | Open in IMG/M |
| 3300030524|Ga0311357_11729196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300030706|Ga0310039_10260364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 666 | Open in IMG/M |
| 3300030737|Ga0302310_10528425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 630 | Open in IMG/M |
| 3300030838|Ga0311335_10797645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 668 | Open in IMG/M |
| 3300031057|Ga0170834_106066512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 537 | Open in IMG/M |
| 3300031234|Ga0302325_12521168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 613 | Open in IMG/M |
| 3300031236|Ga0302324_100917210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1202 | Open in IMG/M |
| 3300031524|Ga0302320_10604174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1281 | Open in IMG/M |
| 3300031715|Ga0307476_10221631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1377 | Open in IMG/M |
| 3300031754|Ga0307475_10916944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 691 | Open in IMG/M |
| 3300032180|Ga0307471_102118977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 707 | Open in IMG/M |
| 3300032805|Ga0335078_10746152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1204 | Open in IMG/M |
| 3300033486|Ga0316624_10779335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 848 | Open in IMG/M |
| 3300033807|Ga0314866_051793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 674 | Open in IMG/M |
| 3300034090|Ga0326723_0308358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 12.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 9.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.78% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.08% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.39% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.39% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.54% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.54% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.69% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.85% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001098 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 | Environmental | Open in IMG/M |
| 3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024240 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12633J13313_1035072 | 3300001098 | Forest Soil | PEWSDNPLLVSYPTLRNIVASGFARGLATGLGVLNVWIGFWEAIQYREE* |
| JGI12704J13340_10021872 | 3300001170 | Forest Soil | MILPWRPEWSDNPLLSPHPTLRALVTSGFARGLSTGLGVINVWIGFWEAIQYREE* |
| JGI12269J14319_103436871 | 3300001356 | Peatlands Soil | LPYPTFRAIVASGFSRGVATGLGVLNVWIGFWEAIQYREEE* |
| JGI12635J15846_109001011 | 3300001593 | Forest Soil | ALVASGFVRGLATGLGVLNVWIGFWEAIQYREGE* |
| Ga0062385_100080211 | 3300004080 | Bog Forest Soil | LPYPELRAVVASGFARGVATGLGVINVWIGFWEAIQYREEE* |
| Ga0062385_107447091 | 3300004080 | Bog Forest Soil | LLPFPALRTVVASGFVRGVATGLGALNVWIGFWEAIQYREEE* |
| Ga0062384_1001245292 | 3300004082 | Bog Forest Soil | PEWSDNPLLMPYPTLRSLVSSGFARGVSTGLGMLNVWIGFWEAIQYQE* |
| Ga0066683_107379241 | 3300005172 | Soil | PWRPEWADNHLLLPYPTLRAIFASGFVRGVCTGLGVLNVWIGFWEAIQYREDG* |
| Ga0070708_1003147121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RPEWADNHLLLPYPTLRAIFASGFVRGVCTGLGVLNVWIGFWEAIQYREDG* |
| Ga0066652_1012748231 | 3300006046 | Soil | NHLLLPYPTLRAIFASGFVRGVCTGLGVLNVWIGFWEAIQYREDG* |
| Ga0075028_1002047211 | 3300006050 | Watersheds | PTLRAIVGSGFARGVFTGLGVLNVWIGFWEAIQYRED* |
| Ga0075028_1010582561 | 3300006050 | Watersheds | PEWSDNPLLLPYPAIRGVISSGFARGVSTGLGVLNVWIGFWEAIQYRED* |
| Ga0075015_1003412452 | 3300006102 | Watersheds | LPWRPEWADNHLLLPYPMLRSIVSTGFVRGVCTGLGVLNVWIGFQEAIQYRED* |
| Ga0075015_1009528082 | 3300006102 | Watersheds | LFPYPTLRSIFGSGFVRGVCTGLGFLNVWVGFQEAIQYRED* |
| Ga0075030_1016114561 | 3300006162 | Watersheds | RAVVASGFARGLSTGLGALNVWIGFWEAIQYREEE* |
| Ga0070716_1004119851 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | WADNHLLLPYPTLRAVFASGFVRGVCTGLGVLNVWIGFWEAIQYREDG* |
| Ga0075014_1007701031 | 3300006174 | Watersheds | PYPMLRSIVGNGFVRGVCTGLGVLNVWIGFQEAIQYRED* |
| Ga0075021_111922941 | 3300006354 | Watersheds | LLPYPTLRSIVSTGFVRGVCTGLGFLNVWVGFQEAIQYRED* |
| Ga0066797_10501802 | 3300006864 | Soil | EWSDNPLLLPYPTLRAIVASGFARGLATGLGVLNVWIGFWEAIQYREE* |
| Ga0099829_106805911 | 3300009038 | Vadose Zone Soil | DNPLLLPYPTLRAVVASGFARGLATGLGVLNVWIGFWEAIQYREEE* |
| Ga0099830_106534421 | 3300009088 | Vadose Zone Soil | LRAMVASGFARGLSTGLGVLNVWIGFWEAVQYREEQ* |
| Ga0116127_10987962 | 3300009618 | Peatland | YPTLRAVVASGFVRGVSTGLGVINVWIGFWEAIQYREEE* |
| Ga0116119_11748171 | 3300009629 | Peatland | RAVAASGFTRGVATGLGALNVWIGFWEAIQYREEE* |
| Ga0116120_10861611 | 3300009641 | Peatland | MILPWRPEWSDNPLLLPYPSLRAVAASGFTRGVATGLGALNVWIGFWEAIQYREEE* |
| Ga0116106_10393683 | 3300009645 | Peatland | MLMILPWRPEWSDNPLLLPYPTLRAVVASGFVRGLSTGLGALNVWIGFWEAIQYREGDE* |
| Ga0116132_11956402 | 3300009646 | Peatland | LLLPYPSLRAVAASGFTRGVATGLGALNVWIGFWEAIQYREEE* |
| Ga0116224_105092722 | 3300009683 | Peatlands Soil | MILPWRPEWSDNPLLLPYPTLRAIVASGFARGVSTGLGVLNVWIGFWEAIQYREE* |
| Ga0116216_109451791 | 3300009698 | Peatlands Soil | ILPWRPEWSDNPLLLPYPTLRSVVSSGFVRGLSSGLGALNVWIGFWEAIQYREENE* |
| Ga0116219_102009841 | 3300009824 | Peatlands Soil | MILPWRPEWSDNPLLLPYPTIRTVVASGFARGVSTGLGVLNVWIGFWEAIQYREEE* |
| Ga0116223_105452492 | 3300009839 | Peatlands Soil | RAIVASGFARGVSTGLGVLNVWIGFWEAIQYREE* |
| Ga0074046_108951681 | 3300010339 | Bog Forest Soil | PLLLPYPTLRAVVASGFARGVATGLGVLNVWIGFWEAIQYQEEE* |
| Ga0074045_101765202 | 3300010341 | Bog Forest Soil | PEWSDNPLLLPYPALRVLIASGFARGLATGLGLLNVWIGFWEAIQYREEE* |
| Ga0136449_1034385582 | 3300010379 | Peatlands Soil | PTFRAVVASGFVRGVATGLGVLNVWIGFWEAIQYQEEE* |
| Ga0137392_109537651 | 3300011269 | Vadose Zone Soil | LPYPALRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEEY* |
| Ga0137362_108564991 | 3300012205 | Vadose Zone Soil | DNPLLLPYPTLRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE* |
| Ga0137376_108403352 | 3300012208 | Vadose Zone Soil | PYPTLRAIFASGFVRGVCTGLGVLNVWIGFWEAIQYREDG* |
| Ga0137376_109379521 | 3300012208 | Vadose Zone Soil | LPWRPEWSDNPLLLPYPTLRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE* |
| Ga0137395_109466961 | 3300012917 | Vadose Zone Soil | NPLLLTYPTLRAVVGSGFARGLATGLGVLNVWIGFWEAIQYREEE* |
| Ga0137419_119728861 | 3300012925 | Vadose Zone Soil | PWRPEWADNHLLLPFPTLRAIFENGFTRGVCTGLGVLNVWIGFWEAIQYREE* |
| Ga0137416_115126781 | 3300012927 | Vadose Zone Soil | PEWSDNPLLLPYPTLRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE* |
| Ga0181518_100498233 | 3300014156 | Bog | FPYPTLRTVVASGFVRGVATGLGVLNVWIGFWEAIQYQEEE* |
| Ga0181526_110907332 | 3300014200 | Bog | YPQLRAVVASGFARGVSTGLGVINVWIGFWEAIQYREEE* |
| Ga0182010_109187002 | 3300014490 | Fen | EWSDNHLILPYPMIRAVVASGFVRGVSTGLGVINVWIGFWEAMQYRED* |
| Ga0182027_101843883 | 3300014839 | Fen | YPTLRAIVASGFARGVSTGLGVLNVWIGFWEAIQYQEE* |
| Ga0167668_10176133 | 3300015193 | Glacier Forefield Soil | MVASGFVRGLATGLGVLNVWIGFWEAIQYREGNE* |
| Ga0137418_105366221 | 3300015241 | Vadose Zone Soil | LRAIFASGFVRGVCTGLGVLNVWIGFWEAIQYREDG* |
| Ga0187807_12057411 | 3300017926 | Freshwater Sediment | LLFSYPTFRAVVASGFVRGVATGLGVLNVWIGFWEAIQYQEEE |
| Ga0187848_104848332 | 3300017935 | Peatland | ILPWRSEWSENPLLLPYPTLRALFASGFARGVSTGLGALNVWIGFWEAIQYREE |
| Ga0187854_104686261 | 3300017938 | Peatland | LRAVIGSGFARGVSTGLGVINVWIGFWEAIQYREEE |
| Ga0187879_105691801 | 3300017946 | Peatland | MLMILPWRPEWSDNPLLLPYPTLRAVVASGFVRGLSTGLGALNVWIGFWEAIQYREGDE |
| Ga0187868_11774861 | 3300018002 | Peatland | LMILPWRPEWSDNPLLLPYPSLRAVAASGFTRGVATGLGALNVWIGFWEAIQYREEE |
| Ga0187878_10492663 | 3300018005 | Peatland | WRPEWSDNPLLLPYPTLRAVVASGFVRGVSTGLGVINVWIGFWEAIQYREEE |
| Ga0187860_11205371 | 3300018014 | Peatland | PWRPEWSDNPLLLPYPSLRAVAASGFTRGVATGLGALNVWIGFWEAIQYREEE |
| Ga0187880_11143422 | 3300018016 | Peatland | MILPWRPEWSDNPLLLPYPTLRAAVASGFVRGVATGLGALNVWIGFWEAIRYQEEE |
| Ga0187874_103656112 | 3300018019 | Peatland | WRPEWSDNPLLFSYPTFRAVVASGFVRGVATGLGVLNVWIGFWEAIQYREEE |
| Ga0187889_103021842 | 3300018023 | Peatland | PYPQLRAVVASGFARGVSTGLGVINVWIGFWEAIQYREEA |
| Ga0187863_106406071 | 3300018034 | Peatland | ILPWRPEWSDNPLLLPYPMLRAAVGSGFARGLSTGLGALNVWIGFWEAIQYREE |
| Ga0187863_108790062 | 3300018034 | Peatland | WRPEWSDNPLLFSYPTIRAVVASGFVRGVATGLGVLNVWIGFWEAIQYREEE |
| Ga0187871_100401254 | 3300018042 | Peatland | SDNPLLLPYPTLRAFVASGFARGVATGLGVLNVWIGFYEAIQYREEE |
| Ga0187871_100882153 | 3300018042 | Peatland | DNPLLLPYPTLHAVMASGFARGVSTGLGLLNVWIGFWEAIQYREE |
| Ga0187871_101057083 | 3300018042 | Peatland | ENPLLLPYPTLRALFASGFARGVSTGLGALNVWIGFWEAIQYREE |
| Ga0187858_103432852 | 3300018057 | Peatland | RAVVASGFVRGVATGLGVLNVWIGFWEAIQYREEE |
| Ga0187784_108711612 | 3300018062 | Tropical Peatland | YPAIRDVVSSGFVRGVITGLGLLNVRMGFWEAIQYRED |
| Ga0182022_13326353 | 3300019785 | Fen | MLMILPWRPEWSDNPCFFRIPRFRAVVATGFARGVATGLGVLNVWIGFWEAIQ |
| Ga0210403_106136281 | 3300020580 | Soil | MLMILPWRPEWSDNPLLLPYPTVRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE |
| Ga0210401_102361213 | 3300020583 | Soil | YPALRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE |
| Ga0210406_101074091 | 3300021168 | Soil | LPYPTVRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE |
| Ga0210400_112393562 | 3300021170 | Soil | NPLLLPYPTVRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE |
| Ga0210388_103430522 | 3300021181 | Soil | PALHDLVASGFMRGLVTGLGLLNVWIGFWEALQYHEE |
| Ga0210383_101592191 | 3300021407 | Soil | LSYPALRAFVASGFARGAATGLGVLNVWIGFWEAIQYQED |
| Ga0210402_101542934 | 3300021478 | Soil | SYPALHALVASGFTRGLVTGLGLLNVWIGFWEALQYRED |
| Ga0210409_102838991 | 3300021559 | Soil | WRPEWSDNPLLVPYPTLRAFVASGFARGVSTGLGVLNVWVGFYEAIQYREEE |
| Ga0224544_10072922 | 3300023250 | Soil | PYPALRGIVDSGFARGLATGLGVLNVWIGFWEAIQYREEE |
| Ga0224551_10021074 | 3300023259 | Soil | VMLMILPWRPEWSDNPLLLPHPMLRAVVGSGFARGLSTGLGALNVWIGFWEAIQYREE |
| Ga0224522_11433901 | 3300024240 | Soil | PYPTLRAIVASGFARGVSTGLGVLNVWIGFWEAIQYQEE |
| Ga0224556_11283151 | 3300024295 | Soil | STYPALRAIVASGFARGVATGLGLLNVWIGFWEAIQYREE |
| Ga0208039_10504041 | 3300025454 | Peatland | NPLLLPYPTFRAVVASGFARGVATGLGVLNVWIGFWEAIQYQEEE |
| Ga0207665_106411911 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TLRAVFASGFVRGVCTGLGVLNVWIGFWEAIQYREDG |
| Ga0209239_10966241 | 3300026310 | Grasslands Soil | ILPWRPEWSDNPLLLPYPTLRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE |
| Ga0257178_10578281 | 3300026446 | Soil | LLPYPEFRVLVASGFARGLATGLGVLNVWIGFWEAVQYREE |
| Ga0209577_107219491 | 3300026552 | Soil | MILPWRPEWSDNPLLLPYPTLRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE |
| Ga0208983_10954531 | 3300027381 | Forest Soil | PLLLPYPTLRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREEE |
| Ga0209008_10140561 | 3300027545 | Forest Soil | ENPLLLSYPALHDLVASGFTRGLVTGLGLLNVWIGFWEALQYHEE |
| Ga0208042_10178633 | 3300027568 | Peatlands Soil | QLRAVVASGFARGVSTGLGVINVWIGFWEAIQYREEE |
| Ga0209221_10004378 | 3300027609 | Forest Soil | MILPWRPEWSDNPLLSPHPTLRALVTSGFARGLSTGLGVINVWIGFWEAIQYREE |
| Ga0208988_10988061 | 3300027633 | Forest Soil | PALLTIFSSGFTRGVCTGLGVLNVWIGFWEAIQYREE |
| Ga0209333_10080601 | 3300027676 | Forest Soil | MILPWRPEWSDNPLLLPHPTLRALVTSGFARGLSTGLGVINVWIGFWEAIQYREE |
| Ga0209248_101916502 | 3300027729 | Bog Forest Soil | NPLLLPYPTLHAVMASGFARGASTGLGLLNVWIGFWEAMQYRED |
| Ga0209274_102891502 | 3300027853 | Soil | LLLPYPTLRAFVASGFARGVSTGLGLLNVWIGFSEAIQYREEE |
| Ga0209169_104759063 | 3300027879 | Soil | NPLLLSYPTLHDLATTGFIRGVVTGLGLLNVWIGFWEALQYRED |
| Ga0209068_109900781 | 3300027894 | Watersheds | LLPYPTLRSIVSTGFVRGVCTGLGFLNVWVGFQEAIQYRED |
| Ga0209067_103786201 | 3300027898 | Watersheds | ILPWRPEWSDNPLLLPYPTIRAFVASGFTRGVSTGLGVLNVWIGFWEAIQYREE |
| Ga0209488_110792182 | 3300027903 | Vadose Zone Soil | WSDNPLLLPYPTLRTVVASGFARGLSTGLGVINVWIGFWEAIQYREEE |
| Ga0209006_104770301 | 3300027908 | Forest Soil | LRNIVASGFARGLATGLGVLNVWIGFWEAIQYREE |
| Ga0209698_101823631 | 3300027911 | Watersheds | RPEWSDNPLLLPYPTLRALVASGFARGVSTGLGALNVWIGFWEAIQYREGDE |
| Ga0209698_107636202 | 3300027911 | Watersheds | RPEWSDNPLLLPYPTLRALVASGFARGVSTGLGALNVWIGFWEAIQYREE |
| Ga0257175_10567782 | 3300028673 | Soil | LLPYPTLRAVFASGFVRGVCTGLGVLNVWIGFWEAIQYREDG |
| Ga0302225_100184905 | 3300028780 | Palsa | SYPALRAIMASGFARGLATGLGVLNVWIGFWEAIQYREEE |
| Ga0311369_101150732 | 3300029910 | Palsa | MLMILPWRPEWSDNPLLLPYPVLRAVVASGFARGLSTGLGALNVWIGFWEAIQYREE |
| Ga0311326_100361081 | 3300029917 | Bog | PAIRAFIGSGFARGVAMGLGVLNVWIGFWEAIQYREE |
| Ga0311340_105358212 | 3300029943 | Palsa | MLMILPWRPEWAENPLLLPYPALRGIVDSGFARGLATGLGVLNVWIGFWEAIQYREEE |
| Ga0302192_100452612 | 3300030507 | Bog | MIVPWRPEWTDNPLLSSYPAIRAFIGSGFARGVAMGLGVLNVWIGFWEAIQYREE |
| Ga0302193_1000419512 | 3300030519 | Bog | PALRAIVASGFARGVATGLGLLNVWIGFWEAIQYREE |
| Ga0311357_117291962 | 3300030524 | Palsa | MILPWRPEWSDNPLLLPYPVLRAVVASGFARGLSTGLGALNVWIGFWEAIQYREE |
| Ga0310039_102603642 | 3300030706 | Peatlands Soil | SDNPLLFSYPTFRAVVASGFVRGVATGLGVLNVWIGFWEAIQYQEEE |
| Ga0302310_105284251 | 3300030737 | Palsa | YPALRAIMASGFARGLATGLGVLNVWIGFWEAIQYREEE |
| Ga0311335_107976452 | 3300030838 | Fen | NHLLMRYPTLLAIFANGFTRGVCTGLGVLNVWIGFWEAIQYQED |
| Ga0170834_1060665121 | 3300031057 | Forest Soil | LMILPWRPEWSDNPLLLPYPTLRAVVASGFARGLATGLGVLNVWIGFWEAIQYREEE |
| Ga0302325_125211681 | 3300031234 | Palsa | ALREMLGQGYVRGVCSGLGVLDVWIGFWEAIHYQEDAEARK |
| Ga0302324_1009172101 | 3300031236 | Palsa | PEWSDNPLLLSYPAFRAIMASGFARGLATGLGVLNVWIGFWEAIQYREEE |
| Ga0302320_106041741 | 3300031524 | Bog | PDWSDNPLLLPYPTLRAFVASGFARGISTGLGVLNVWIGFWEAIQYREE |
| Ga0307476_102216311 | 3300031715 | Hardwood Forest Soil | SENPLLLSYPALHDLVASGFTRGLVTGLGLLNVWIGFWEALQYHEE |
| Ga0307475_109169442 | 3300031754 | Hardwood Forest Soil | MILPWRPEWSDNPLLLPYPTLRAVVASGFARGLSTGLGVLNVWIGFWEAIQYREGE |
| Ga0307471_1021189771 | 3300032180 | Hardwood Forest Soil | RPEWADNHLLLPYPTLRAVFASGFVRGVCTGLGVLNVWIGFWEAIQYREDG |
| Ga0335078_107461521 | 3300032805 | Soil | PLLLAYPVLHDLVASGFTRGLVTGLGLLNVWIGFWEALQYRED |
| Ga0316624_107793352 | 3300033486 | Soil | LPWRPEWSDNPLLLPYPTLRAIVASGFARGVATGLGVLNVWIGFWEAIQYREEE |
| Ga0314866_051793_1_111 | 3300033807 | Peatland | TVRELLATGFVRGLVSGLGLLNVWIGFWEAVRYQEE |
| Ga0326723_0308358_523_696 | 3300034090 | Peat Soil | MLIMLPWRPEWTDNHLLLPYPMLRSIVSNGFVRGVCTGLGVLNVWVGFQEAIQYREN |
| ⦗Top⦘ |