NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076627

Metagenome / Metatranscriptome Family F076627

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076627
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 46 residues
Representative Sequence GSVSGDLSSEVPLGSDPGSAEGYGPTLVVRGKTVSGDFRVFRAS
Number of Associated Samples 105
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.85 %
% of genes near scaffold ends (potentially truncated) 99.15 %
% of genes from short scaffolds (< 2000 bps) 94.92 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.525 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(9.322 % of family members)
Environment Ontology (ENVO) Unclassified
(26.271 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.915 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 18.06%    Coil/Unstructured: 81.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF07690MFS_1 61.86
PF05977MFS_3 11.86
PF02637GatB_Yqey 5.93
PF02934GatB_N 2.54
PF01636APH 1.69
PF00072Response_reg 0.85
PF01425Amidase 0.85
PF02882THF_DHG_CYH_C 0.85
PF00903Glyoxalase 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 11.86
COG0064Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunitTranslation, ribosomal structure and biogenesis [J] 8.47
COG2511Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domainTranslation, ribosomal structure and biogenesis [J] 8.47
COG1610Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activityGeneral function prediction only [R] 5.93
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.85
COG01905,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolaseCoenzyme transport and metabolism [H] 0.85
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.53 %
UnclassifiedrootN/A8.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090008|P3_DRAFT_NODE_107970_len_1027_cov_9_116845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1077Open in IMG/M
2124908043|A2_c1_ConsensusfromContig13432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig1194442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
2140918007|ConsensusfromContig15602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria985Open in IMG/M
2166559005|cont_contig109612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
2170459006|GBPF9FW01D4NOUAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300001418|JGI20188J14859_1006111All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300001686|C688J18823_10647985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia673Open in IMG/M
3300005176|Ga0066679_10759775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia623Open in IMG/M
3300005178|Ga0066688_10954418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300005434|Ga0070709_11634274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300005435|Ga0070714_102281095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300005439|Ga0070711_101726235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300005467|Ga0070706_101598049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300005467|Ga0070706_102007644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia524Open in IMG/M
3300005529|Ga0070741_10337724Not Available1401Open in IMG/M
3300005539|Ga0068853_102500973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300005542|Ga0070732_10825824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300005553|Ga0066695_10887442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300005559|Ga0066700_10158283All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300005560|Ga0066670_10812521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300005560|Ga0066670_11012086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300005563|Ga0068855_101886344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300005577|Ga0068857_100805743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300005578|Ga0068854_102291409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300005587|Ga0066654_10458357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium697Open in IMG/M
3300005616|Ga0068852_100427403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1308Open in IMG/M
3300005764|Ga0066903_101760375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1182Open in IMG/M
3300005764|Ga0066903_104685950Not Available728Open in IMG/M
3300005893|Ga0075278_1085857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300005896|Ga0075282_1065548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300006046|Ga0066652_101601496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300006606|Ga0074062_11641907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium689Open in IMG/M
3300006854|Ga0075425_102514543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300006954|Ga0079219_10821322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300007821|Ga0104323_119634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1520Open in IMG/M
3300007821|Ga0104323_120892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1591Open in IMG/M
3300009012|Ga0066710_100826011Not Available1422Open in IMG/M
3300009012|Ga0066710_101047537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1260Open in IMG/M
3300009137|Ga0066709_100770573Not Available1391Open in IMG/M
3300009551|Ga0105238_11977184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300010366|Ga0126379_11194625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium867Open in IMG/M
3300010373|Ga0134128_11012371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium918Open in IMG/M
3300010379|Ga0136449_103611293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300010397|Ga0134124_13012080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300011269|Ga0137392_10711996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium831Open in IMG/M
3300011271|Ga0137393_11201359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300012005|Ga0120161_1098062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria704Open in IMG/M
3300012200|Ga0137382_10287944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1144Open in IMG/M
3300012201|Ga0137365_10765455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300012208|Ga0137376_11226058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300012355|Ga0137369_10386335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1013Open in IMG/M
3300012362|Ga0137361_10667658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium951Open in IMG/M
3300012922|Ga0137394_10691467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium859Open in IMG/M
3300012924|Ga0137413_11452821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300012977|Ga0134087_10455369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300012977|Ga0134087_10707139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300012989|Ga0164305_11777454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300013100|Ga0157373_10728568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria728Open in IMG/M
3300013105|Ga0157369_11582659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia666Open in IMG/M
3300013105|Ga0157369_11628059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300013294|Ga0120150_1112967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300013307|Ga0157372_10249155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2062Open in IMG/M
3300013763|Ga0120179_1031303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1265Open in IMG/M
3300013772|Ga0120158_10111684All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300015164|Ga0167652_1010662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2005Open in IMG/M
3300017821|Ga0187812_1130014Not Available815Open in IMG/M
3300017927|Ga0187824_10187792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300017943|Ga0187819_10365287Not Available833Open in IMG/M
3300017947|Ga0187785_10076356Not Available1302Open in IMG/M
3300017959|Ga0187779_10615756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300017959|Ga0187779_11023004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300017973|Ga0187780_10499327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium869Open in IMG/M
3300018030|Ga0187869_10172229All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300018071|Ga0184618_10235939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium772Open in IMG/M
3300018433|Ga0066667_11635799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300020081|Ga0206354_10729508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300024288|Ga0179589_10505246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300025501|Ga0208563_1028727All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300025878|Ga0209584_10152415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium871Open in IMG/M
3300025906|Ga0207699_10490726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium886Open in IMG/M
3300025906|Ga0207699_10745459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300025910|Ga0207684_11418383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300025917|Ga0207660_11105697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300025917|Ga0207660_11151032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300025921|Ga0207652_10195930All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300025922|Ga0207646_11551201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300025949|Ga0207667_12103383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300026078|Ga0207702_11854995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300026142|Ga0207698_10148392All Organisms → cellular organisms → Bacteria2031Open in IMG/M
3300026550|Ga0209474_10202173Not Available1265Open in IMG/M
3300027633|Ga0208988_1158126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300027842|Ga0209580_10546453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300027862|Ga0209701_10304488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium914Open in IMG/M
3300027869|Ga0209579_10676689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300028577|Ga0265318_10241856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300028654|Ga0265322_10013988All Organisms → cellular organisms → Bacteria2322Open in IMG/M
3300028768|Ga0307280_10124596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300028800|Ga0265338_10139906All Organisms → cellular organisms → Bacteria1897Open in IMG/M
3300028807|Ga0307305_10480314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300028828|Ga0307312_11185271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300031239|Ga0265328_10342414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300031240|Ga0265320_10251004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium785Open in IMG/M
3300031242|Ga0265329_10003868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia6418Open in IMG/M
3300031247|Ga0265340_10034004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2536Open in IMG/M
3300031249|Ga0265339_10374096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300031250|Ga0265331_10134109All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300031344|Ga0265316_10782902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300031719|Ga0306917_11132730Not Available609Open in IMG/M
3300031753|Ga0307477_10351974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1013Open in IMG/M
3300031753|Ga0307477_10678927Not Available690Open in IMG/M
3300031938|Ga0308175_100648418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1141Open in IMG/M
3300031939|Ga0308174_10427542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1071Open in IMG/M
3300032261|Ga0306920_104269662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300032261|Ga0306920_104329929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300032828|Ga0335080_10259798All Organisms → cellular organisms → Bacteria1895Open in IMG/M
3300032954|Ga0335083_10320507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1353Open in IMG/M
3300032954|Ga0335083_10807327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.47%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere8.47%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.08%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.39%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.39%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.39%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.39%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.54%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.54%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.69%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.69%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.69%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.85%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.85%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
3300001418Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007821Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012005Permafrost microbial communities from Nunavut, Canada - A15_80cm_0MEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013294Permafrost microbial communities from Nunavut, Canada - A3_65cm_0MEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300015164Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028654Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaGHost-AssociatedOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_DRAFT_007822602088090008SoilTNLDVDAGSVSGDLSSEVPLGSDRADEAGPTLIVRGKTVSGDFRVFRAA
A2_c1_004920102124908043SoilVDAGSVSGDLASEVPLGSDPDAAGGDGPALVVRGKTVSGDFRVFRGL
KansclcFeb2_060695402124908045SoilEVGVAAGSNLDVDAGSVSGDLSSEVPLGSDPGAGVAEGPTLVVRGKTVSGDFRVYRA
A_all_C_019821702140918007SoilAAGTNLDVDAGSVSGDLASEVPLGSDPDAAGGDGPALVVRGKTVSGDFRVFRGL
cont_0611.000065502166559005SimulatedRRFRPGDLTSEVPLGSDPGSGGCSWPVLVVRGKTVSGDFRVFRAV
L01_067849202170459006Grass SoilSEVPLADTPDRSDDGGPTVVVRGKTVSGDFRVFRAA
JGI20188J14859_100611113300001418Arctic Peat SoilGSVSGDLSSEVALGSDIGNIGGGGPTLVVRGKTVSGDFKVFRAA*
C688J18823_1064798523300001686SoilDIEVGVAAGTNLDVDAGSVSGDLASEVPLGDTPGGNGGEGPVLVLRGKTVSGDFRVFRGQ
Ga0066679_1075977513300005176SoilVAAGTNLDVDAGSVSGDLASEVPLGSDPSAIGGDGPALVVRGKTVSGDFRVFRGL*
Ga0066688_1095441823300005178SoilDVDAGSVSGDLTSEVALGSDIGNIGPEGPMLVVRGKTVSGDFKVFRAA*
Ga0070709_1163427423300005434Corn, Switchgrass And Miscanthus RhizosphereGDIEVGVETGTNLDVDAGSVSGDLSSEVPLGSDSASAVGEGPTLVVRGKSVSGDFRVFRAG*
Ga0070714_10228109513300005435Agricultural SoilGVAAGTNVDVDANSVSGDLDSEVPLGSDSGGLAPGPTLVVRGKTVSGDFRLVRAS*
Ga0070711_10172623513300005439Corn, Switchgrass And Miscanthus RhizosphereLDVDANSVSGDLDSEVALGGELEGLEEGGPTLVVRGKTVSGDFRIVRA*
Ga0070706_10159804913300005467Corn, Switchgrass And Miscanthus RhizosphereVAPGSNLDVDAGSVSGDLASEVPLGSEPATGGDGPTVVVRGRTVSGDFKVFRAA*
Ga0070706_10200764423300005467Corn, Switchgrass And Miscanthus RhizosphereTNLDVDAGSVSGELSSEVPLGSEPGEAGGDGPFLVVRGKTVSGDFRVFRAG*
Ga0070741_1033772413300005529Surface SoilAPGTNLDVDAGSVSGDLSSEVPLGSDPSYNGGEGPTLVVRGKTVSGDFRVFRAA*
Ga0068853_10250097313300005539Corn RhizosphereVSGDLDSAVALGSEAGFEEGGPTLVVRGKTVSGDFRIVRA*
Ga0070732_1082582413300005542Surface SoilSEVPLGSEPGAANGDGPVLVVRGKTVSGDFRVFRGQ*
Ga0066695_1088744223300005553SoilLDVDAGSVSGDLSSEVPLGSEPGETEDAGPTLVLRGKTVSGDFRVFRA*
Ga0066700_1015828333300005559SoilGTNLDVDAGSVSGDLTSEVPLASDPGFVGDGPTLVARGKTVSGDFRVFRAV*
Ga0066670_1081252113300005560SoilAAGTNLDVDANSVSGDLNSEIPLGDDVGGLEPGPTLRVRGKTVSGDFRLVRAS*
Ga0066670_1101208613300005560SoilTNLDVDAGSVSGDLDSEVALGSDIGNIGPDGPMLVVRGKTVSGDFKVFRAA*
Ga0068855_10188634423300005563Corn RhizosphereDVDANSVSGDLDSAVALGSEAGFEEGGPTLVVRGKTVSGDFRIVRA*
Ga0068857_10080574323300005577Corn RhizosphereHLGVAEGTNVDVDANSVSGDLSSDVPLGADPTGVHTDGPTLVVRGKTVSGDFKLVRA*
Ga0068854_10229140923300005578Corn RhizosphereNLDVDAGSVSGDLSSDVPLGSDAGNVGDGPTLVVRGKTVSGDFKVFRAA*
Ga0066654_1045835713300005587SoilTNLDVDAGSVSGDLDSEVALGSDAGNLGDGPVLVVRGKTVSGDFKVFRAA*
Ga0068852_10042740313300005616Corn RhizosphereNSVSGDLDSEVPLGSDIGLAPGPTLVVRGKTVSGDFRLVRAGS*
Ga0066903_10176037523300005764Tropical Forest SoilAGTNLDVDAGSVSGDLASEVPLGAEPGEAGDGPTLVVRGKTVSGDFKVFRAA*
Ga0066903_10468595013300005764Tropical Forest SoilVDVDAGSASGTLSSEVPLSDSPSGDPGPTLVVRSKTVSGDFRVVRAA*
Ga0075278_108585723300005893Rice Paddy SoilSGDLTSEVPLGSEPGSATGEGPTLVVRGKTVSGDFRVFRAS*
Ga0075282_106554813300005896Rice Paddy SoilTSEVPLGSDSSAGGDDLAPLVVRGKTVSGDFRVYRAA*
Ga0066652_10160149623300006046SoilEVPLGSEPGSADGDGPTLVVRGKTVSGDFRVFRAS*
Ga0074062_1164190723300006606SoilEVPLGSDPGALAVEGGPTLVVRGKTVSGDFRVFRAA*
Ga0075425_10251454313300006854Populus RhizosphereVSGDLSSEVPLGSDPGAGMAEGPTLVVRGKTVSGDFRVYRA*
Ga0079219_1082132223300006954Agricultural SoilAPGTNLDVDAGSVSGDLSSDVPLGSDPGAGVAEGPALVVRGKTVSGDFRVFRA*
Ga0104323_11963433300007821SoilELGVAAGTNLDVDAGSVSGDLASEVPLGSDPDAAGGDGPALVVRGKTVSGDFRVFRGL*
Ga0104323_12089233300007821SoilELGVAAGTNLDVDAGSVSGDLASEVPLGSDPGALGSDGPALIVRGKTVSGDFRVFRGV*
Ga0066710_10082601123300009012Grasslands SoilEAGTSLDVDAGSVSGDLSSEVPLGSEPGSADGDGSTLVVRGKTVSGDFRVFRAS
Ga0066710_10104753723300009012Grasslands SoilAGTNLDVDAGSVSGDLDSEVPLDNDPGAAGDGPLLVVRGKTVSGDFRVFRGQ
Ga0066709_10077057313300009137Grasslands SoilGTNLDVDAGSVSGDLSSEVPLGSDAASAAGHGPTLVVRGKSVSGDFRVFRAG*
Ga0105238_1197718423300009551Corn RhizosphereGDLESEVALGSDPSGTGDGPTLVVRGKTVSGDFRLVRAS*
Ga0126379_1119462513300010366Tropical Forest SoilEVPLGSEASSISDDGPTLVVRGKTVSGDFRVRRAL*
Ga0134128_1101237123300010373Terrestrial SoilSGELSSEVPLGSEPCEAGGDGPVLVVRGKTVSGDFRVFRAG*
Ga0136449_10361129313300010379Peatlands SoilGSNVDVDANTVSGELSSDVPLVSVPGEGGGGPTVVVRGKTVSGDFKVLRAATPEASPAKAG*
Ga0134124_1301208013300010397Terrestrial SoilLDVDAGSVSGDLASDVALGSDAAAVGEGPTVVVRGKTVSGDFKLFRAA*
Ga0137392_1071199623300011269Vadose Zone SoilDAGSVSGDLTSEVPLASDPGFVGDGPTLVVRGKTVSGDFRVFRAV*
Ga0137393_1120135913300011271Vadose Zone SoilNLDVDAGSVSGELASEVPLGSDPDAAGEGPMLVVRGKTVSGDFRVFRGP*
Ga0120161_109806223300012005PermafrostIELGVPTGTNLDVDAGSVSGDLASEVPLGSDPDAAAGDGPALVVRGKTVSGDFRVFRGI*
Ga0137382_1028794423300012200Vadose Zone SoilVSGDLSSEVPLGSDAGSAGGDGPMLVVRGKSVSGDFRVFRAS*
Ga0137365_1076545513300012201Vadose Zone SoilVSGDLSSEVPLGSEPGSADGDGPTLVVRGKTVSGDFRVFRAS*
Ga0137376_1122605813300012208Vadose Zone SoilSLDVDAGSVSGDLSSEVPLGSEPGSADGDGPTLVVRGKTVSGDFRVFRAS*
Ga0137369_1038633523300012355Vadose Zone SoilGVEAGTNLDVDAGSVSGDLASEVPLGSEPGGAADGPTLVVRGKTVSGNFRVIRAS*
Ga0137361_1066765813300012362Vadose Zone SoilTNLDVDAGSVSGELASEVPLGSDPDAAGEGPMLVVRGKTVSGDFRVFRGP*
Ga0137394_1069146713300012922Vadose Zone SoilDLTSEVPLGSEPGGEPGGPMLVVRGKTVSGDFKVFRAA*
Ga0137413_1145282123300012924Vadose Zone SoilDLASEAPFGSDPDVIGGGGPALVVRGKTVSGDFRVFRGL*
Ga0134087_1045536923300012977Grasslands SoilTNVDVDANSVSGDLGSDVPLGSDPDGVHGEGPTLVVRGKTVSGDFRLIRAS*
Ga0134087_1070713923300012977Grasslands SoilVDAGSVSGDLSSEVPLGSDAASAAGHGPTLVVRGKSVSGDFRVFRAG*
Ga0164305_1177745413300012989SoilTNLDVDAGSVSGDLSSEVPLGSDPGSAEGYGPTLVVRGKTVSGDFRVFRAS*
Ga0157373_1072856813300013100Corn RhizospherePGTSLDVDAGSVSGDLSSEVPLGSDPGAAIAAGGPTLVVRGKTVSGDFRVFRAA*
Ga0157369_1158265923300013105Corn RhizosphereVDVDANSVSGDLSSDVPLSSDPGSAGGDGPVVVVRGKTVSGDFRITRAYAA*
Ga0157369_1162805913300013105Corn RhizosphereLDSAVALGSEAGFEEGGPTLVVRGKTVSGDFRLVRAG*
Ga0120150_111296723300013294PermafrostLDVDAGSVSGDLSSEVPLGSDAASAVGDGPTLVVRGKSVSGDFRVFRAS*
Ga0157372_1024915533300013307Corn RhizosphereDAGSVSGDLSSEVPLGSEPGVADGDGPALVVRGKTVSGDFRVFRAG*
Ga0120179_103130323300013763PermafrostVDAGSVSGDLASEVPLGSDPDAAGGDGPALVVRGKTVSGDFRVFRGL*
Ga0120158_1011168413300013772PermafrostVDAGSVSGDLSSEVPLGSEPGAHEGGPSLVVRGKTVSGDFRVFRAA*
Ga0167652_101066213300015164Glacier Forefield SoilDLASEVPLGSDPDAIGGSGPALVVRGKTVSGDFRVFRGL*
Ga0187812_113001423300017821Freshwater SedimentSASGDLSSEVPLSDTPGGDVGPTVVVRGNTVSGDFRVFRAA
Ga0187824_1018779223300017927Freshwater SedimentTNLDVDAGSVSGDLSSEVALGSDVGEIGDGPTLVVRGKTVSGDFRVFRAA
Ga0187819_1036528723300017943Freshwater SedimentDLSSEVPLSDTPGGDVGPTVVVRGNTVSGDFRVFRAA
Ga0187785_1007635613300017947Tropical PeatlandGSVSGDLTSEVPLGSDFGSMGDGPTLVVRGKTVSGDFKVFRAA
Ga0187779_1061575623300017959Tropical PeatlandVSGDLSSEVALGDSPDSTGGGPTVVVRGKTVSGDFRVFRAA
Ga0187779_1102300423300017959Tropical PeatlandSVSGELTSEVPLADAPVEAGDGPTVVVRGKTVSGDFRVFRAA
Ga0187780_1049932713300017973Tropical PeatlandTAVSGELSSEVPLASTPELVGEGDGPTVVVRGKTVSGDFHVFRAA
Ga0187869_1017222913300018030PeatlandAAGSSVDVDASSVSGDLSSDVPLANVPGEGESGPTVVVRGKTVSGDFKVARAA
Ga0184618_1023593923300018071Groundwater SedimentNLDVDAGSVSGDLSSEVPLGSDAASAVGDGPTLVVRGKSVSGDFRVFRAG
Ga0066667_1163579923300018433Grasslands SoilDAGSVSGDLTSEVPLGSDAASAAGEGPTLVVRGKSVSGDFRVFRAG
Ga0206354_1072950823300020081Corn, Switchgrass And Miscanthus RhizosphereVSGDLSSDVPLSSDPGSAGGDGPVVVVRGKTVSGDFRITRAYAA
Ga0179589_1050524613300024288Vadose Zone SoilSVSGDLSSEVPLGSDPGSAEGYGPMLVVRGKTVSGDFRVFRGQ
Ga0208563_102872723300025501PeatlandGSSVDVDASSVSGDLSSDVPLANVPGEGESGPTVVVRGKTVSGDFKVARAA
Ga0209584_1015241523300025878Arctic Peat SoilSGDLTSEVPLGSEPGVTHDGGPMLVVRGKTISGDFRVFRAA
Ga0207699_1049072623300025906Corn, Switchgrass And Miscanthus RhizosphereLTSEVPLGSDPDGFDNGDGPTLVVRGKTVSGDFRVFRG
Ga0207699_1074545913300025906Corn, Switchgrass And Miscanthus RhizosphereGTSLDVDANSVSGDLDSEVALGGELEGIEGDGPTLVVRGKTVSGDFRIGRA
Ga0207684_1141838313300025910Corn, Switchgrass And Miscanthus RhizosphereAGSVSGDLSSEVPLGSEPATGGNGPTVVVRGRTVSGDFKVFRAA
Ga0207660_1110569723300025917Corn RhizosphereSGELSSEVPLGSEPGEAGGDGPVLVVRGKTVSGDFRVFRAG
Ga0207660_1115103213300025917Corn RhizosphereVSGDIHLGVAEGTNVDVDANSVSGDLSSDVPLGADPTGVHTDGPTLVVRGKTVSGDFKLVRA
Ga0207652_1019593013300025921Corn RhizosphereGSVSGDLSSEVPLGSDPGSAEGYGPTLVVRGKTVSGDFRVFRAS
Ga0207646_1155120113300025922Corn, Switchgrass And Miscanthus RhizosphereSVSGDLSSEVPLGSERGPASDGPTLVVRGKTVSGDFRVFRAL
Ga0207667_1210338323300025949Corn RhizosphereEPGTTLDVDANSVSGDLDSAVALGSEAGFEEGGPTLVVRGKTVSGDFRIVRA
Ga0207702_1185499523300026078Corn RhizosphereLSSEVPLGSDPGSAEGYGPTLVVRGKTVSGDFRVFRAS
Ga0207698_1014839233300026142Corn RhizosphereNSVSGDLDSEVPLGSDIGLAPGPTLVVRGKTVSGDFRLVRAGS
Ga0209474_1020217323300026550SoilEVPLGSDAAAAAGEGPTLVVRGRSVSGDFRVVRAG
Ga0208988_115812623300027633Forest SoilNLDVDAGSVSGDLASEVPLGSDPDALGGDGPALVVRGKTVSGDFRVFRGL
Ga0209580_1054645313300027842Surface SoilGSVSGDLTSEVPLGSEPNGFDNGDGPMLVVRGKTVSGDFRVFRG
Ga0209701_1030448813300027862Vadose Zone SoilLDVDAGSVSGDLTSEVPLASDPGFVGDGPTLVVRGKTVSGDFRVFRAV
Ga0209579_1067668923300027869Surface SoilDLTSEVPLGSDAGAVGDGPTLVVRGKTVSGDFKVFRAA
Ga0265318_1024185623300028577RhizosphereSDVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA
Ga0265322_1001398843300028654RhizosphereDLSSDVPLASAPDESEGGGPVVIVRGKTVSGDFKVARAA
Ga0307280_1012459623300028768SoilAPGTTLDVDAGSVSGDLSSEVPLGSDPGAVAVDGGPTLVVRGKTVSGDFRVFRAA
Ga0265338_1013990613300028800RhizosphereLTSEVPLGSEPGATHDGGPTLVVRGKTISGDFRVFRAA
Ga0307305_1048031423300028807SoilAGSVSGDLSSEVPLGSDVASAAGDGPTLVVRGKSVSGDFRVFRAG
Ga0307312_1118527123300028828SoilNLDVDAGSVSGDLDSEVPLGSEPGVGDGSGPTLVVRGKTVSGDFRVFRA
Ga0265328_1034241413300031239RhizosphereIAAGSNVDVDANSVSGDLSSEVALATDPGVAGVGDGPTVVVRGKTVSGDFRVFRAA
Ga0265320_1025100433300031240RhizosphereDLTSEVPLANDMGTLGGGPTLVVRGNTVSGDFRVFRAA
Ga0265329_1000386893300031242RhizosphereSSDVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA
Ga0265340_1003400433300031247RhizosphereAGSVSGDLTSEVPLGSEPGATHDGGPTLVVRGKTISGDFRVFRAA
Ga0265339_1037409623300031249RhizosphereDLSSDVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA
Ga0265331_1013410913300031250RhizosphereDVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA
Ga0265316_1078290213300031344RhizosphereGDLSSDVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA
Ga0306917_1113273013300031719SoilLSSEVPLSGTRNDGPGPTLVVRSKTVSGDFRVVRAA
Ga0307477_1035197423300031753Hardwood Forest SoilPGTNLDVDAGSVSGDLTSEVPLGSDAGAVGDGPTLVVRGRTVSGDFKVFRAA
Ga0307477_1067892723300031753Hardwood Forest SoilDVDAASASGELSSEVPLSGTPGDNAGPTVVVRGNTVSGDFRVFRAA
Ga0308175_10064841813300031938SoilANSVSGDLESDVPLASDPSGANGEGPTLVVRGKTVSGDFRLVRG
Ga0308174_1042754223300031939SoilSGDIRVGVAAGTNVDVDANSVSGDLDSEVPLGTDIGLAPGPTLVVRGKTVSGDFRLVRAG
Ga0306920_10426966223300032261SoilLSSEVPLSGERSEGPGPTLVVRSKTVSGDFRVVRAA
Ga0306920_10432992923300032261SoilGDLTSEVPLSAVPSGEADPTLVVRGKTVSGDVRLVRAG
Ga0335080_1025979833300032828SoilSGELSSEVPLASSPELAGAGDGPTVVVRGKTVSGDFHVFRAA
Ga0335083_1032050713300032954SoilSSDVPLTSDPGEGGDGPTVILRGKTVSGDLKVFRSI
Ga0335083_1080732723300032954SoilTSEVALADTPGAAGAGPTVVVRGKTVSGDFRVFRAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.