| Basic Information | |
|---|---|
| Family ID | F076637 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRRKVANYKRFRELVNEWVDLEVERERAEREKEKQAGGH |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.52 % |
| % of genes near scaffold ends (potentially truncated) | 79.66 % |
| % of genes from short scaffolds (< 2000 bps) | 87.29 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.525 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (27.119 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.102 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (49.153 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF13007 | LZ_Tnp_IS66 | 66.95 |
| PF13817 | DDE_Tnp_IS66_C | 12.71 |
| PF00248 | Aldo_ket_red | 0.85 |
| PF01420 | Methylase_S | 0.85 |
| PF00916 | Sulfate_transp | 0.85 |
| PF13353 | Fer4_12 | 0.85 |
| PF05717 | TnpB_IS66 | 0.85 |
| PF13358 | DDE_3 | 0.85 |
| PF03050 | DDE_Tnp_IS66 | 0.85 |
| PF00459 | Inositol_P | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.69 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.85 |
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.85 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.85 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.53 % |
| Unclassified | root | N/A | 8.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10019599 | All Organisms → cellular organisms → Bacteria | 4214 | Open in IMG/M |
| 3300001372|YBBDRAFT_1048176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 597 | Open in IMG/M |
| 3300001533|MLSed_10140877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300005586|Ga0066691_10922564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 514 | Open in IMG/M |
| 3300009167|Ga0113563_12284654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 650 | Open in IMG/M |
| 3300009518|Ga0116128_1028684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1856 | Open in IMG/M |
| 3300009519|Ga0116108_1016525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2606 | Open in IMG/M |
| 3300009552|Ga0116138_1089639 | Not Available | 856 | Open in IMG/M |
| 3300009629|Ga0116119_1137413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 611 | Open in IMG/M |
| 3300009636|Ga0116112_1049376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1252 | Open in IMG/M |
| 3300009764|Ga0116134_1052749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1550 | Open in IMG/M |
| 3300009824|Ga0116219_10763381 | Not Available | 528 | Open in IMG/M |
| 3300012964|Ga0153916_11216299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
| 3300014151|Ga0181539_1036010 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
| 3300014151|Ga0181539_1061834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1702 | Open in IMG/M |
| 3300014151|Ga0181539_1241648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300014153|Ga0181527_1157546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
| 3300014153|Ga0181527_1268848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 681 | Open in IMG/M |
| 3300014155|Ga0181524_10095475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1677 | Open in IMG/M |
| 3300014156|Ga0181518_10275022 | Not Available | 847 | Open in IMG/M |
| 3300014158|Ga0181521_10127592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1503 | Open in IMG/M |
| 3300014158|Ga0181521_10591259 | Not Available | 521 | Open in IMG/M |
| 3300014160|Ga0181517_10299018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300014200|Ga0181526_10605385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300014200|Ga0181526_11054018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 511 | Open in IMG/M |
| 3300014490|Ga0182010_10907678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 503 | Open in IMG/M |
| 3300014839|Ga0182027_11322030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300017823|Ga0187818_10109433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1197 | Open in IMG/M |
| 3300017925|Ga0187856_1267464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 598 | Open in IMG/M |
| 3300017929|Ga0187849_1264269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 652 | Open in IMG/M |
| 3300017931|Ga0187877_1101902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1198 | Open in IMG/M |
| 3300017931|Ga0187877_1313075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 599 | Open in IMG/M |
| 3300017934|Ga0187803_10315792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 625 | Open in IMG/M |
| 3300017935|Ga0187848_10053452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1934 | Open in IMG/M |
| 3300017938|Ga0187854_10197223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300017940|Ga0187853_10464404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 555 | Open in IMG/M |
| 3300017941|Ga0187850_10196607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300017941|Ga0187850_10268383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300017942|Ga0187808_10165583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300017943|Ga0187819_10169723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1295 | Open in IMG/M |
| 3300017946|Ga0187879_10140296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1371 | Open in IMG/M |
| 3300017946|Ga0187879_10342531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300017946|Ga0187879_10390637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300017955|Ga0187817_10551761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300017975|Ga0187782_10331517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
| 3300017975|Ga0187782_10702350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300018002|Ga0187868_1110639 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300018003|Ga0187876_1119842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
| 3300018008|Ga0187888_1212853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 763 | Open in IMG/M |
| 3300018009|Ga0187884_10390130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 560 | Open in IMG/M |
| 3300018013|Ga0187873_1143303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300018013|Ga0187873_1343872 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 545 | Open in IMG/M |
| 3300018014|Ga0187860_1216562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 776 | Open in IMG/M |
| 3300018014|Ga0187860_1396278 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 518 | Open in IMG/M |
| 3300018015|Ga0187866_1205297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300018016|Ga0187880_1241979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300018016|Ga0187880_1347536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 630 | Open in IMG/M |
| 3300018019|Ga0187874_10259067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300018020|Ga0187861_10059285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1957 | Open in IMG/M |
| 3300018020|Ga0187861_10097926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
| 3300018020|Ga0187861_10153461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
| 3300018020|Ga0187861_10426089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300018024|Ga0187881_10255584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300018043|Ga0187887_10022367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4057 | Open in IMG/M |
| 3300018057|Ga0187858_10599480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 664 | Open in IMG/M |
| 3300018058|Ga0187766_11365742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 519 | Open in IMG/M |
| 3300018062|Ga0187784_10952574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 683 | Open in IMG/M |
| 3300018085|Ga0187772_11066539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 592 | Open in IMG/M |
| 3300018088|Ga0187771_10853836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300018088|Ga0187771_11860632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300018090|Ga0187770_11802954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 501 | Open in IMG/M |
| 3300019788|Ga0182028_1432975 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
| 3300021861|Ga0213853_11002340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300023088|Ga0224555_1225904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 503 | Open in IMG/M |
| 3300025444|Ga0208189_1010231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2306 | Open in IMG/M |
| 3300025464|Ga0208076_1091536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300025506|Ga0208937_1046871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1022 | Open in IMG/M |
| 3300027662|Ga0208565_1086945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300027696|Ga0208696_1265966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 530 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10169662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| (restricted) 3300027995|Ga0233418_10248490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 603 | Open in IMG/M |
| 3300030503|Ga0311370_11639665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 663 | Open in IMG/M |
| 3300030707|Ga0310038_10042761 | All Organisms → cellular organisms → Bacteria | 2608 | Open in IMG/M |
| 3300031708|Ga0310686_107179596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2058 | Open in IMG/M |
| 3300031834|Ga0315290_10227310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1626 | Open in IMG/M |
| 3300031965|Ga0326597_10437210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1443 | Open in IMG/M |
| 3300032046|Ga0315289_11545335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 503 | Open in IMG/M |
| 3300032118|Ga0315277_11306481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300032160|Ga0311301_11616322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300032160|Ga0311301_13002996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 507 | Open in IMG/M |
| 3300032163|Ga0315281_10429024 | Not Available | 1419 | Open in IMG/M |
| 3300032163|Ga0315281_11298275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300032173|Ga0315268_10607302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300032805|Ga0335078_10695658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
| 3300032805|Ga0335078_11755505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 677 | Open in IMG/M |
| 3300032805|Ga0335078_12615468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 517 | Open in IMG/M |
| 3300032828|Ga0335080_10580637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1181 | Open in IMG/M |
| 3300032892|Ga0335081_11646752 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. | 702 | Open in IMG/M |
| 3300033158|Ga0335077_10609980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300033402|Ga0326728_10107264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3315 | Open in IMG/M |
| 3300033402|Ga0326728_10228249 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300033402|Ga0326728_10239251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1750 | Open in IMG/M |
| 3300033405|Ga0326727_10083959 | All Organisms → cellular organisms → Bacteria | 4397 | Open in IMG/M |
| 3300033405|Ga0326727_10993871 | Not Available | 613 | Open in IMG/M |
| 3300033405|Ga0326727_11158410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 543 | Open in IMG/M |
| 3300033414|Ga0316619_10308344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300033482|Ga0316627_101970258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300033513|Ga0316628_103295909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 586 | Open in IMG/M |
| 3300033755|Ga0371489_0000151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 135167 | Open in IMG/M |
| 3300033755|Ga0371489_0010884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 8329 | Open in IMG/M |
| 3300033755|Ga0371489_0243177 | Not Available | 901 | Open in IMG/M |
| 3300033891|Ga0334811_174020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 526 | Open in IMG/M |
| 3300033977|Ga0314861_0512917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 513 | Open in IMG/M |
| 3300034078|Ga0373900_021676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300034088|Ga0373912_0219857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 527 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 27.12% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 10.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.63% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 7.63% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.78% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.78% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.08% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.69% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.69% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 0.85% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.85% |
| Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Sediment | 0.85% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034078 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.1 | Engineered | Open in IMG/M |
| 3300034088 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.1 | Engineered | Open in IMG/M |
| 3300034782 | Sediment microbial communities from coastal wetland in Texas, United States - D0606M02 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100195991 | 3300000567 | Peatlands Soil | GEPMRRKVANYRRLRELVNEWVALEIERERAERAREKHAGGN* |
| YBBDRAFT_10481762 | 3300001372 | Marine Estuarine | KVRNYKRFRELVNEWVGLAVELERAERAATKQNHGD* |
| MLSed_101408771 | 3300001533 | Benthic | AMREKLATYKRLRELVNEWVDLALEHEALARAAGKGKR* |
| Ga0066691_109225641 | 3300005586 | Soil | QVEPMRQKVANYKRLRELVHEWVNLEIERERAERAKEKHLGGN* |
| Ga0113563_122846541 | 3300009167 | Freshwater Wetlands | VRPDQVAGVREKVANYKRFRELINEWVDLAVELERAERAQARKSHAD* |
| Ga0116128_10286842 | 3300009518 | Peatland | MRQKVANYKRLRELMNEWVSLGVELERAERAEEKHARGH* |
| Ga0116108_10165251 | 3300009519 | Peatland | VEPMRRKVANYKRLRELVNAWVALEIERERAKREKEKRAGGD* |
| Ga0116138_10896391 | 3300009552 | Peatland | SSRFVRPAQVAEMRRKVENYKRFRELVNEWVDLAVERERAERAAREPHAGD* |
| Ga0116119_11374132 | 3300009629 | Peatland | EGMQRKVANYKRFRELVNEWVDLEVEREQAERGQEKHAGGN* |
| Ga0116112_10493762 | 3300009636 | Peatland | VANYKRFRELVNEWVDLEVEREQVERAQEKNVGGN* |
| Ga0116134_10527492 | 3300009764 | Peatland | ANYKRLRELMNEWVSLGVELERAEREKERHAGGH* |
| Ga0116219_107633811 | 3300009824 | Peatlands Soil | RKVANYKRFRELVNEWVDLEVERERAERAQEKRAGGN* |
| Ga0153916_112162991 | 3300012964 | Freshwater Wetlands | IRRKVENYKRFRELVNEWVDLAVEQERAPSKQRHGD* |
| Ga0181539_10360104 | 3300014151 | Bog | QVAEMRRKVARYKRFRKLVNQWVDLEVERERAERAQEKRAGGN* |
| Ga0181539_10618341 | 3300014151 | Bog | QKVANYKRLRELMNEWVSLAVERERAERAEEKHHRGD* |
| Ga0181539_12416481 | 3300014151 | Bog | RKVANYKRFRELVNDWVDLEVERERAEREKERQAGGH* |
| Ga0181527_11575461 | 3300014153 | Bog | QKVANYKRLRELMKEWVSLGVELERAEREKEKHASGH* |
| Ga0181527_12688482 | 3300014153 | Bog | RFVRPEQVAEMRRKVARYKRFRKLVNQWVDLEVERERAEREKERRGGGD* |
| Ga0181524_100954752 | 3300014155 | Bog | PEHVTEMRQKVAHYKRFRELVNEWVDLEVERERAEREKERHARGD* |
| Ga0181518_102750221 | 3300014156 | Bog | MRRRVARYKRFRELVNRWVDLEVEREGVEREREKRAAGH* |
| Ga0181521_101275921 | 3300014158 | Bog | ANYKRFWELVNEWVDLEVEREQAERAEEKHAGGN* |
| Ga0181521_105912592 | 3300014158 | Bog | ANYKRFRELVNEWVDLEVERERAERQKEKHTGGH* |
| Ga0181517_102990182 | 3300014160 | Bog | MQRKVANYKRFRELVNDWVDLEVERERAEREKERQAGGH* |
| Ga0181526_106053852 | 3300014200 | Bog | QKVANYKRFRELVNEWVDLEVEREQAERAQEKHAGGN* |
| Ga0181526_110540181 | 3300014200 | Bog | GTQQKVANYKRFRELVNEWVGLEVERERAERAQEKHAGGN* |
| Ga0182010_109076782 | 3300014490 | Fen | VTEMRHKVENYKRFRELVNQWVDLTVELERAERATSKQHHGD* |
| Ga0182027_113220301 | 3300014839 | Fen | EQVEGMQRKVANYKRFRELVNEWVDLEVEREQVERGQEKHAGGN* |
| Ga0187818_101094331 | 3300017823 | Freshwater Sediment | QVEPMRRKVASYKRLRELVNEWVALEIERERAEREKEKRAGGN |
| Ga0187856_12674641 | 3300017925 | Peatland | QVEPMRQKVANYKRLRELMNEWVSLGVELERAEREKEKHTGGH |
| Ga0187849_12642691 | 3300017929 | Peatland | MQWKVANYKRFRELVNEWVDLEVEREQAERGQEKHAGGN |
| Ga0187877_11019021 | 3300017931 | Peatland | MRRKVARYKRFRELVNQWVDLEVERERAEREKERRAGGD |
| Ga0187877_13130751 | 3300017931 | Peatland | GMQRKVANYKRFRELVNEWVVLEVEREQAERGQEKHAGGN |
| Ga0187803_103157921 | 3300017934 | Freshwater Sediment | VEPMRQKVANYKRLRELMNEGVSLGVELERAERGLAKERDGD |
| Ga0187848_100534521 | 3300017935 | Peatland | PEQVEPMRQKVANYKRLRELMNEWVSLGVELERAEREKEKHTGGH |
| Ga0187854_101972232 | 3300017938 | Peatland | MRQKVATYKRLRELVNQWVELAVELERAERAEAKHSDGH |
| Ga0187853_104644041 | 3300017940 | Peatland | RVAEMRRKVANYKRFRELVNQWVDLAVEQERAERVQEKYSDGD |
| Ga0187850_101966072 | 3300017941 | Peatland | FLRPEQVEPMRRKVANYRRLREVVNEWVALEIERERAEREKEKRGGGD |
| Ga0187850_102683832 | 3300017941 | Peatland | KVANYKRLRELVNEWVELAIELEKAERAAAKQGHGD |
| Ga0187808_101655831 | 3300017942 | Freshwater Sediment | GKSTTRFVRPEHVSEMRQKVARYKRFRELVNEWVDLEVERERAEREKERHAGGH |
| Ga0187808_102965151 | 3300017942 | Freshwater Sediment | SYTWRGKSTTRFVRPEQVDPMQRKVANYKRFRELVNDWVDLEVERERVEWERERQAGGH |
| Ga0187819_101697232 | 3300017943 | Freshwater Sediment | TEMRQKVARYKRFRELVNEWVDLEVERERAEREKERHARGD |
| Ga0187879_101402962 | 3300017946 | Peatland | RQKVANYKRLRELMNEWVSLGVELERAEREKERHAGGH |
| Ga0187879_103425311 | 3300017946 | Peatland | VEGMQRKVANYKRFRGLVNEWVDLEVEREQVERAQEKNVGGN |
| Ga0187879_103906372 | 3300017946 | Peatland | QRKVANYKRFRELVNEWVDLEVEREQAERAEEKHAGGN |
| Ga0187817_105517612 | 3300017955 | Freshwater Sediment | RRKVASYKRLRELVNEWVALEIERERAEREKEKRAGGN |
| Ga0187782_103315171 | 3300017975 | Tropical Peatland | EMRQKVARYKRFRELVNEWVDLEVERERAEREKERHAGGH |
| Ga0187782_107023501 | 3300017975 | Tropical Peatland | MRQKVARYKRFRELVNEWVDLEVERERAEREKERHAGGH |
| Ga0187870_10275581 | 3300017998 | Peatland | STTRFVRPEHVAEMRRKVANYKRFRELVNAWVDLEVARERAERAKEKHPSGY |
| Ga0187868_11106393 | 3300018002 | Peatland | EMRRKVANYKRFRELVNQWVDLAVEQERAERVQEKYSDGD |
| Ga0187876_11198422 | 3300018003 | Peatland | LRPEQVEPMRRKVANYKRLRELVNEWVALEIERERAERAKEKRAGGD |
| Ga0187888_12128531 | 3300018008 | Peatland | PQRVAEMRRKVANYKRFRELVNQWVDLAVEQERAERVQEKYSDGD |
| Ga0187884_103901301 | 3300018009 | Peatland | RGKVENYKRFRGLVNEWVDLAVELEQAERATSKQLHGD |
| Ga0187873_11433031 | 3300018013 | Peatland | LRPEQVEPMRRKVANYRRLRELVNEWVALEIERERAERAREKHAGGN |
| Ga0187873_13438722 | 3300018013 | Peatland | AEMRRKVANYKRFRELVNQWVDMAVEQERAERVQEKYRDGD |
| Ga0187860_12165621 | 3300018014 | Peatland | KSSSRFVRPQRVAEMRRKVANYKRFRELVNQWVDLAVEQERAERVQEKYSDGD |
| Ga0187860_13962781 | 3300018014 | Peatland | QRLAEMRRKVANYKRFRELVNQWVDMAVEQERAERVQEKYRDGD |
| Ga0187866_12052971 | 3300018015 | Peatland | TWRGKSMTRFVRREHVAEMQQKVANYQRFRELVNAWVDLEVERERAERAQEKRTGGN |
| Ga0187880_12419792 | 3300018016 | Peatland | QKVTNYKRFRELVNEWVDLEVERERAEREKERHAGGH |
| Ga0187880_13475362 | 3300018016 | Peatland | VRPQRLAEMRRKVANYKRFRELVNQWVDLAVEQERAERVQEKYSDGD |
| Ga0187874_102590672 | 3300018019 | Peatland | VEGMQRKVANYKRFRELVNEWVDLEVEREQAERGQEKHAGGN |
| Ga0187861_100592852 | 3300018020 | Peatland | LRAEQVAEMREKVANYKRVRGLVNEWVELAVELERAERELAK |
| Ga0187861_100979262 | 3300018020 | Peatland | VRPEQVDGMRRKVANYKRFRGLVNEWVDLEVEREQVERAQEKNVGGN |
| Ga0187861_101534611 | 3300018020 | Peatland | MRRKVASYKRLRELVNEWVALEIERERAEREKEKRAGGN |
| Ga0187861_104260892 | 3300018020 | Peatland | MRRKVANYKRFRELVNEWVDLEVERERAEREKEKQAGGH |
| Ga0187881_102555841 | 3300018024 | Peatland | EQVEPMRQKVANYKRLRELMNEWVSLGVELERAERAEEKHARGH |
| Ga0187887_100223675 | 3300018043 | Peatland | QQKVANYKRFRELVNEWVDLEVERERAERAQEKHAGGN |
| Ga0187858_105994802 | 3300018057 | Peatland | QRVAEMRRKVANYKRFRELVNQWVDLAVEQERAERVQEKYSDGD |
| Ga0187766_113657421 | 3300018058 | Tropical Peatland | EPMRRKVASYKRLRELVNEWVALEIERERAEREKEKRACGD |
| Ga0187784_109525742 | 3300018062 | Tropical Peatland | VRPEHVTEMRQKVARYKRFRELVNEWVDLEVERERAEREKERHAGGH |
| Ga0187772_110665392 | 3300018085 | Tropical Peatland | VRPEQVDPMQRKVANYKRFREAVNDWVDLEVERERAEREKEKQAGGH |
| Ga0187771_108538362 | 3300018088 | Tropical Peatland | VRPEHVDPMRRKVANYKRFRELVNDWVDLEVERERAEREKERQAGGH |
| Ga0187771_118606322 | 3300018088 | Tropical Peatland | MREKVSNYKRFRELVNECVDLSLELEQVERAQAKKDDDGN |
| Ga0187770_118029541 | 3300018090 | Tropical Peatland | MRQKVANYKRLRELMNEWVSLGVELERAEREKERHASGH |
| Ga0182028_14329756 | 3300019788 | Fen | MRQKVANYKRLRELVNEWVELAIELEKAERAAAKQGHGD |
| Ga0213853_110023401 | 3300021861 | Watersheds | QKVANYKRFRELVNEWVDLEVEREKAERAEEKHAGGN |
| Ga0224555_12259041 | 3300023088 | Soil | VAEMQQKVANYKRFRELVNEWVDLEVEREQAERAQEKHAGGN |
| Ga0208189_10102311 | 3300025444 | Peatland | RPERVEGMQRKVANYKRFRGLVNEWVDLEVEREQVERAQEKNVGGN |
| Ga0208076_10915362 | 3300025464 | Arctic Peat Soil | LRAEQVETMREKVANYKRLRELVQEWVELAVALERAEREQAK |
| Ga0208937_10468712 | 3300025506 | Peatland | RRKVAHYKRFRELVNEWVDLEVGRERAERAQEKHAGGH |
| Ga0208565_10869452 | 3300027662 | Peatlands Soil | HVTEMRQKVARYKRFRELVNEWVDLEVERERAEREKERHAGGH |
| Ga0208696_12659662 | 3300027696 | Peatlands Soil | VANYKRLRELMNEWVSLGVELERAERAQEKHAGGH |
| (restricted) Ga0233418_101696621 | 3300027995 | Sediment | MRQKVANYKRLRELVNEWVALEIERERAEREKEKRAGGD |
| (restricted) Ga0233418_102484901 | 3300027995 | Sediment | RFVRPDQVAGMQEKVATYKRFRKLVNEWVDLAVALEREERARARQSHGD |
| Ga0311370_116396652 | 3300030503 | Palsa | QQKVANYKRFRELVNEWVDLEVEREKAERAQEKHAGGN |
| Ga0310038_100427611 | 3300030707 | Peatlands Soil | MQQKVANYKSFRELVNAWVDLEVEREQAERAQEKHAGGN |
| Ga0310686_1071795964 | 3300031708 | Soil | MRQKVANYKRLRELMNEWVRLVVELERAAREKEKHTGGH |
| Ga0315290_102273103 | 3300031834 | Sediment | VETYKRFRELVNEWVDLAVELARAERATSKQHHGD |
| Ga0326597_104372101 | 3300031965 | Soil | VENYKRFRELVNEWVDLAVELGQAERATSKQRHGD |
| Ga0315289_115453352 | 3300032046 | Sediment | VEKYKRFRELVNEWVDLAVELERAERATSKQHHGD |
| Ga0315277_113064812 | 3300032118 | Sediment | MHQKVANYKRFRELVNQWVDLAVELERAERAQAKHSHGD |
| Ga0311301_116163221 | 3300032160 | Peatlands Soil | PEQVDPMQRKVANYKRFRELVNDWVDLEVERERAEREKERQAGGH |
| Ga0311301_130029962 | 3300032160 | Peatlands Soil | FVRPERVDGMQRKVANYKRFRELVNEWVDLEVEREKAERAQEKHAGGN |
| Ga0315281_104290243 | 3300032163 | Sediment | MRQKVPNYKRLRELVNKWVGLAAELERAERAEAKHGDGY |
| Ga0315281_112982752 | 3300032163 | Sediment | SRFVRPERVTEIRHRVENYKRFRELVNEWVDLSVELGRVERVRVKQSDGD |
| Ga0315268_106073022 | 3300032173 | Sediment | ERVAAMREKVANYRQFRELINEWVELAVELERAERAEAKHSDGD |
| Ga0335078_106956582 | 3300032805 | Soil | DRMQRKVANYKRFRELVNEWVDLEVERERAEREKEKHAGGH |
| Ga0335078_117555052 | 3300032805 | Soil | VRPEHVDRMQRKVANYKRFRELVNDWVDLEVERERAEREKERQAGGH |
| Ga0335078_126154681 | 3300032805 | Soil | RVKIGNYKRLRELTSEWVELAVELERAEREQARHHGD |
| Ga0335080_105806372 | 3300032828 | Soil | VRPERGDSMQRKVANYKRFRELVNDWVDLEVERERAEREKERQAGGH |
| Ga0335081_116467521 | 3300032892 | Soil | EMRVKVGNYKRFRELTSEWVELAVELERAGREQAKHADGH |
| Ga0335077_106099802 | 3300033158 | Soil | STTRFVRPEHVDRMQRKVANYKRFRELVNDWVDLEVERERAEREKERQAGGH |
| Ga0326728_101072644 | 3300033402 | Peat Soil | AEMQQKVANYKRFRELVNEWVDLEVEREQAERAQEKHAGGN |
| Ga0326728_102282494 | 3300033402 | Peat Soil | VRPEQVAEMRRMVDNYKRFRELVNEWVDLAVERERAERAAGKPHARD |
| Ga0326728_102392511 | 3300033402 | Peat Soil | QVEEMRQKVANYKRLRELMNEWVGLAVERERAERAEEKHRRGD |
| Ga0326727_100839593 | 3300033405 | Peat Soil | MQRKMANYKRFRELVNQWVDLEVGREQAERAQEKNAGGN |
| Ga0326727_109938711 | 3300033405 | Peat Soil | FVRPEQVDGMRRKVANYRRFRELVNEWVDLEVERERAERAQEKHAGGH |
| Ga0326727_111584101 | 3300033405 | Peat Soil | VANYKRLRELMNEWVSLGVELERAEREKEKHPGGH |
| Ga0316619_103083442 | 3300033414 | Soil | KVANYKRFRELVNEWVDLALELERAERVPARTSDGD |
| Ga0316627_1019702582 | 3300033482 | Soil | VRPDQVAGVREKVANYKRFRELINEWVDLAVELERAERAQDRKSHAD |
| Ga0316628_1032959091 | 3300033513 | Soil | EKVSNYKRFRELVNECVDLSLELEKIERAQAKKYSDGN |
| Ga0371489_0000151_61217_61336 | 3300033755 | Peat Soil | MRQKVANYKRLRELMNEWVSLGVELEKAERAQEKHAGGN |
| Ga0371489_0010884_72_191 | 3300033755 | Peat Soil | MRQKVARYKRFRELVNEWVDLEVERERAERDKERHAGGH |
| Ga0371489_0243177_55_174 | 3300033755 | Peat Soil | MRRKVANYKRLRELMNEWVSLGVELERAERAQEKHAGGN |
| Ga0334811_174020_33_176 | 3300033891 | Soil | VRPEQVEGMQRKVANYKRFRELVNEWVDLEVEREQVERGQEKHAGGN |
| Ga0314861_0512917_400_513 | 3300033977 | Peatland | QKVANYKRLRELMNEWVSLGVELERAEREKERHASGH |
| Ga0373900_021676_49_168 | 3300034078 | Sediment Slurry | MREKVANYRQFRELINEWVELAVEMERVERAEAKHSDGD |
| Ga0373912_0219857_75_218 | 3300034088 | Sediment Slurry | VRPERVAAMRRKVANYKLFRELVNQWVDLALELERAERVPARPSDGD |
| Ga0373573_0239218_416_547 | 3300034782 | Sediment | VRQEAVAEMREKVSNYKRFRELVNEWVDLVVELEKAKRAQAKK |
| ⦗Top⦘ |