NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076550

Metagenome / Metatranscriptome Family F076550

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076550
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 46 residues
Representative Sequence AVSHYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK
Number of Associated Samples 99
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.85 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.07 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.220 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(7.627 % of family members)
Environment Ontology (ENVO) Unclassified
(42.373 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.017 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 52.63%    Coil/Unstructured: 47.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF02915Rubrerythrin 2.54
PF00166Cpn10 1.69
PF07883Cupin_2 1.69
PF00291PALP 1.69
PF01207Dus 1.69
PF00881Nitroreductase 0.85
PF02687FtsX 0.85
PF00210Ferritin 0.85
PF00691OmpA 0.85
PF00809Pterin_bind 0.85
PF07589PEP-CTERM 0.85
PF07521RMMBL 0.85
PF06580His_kinase 0.85
PF01833TIG 0.85
PF00754F5_F8_type_C 0.85
PF13517FG-GAP_3 0.85
PF02661Fic 0.85
PF01980TrmO 0.85
PF04972BON 0.85
PF09509Hypoth_Ymh 0.85
PF00282Pyridoxal_deC 0.85
PF12680SnoaL_2 0.85
PF13432TPR_16 0.85
PF13470PIN_3 0.85
PF00106adh_short 0.85
PF00072Response_reg 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 1.69
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 1.69
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.85
COG1720tRNA (Thr-GGU) A37 N6-methylaseTranslation, ribosomal structure and biogenesis [J] 0.85
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.85
COG3275Sensor histidine kinase, LytS/YehU familySignal transduction mechanisms [T] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.22 %
UnclassifiedrootN/A6.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_3462465All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300000955|JGI1027J12803_101221015All Organisms → cellular organisms → Bacteria → Acidobacteria1427Open in IMG/M
3300000955|JGI1027J12803_103228940All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300001083|JGI12678J13193_1002219All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300002245|JGIcombinedJ26739_101407660All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300004643|Ga0062591_102522412All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300005171|Ga0066677_10777614All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300005179|Ga0066684_10020578All Organisms → cellular organisms → Bacteria3427Open in IMG/M
3300005330|Ga0070690_100725882All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300005331|Ga0070670_101698345All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300005332|Ga0066388_101777607All Organisms → cellular organisms → Bacteria → Acidobacteria1095Open in IMG/M
3300005335|Ga0070666_10372264All Organisms → cellular organisms → Bacteria → Acidobacteria1024Open in IMG/M
3300005355|Ga0070671_100642317All Organisms → cellular organisms → Bacteria → Acidobacteria919Open in IMG/M
3300005435|Ga0070714_102016726All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300005437|Ga0070710_10788680Not Available678Open in IMG/M
3300005454|Ga0066687_10343050All Organisms → cellular organisms → Bacteria → Acidobacteria854Open in IMG/M
3300005455|Ga0070663_102172428All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300005457|Ga0070662_100923772All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300005467|Ga0070706_100985479All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300005529|Ga0070741_10398339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1265Open in IMG/M
3300005530|Ga0070679_100381866All Organisms → cellular organisms → Bacteria → Acidobacteria1355Open in IMG/M
3300005530|Ga0070679_101567314All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium606Open in IMG/M
3300005532|Ga0070739_10371788All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300005535|Ga0070684_101644100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300005542|Ga0070732_10096167All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1742Open in IMG/M
3300005577|Ga0068857_100934219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales833Open in IMG/M
3300005577|Ga0068857_102381463All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300005578|Ga0068854_100951851All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300005598|Ga0066706_10123193All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300005614|Ga0068856_100520561All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300005614|Ga0068856_101379766All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300005842|Ga0068858_102313239All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006028|Ga0070717_11930897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300006041|Ga0075023_100157465All Organisms → cellular organisms → Bacteria → Acidobacteria843Open in IMG/M
3300006163|Ga0070715_10293994All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300006237|Ga0097621_100870642All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300006358|Ga0068871_100786129All Organisms → cellular organisms → Bacteria → Acidobacteria876Open in IMG/M
3300006800|Ga0066660_10821286All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300006806|Ga0079220_10463990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium852Open in IMG/M
3300006914|Ga0075436_101537272Not Available506Open in IMG/M
3300009029|Ga0066793_10232554All Organisms → cellular organisms → Bacteria → Acidobacteria1070Open in IMG/M
3300009137|Ga0066709_100790094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1374Open in IMG/M
3300009137|Ga0066709_101055913All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300009545|Ga0105237_11691207All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300009545|Ga0105237_11790182All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300009545|Ga0105237_11819734All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300009551|Ga0105238_10726197All Organisms → cellular organisms → Bacteria → Acidobacteria1006Open in IMG/M
3300009553|Ga0105249_13171779All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium528Open in IMG/M
3300010043|Ga0126380_10078073Not Available1906Open in IMG/M
3300010375|Ga0105239_10776568All Organisms → cellular organisms → Bacteria → Acidobacteria1097Open in IMG/M
3300010396|Ga0134126_10469363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1454Open in IMG/M
3300010403|Ga0134123_10013559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium5619Open in IMG/M
3300011120|Ga0150983_10014457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1041Open in IMG/M
3300012209|Ga0137379_10289384All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300012209|Ga0137379_10583000All Organisms → cellular organisms → Bacteria → Acidobacteria1025Open in IMG/M
3300012211|Ga0137377_10659944All Organisms → cellular organisms → Bacteria → Acidobacteria981Open in IMG/M
3300012469|Ga0150984_121366799All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300012511|Ga0157332_1031256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300012922|Ga0137394_10065513All Organisms → cellular organisms → Bacteria3020Open in IMG/M
3300012930|Ga0137407_11925897All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300012961|Ga0164302_10215951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1192Open in IMG/M
3300012984|Ga0164309_11814727All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300013104|Ga0157370_10689538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae933Open in IMG/M
3300013105|Ga0157369_10258052Not Available1818Open in IMG/M
3300013105|Ga0157369_10787886All Organisms → cellular organisms → Bacteria → Acidobacteria977Open in IMG/M
3300013296|Ga0157374_10056989All Organisms → cellular organisms → Bacteria → Acidobacteria3649Open in IMG/M
3300013296|Ga0157374_10646224All Organisms → cellular organisms → Bacteria → Acidobacteria1069Open in IMG/M
3300013297|Ga0157378_10551469All Organisms → cellular organisms → Bacteria → Acidobacteria1158Open in IMG/M
3300013297|Ga0157378_10710603All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300013297|Ga0157378_10896851All Organisms → cellular organisms → Bacteria → Acidobacteria917Open in IMG/M
3300014325|Ga0163163_12036144All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300014501|Ga0182024_11537523All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300014657|Ga0181522_10202218All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300014968|Ga0157379_11065401All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300015262|Ga0182007_10088448All Organisms → cellular organisms → Bacteria → Acidobacteria1019Open in IMG/M
3300015265|Ga0182005_1253938All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300015372|Ga0132256_100037013All Organisms → cellular organisms → Bacteria4458Open in IMG/M
3300015373|Ga0132257_102399175All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300015374|Ga0132255_100354069All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300017936|Ga0187821_10153661All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300017936|Ga0187821_10437570All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium540Open in IMG/M
3300018042|Ga0187871_10802171All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300020579|Ga0210407_11001314Not Available637Open in IMG/M
3300021180|Ga0210396_11474033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300021403|Ga0210397_10013181All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4999Open in IMG/M
3300021420|Ga0210394_10968910Not Available738Open in IMG/M
3300021432|Ga0210384_11533825All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300021445|Ga0182009_10199481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium973Open in IMG/M
3300022726|Ga0242654_10401856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300025906|Ga0207699_10343988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1051Open in IMG/M
3300025906|Ga0207699_10413742Not Available962Open in IMG/M
3300025906|Ga0207699_10829872All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300025910|Ga0207684_10267829All Organisms → cellular organisms → Bacteria → Acidobacteria1474Open in IMG/M
3300025911|Ga0207654_11181559All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300025914|Ga0207671_11595437All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300025917|Ga0207660_11467013All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300025924|Ga0207694_11263847All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300025925|Ga0207650_10572347All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300025928|Ga0207700_11278161All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300025929|Ga0207664_10371124All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1269Open in IMG/M
3300025929|Ga0207664_10753748All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300025929|Ga0207664_10759178All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300025929|Ga0207664_11601878All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300025933|Ga0207706_10870856All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300025945|Ga0207679_11264970All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300025945|Ga0207679_12142747All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300025961|Ga0207712_11911534All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium531Open in IMG/M
3300026078|Ga0207702_10822695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300026527|Ga0209059_1156685Not Available824Open in IMG/M
3300027674|Ga0209118_1192700All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300031152|Ga0307501_10278201All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031184|Ga0307499_10069511All Organisms → cellular organisms → Bacteria → Acidobacteria906Open in IMG/M
3300031716|Ga0310813_10755894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium872Open in IMG/M
3300031718|Ga0307474_10592614All Organisms → cellular organisms → Bacteria → Acidobacteria873Open in IMG/M
3300031720|Ga0307469_10436623All Organisms → cellular organisms → Bacteria → Acidobacteria1129Open in IMG/M
3300031938|Ga0308175_101071886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae893Open in IMG/M
3300032180|Ga0307471_101458796All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300033412|Ga0310810_10715141All Organisms → cellular organisms → Bacteria927Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.08%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.08%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.24%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil4.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.24%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.24%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.39%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.39%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.54%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.69%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.69%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.85%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.85%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001083Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0227.000003902162886012Miscanthus RhizosphereAVSHYTFTYDAELQGKHRERTVICSDTWVNDSGTWKTASTHCSLVKGQ
JGI1027J12803_10122101533300000955SoilYTFTYDAELQGKHRARTVICSDTWINDSGTWKTASTHCSLVKGE*
JGI1027J12803_10322894013300000955SoilLQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ*
JGI12678J13193_100221913300001083Forest SoilYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ*
JGIcombinedJ26739_10140766023300002245Forest SoilVATFGPNTAVAHYKLAYDATFNGTHRARTVICSDTWINQSGAWKLASNHCSHVEGT*
Ga0062591_10252241213300004643SoilAHYKFTYDADIGGTHRARSVICSDTWVNDSGTWKSASTHCSLVQGK*
Ga0066677_1077761413300005171SoilSHYTFTYDAELQGKHRARTVICSDTWVNDSGSWKTASTHCSLVKGQ*
Ga0066684_1002057863300005179SoilSHYTFTYDAELQGKHRARTVICSDTWVNDSGAWKTASTHCSLVKGE*
Ga0070690_10072588213300005330Switchgrass RhizosphereNTAVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKDT*
Ga0070670_10169834513300005331Switchgrass RhizosphereAVSHYTFTYDAELQGKHRARTVICSDSWVNDSGTWKTASTHCSLVKGE*
Ga0066388_10177760713300005332Tropical Forest SoilHYKFTYDATFNGTHRARPVICSDTWVNDSGTWKLAATHCSVSEGK*
Ga0070666_1037226423300005335Switchgrass RhizosphereTYDAELQGKHRERTVICSDTWVNDSGTWKTASTHCSLVKGQ*
Ga0070671_10064231713300005355Switchgrass RhizosphereYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT*
Ga0070714_10201672613300005435Agricultural SoilKFAYDATFNGTHRARTVICSDTWVNQSGAWKLISDHCSHVEGT*
Ga0070710_1078868013300005437Corn, Switchgrass And Miscanthus RhizosphereAAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ*
Ga0066687_1034305023300005454SoilAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ*
Ga0070663_10217242813300005455Corn RhizosphereTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT*
Ga0070662_10092377213300005457Corn RhizosphereIAHYKFIYDATFNGTHRARTVICSDTWINQSGAWKLASNHCSHVEGT*
Ga0070706_10098547913300005467Corn, Switchgrass And Miscanthus RhizosphereAVSHYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK*
Ga0070741_1039833913300005529Surface SoilAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGI*
Ga0070679_10038186623300005530Corn RhizosphereFTYEAELQGTHRARTVLCSDTWVNDSGTWKTASTHCSLVKGK*
Ga0070679_10156731423300005530Corn RhizosphereFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSMVKGL*
Ga0070739_1037178823300005532Surface SoilLQGKHRARTVICSDTWINDSGTWKTASTHCSLVKGL*
Ga0070684_10164410013300005535Corn RhizosphereTAVSHYTFTYDAELKGTHRARTVICSDTWINDSGTWKTAATHCSMVKGK*
Ga0070732_1009616743300005542Surface SoilATFGPNAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGL*
Ga0068857_10093421913300005577Corn RhizosphereTFTYDADFKGTHRARTVICSDTWLNDSGTWKTASTHCTLVKGM*
Ga0068857_10238146313300005577Corn RhizosphereFTYDATFNGTHRARTVICSDTWIDQSGAWKLASNHCSHVEGT*
Ga0068854_10095185113300005578Corn RhizosphereDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVRGT*
Ga0066706_1012319313300005598SoilGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK*
Ga0068856_10052056133300005614Corn RhizosphereATFGANTAVAHYKFTYDADIGGTHRARSVICSDTWVNDSGTWKSAATHCSLVQGK*
Ga0068856_10137976613300005614Corn RhizosphereTAVARYKLVYDATFSGTHRARTVICSDTWVNQSGVWTLVADHCSHVEGT*
Ga0068858_10231323923300005842Switchgrass RhizosphereTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK*
Ga0070717_1193089713300006028Corn, Switchgrass And Miscanthus RhizosphereTFGSNTAVSHYTFTYDAELRGTHRARTVICSDTWINDSGTWKTAATHCSMVKGK*
Ga0075023_10015746513300006041WatershedsFGSNIAVSHYTFTYDAELQGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGM*
Ga0070715_1029399433300006163Corn, Switchgrass And Miscanthus RhizosphereFTYDAELRGKHRARTVICSDTWVNDAGTWKTLSTHCSLVKGE*
Ga0097621_10087064223300006237Miscanthus RhizosphereDFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGT*
Ga0068871_10078612913300006358Miscanthus RhizosphereAVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGT*
Ga0066660_1082128623300006800SoilAVSHYKFTYDAEIKGTHRARTVICSDTWINDSGTWKTAATHCSMVKGK*
Ga0079220_1046399023300006806Agricultural SoilHYKFTYDATFGGTHRARPVICSDTWVNDSGTWKSAANHCSVSEDK*
Ga0075436_10153727223300006914Populus RhizosphereFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ*
Ga0066793_1023255443300009029Prmafrost SoilLQFTYDATFNGTHRARTVICSDTWLNQSGGWKLASSHCSHVEGK*
Ga0066709_10079009423300009137Grasslands SoilMVATFGSNTAVSHYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCALVK
Ga0066709_10105591313300009137Grasslands SoilNTAVSHYKFTYDAELRGKHRARTVICSDTWVNDSGTWKTAATHCSMVEGSGK*
Ga0105237_1169120723300009545Corn RhizosphereYDAELQGKHRARTVICSDTWVNDSGTWKTAATHCSMVKGV*
Ga0105237_1179018213300009545Corn RhizosphereSNTAISHYSFTYDAQFKGTHRARTVICSDTWVYDSGTWKTASTHCTLVKGI*
Ga0105237_1181973413300009545Corn RhizosphereTFGSNTAVSHYTFTYEADFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGK*
Ga0105238_1072619733300009551Corn RhizosphereYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVKGT*
Ga0105249_1317177923300009553Switchgrass RhizosphereTFGSNTAVSHYTFTYEAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK*
Ga0126380_1007807313300010043Tropical Forest SoilTYDADIGGQHRARTVICSDTWVNDSGTWKSAATHCSLVQGK*
Ga0105239_1077656823300010375Corn RhizosphereTYDADIGGTHRARSVICSDTWVNDSGAWKSASTHCSLVQGK*
Ga0134126_1046936323300010396Terrestrial SoilATFGANTAVAHYKFTYDADIGGTHRARSVICSDTWVNDSGTWKSASTHCSLVQGK*
Ga0134123_1001355983300010403Terrestrial SoilFGANTAVSHYTFTYEAELQGTHRARTVLCSDTWVNDSGTWKTASTHCSLVKGK*
Ga0150983_1001445713300011120Forest SoilGPNAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGE*
Ga0137379_1028938413300012209Vadose Zone SoilYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVKGM*
Ga0137379_1058300023300012209Vadose Zone SoilVAFGSNTAVSHYTFTYDADFEGTHRARTVICSDTWVKDSGTWKTASTHCTLVKGM*
Ga0137377_1065994433300012211Vadose Zone SoilELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ*
Ga0150984_12136679923300012469Avena Fatua RhizosphereYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ*
Ga0157332_103125623300012511SoilSHYTFTYEADLQGKHRARTVLCSDTWVNDSGTWKTASTHCSLVKGK*
Ga0137394_1006551353300012922Vadose Zone SoilQGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ*
Ga0137407_1192589713300012930Vadose Zone SoilQGKHRARTVICSDTWVNDSGTWKTASTHCSMVKGE*
Ga0164302_1021595123300012961SoilVSHYTFTYDAELRGTHRARTVICSDTWINDSGTWKTAATHCSMVKGK*
Ga0164309_1181472713300012984SoilTFTYDAELQGKHRARTVICSDAWVNDSGTWKTASTHCSLVKGQ*
Ga0157370_1068953823300013104Corn RhizosphereFGPNTAIARYKFAYDATFNGTHRARTVICSDTWVNQSGAWKLVSDHCSHVEGT*
Ga0157369_1025805223300013105Corn RhizosphereFTYDADIGGTHRARSVICSDTWVNDSGTWKSASTHCSLVQGK*
Ga0157369_1078788633300013105Corn RhizosphereTFTYDADFKGTHRARTVICSDTWVNYSGTWKTASTHCTLVRGT*
Ga0157374_1005698913300013296Miscanthus RhizosphereTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVKGT*
Ga0157374_1064622423300013296Miscanthus RhizosphereVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT*
Ga0157378_1055146933300013297Miscanthus RhizosphereTFGSNTAVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGT*
Ga0157378_1071060313300013297Miscanthus RhizosphereTFTYDAELQGKHRERTVICSDTWVNDSGTWKTASTHCSLVNGQ*
Ga0157378_1089685113300013297Miscanthus RhizosphereTFTYDAELQGKHRERTVICSDTWVNDSGTWKTASTHCSLVKGQ*
Ga0163163_1203614413300014325Switchgrass RhizosphereFGPNAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTAATHCSMVKGV*
Ga0182024_1153752313300014501PermafrostAVAHYKFVYDATFTGTHRARTVICSDTWINESGAWKVASSHCSHVEGK*
Ga0181522_1020221813300014657BogTYDAELNGTHRARTILCSDTWINDSGAWKTAASHCSLVKGI*
Ga0157379_1106540133300014968Switchgrass RhizosphereAVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT*
Ga0182007_1008844813300015262RhizosphereYKFTYDAEIKGEHRARTVICSDTWINDSGTWKTASTHCSMVKGK*
Ga0182005_125393813300015265RhizosphereTFGSNAAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ*
Ga0132256_10003701363300015372Arabidopsis RhizosphereSNVAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ*
Ga0132257_10239917513300015373Arabidopsis RhizosphereGPNAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTAATHCSMVKGV*
Ga0132255_10035406943300015374Arabidopsis RhizosphereAVSHYTFTYDAELNGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ*
Ga0187821_1015366113300017936Freshwater SedimentELQGKHRARTVICSDTWINDSGTWKTVSTHCSLVKGE
Ga0187821_1043757023300017936Freshwater SedimentNAAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSMVKGL
Ga0187871_1080217113300018042PeatlandTFTYDADLNGTHRARTILCSDTWVDDSGAWKTAASHCSFVKGM
Ga0210407_1100131423300020579SoilYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ
Ga0210396_1147403313300021180SoilSYDADLKGTHRARTVICSDTWVNDSGTWKTASTHCSMVKGM
Ga0210397_1001318183300021403SoilDINGTHRARSVICSDTWFNDSGTWKSASTHCSLVQGK
Ga0210394_1096891013300021420SoilVSHYTFTYEAELQGTHRARTVICSDTWLNDSGTWKTASTHCSMVKGM
Ga0210384_1153382513300021432SoilIAHYKFTYDATFNGTHRARSVICSDTWISQSGEWKIASNHCSHVEGT
Ga0182009_1019948113300021445SoilPNIAVSHYTFTYDAEIRGTHRARTVICSDTWINDSGTWKTATTHCSMVKGK
Ga0242654_1040185613300022726SoilVATFGPNTAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ
Ga0207699_1034398813300025906Corn, Switchgrass And Miscanthus RhizosphereQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGL
Ga0207699_1041374213300025906Corn, Switchgrass And Miscanthus RhizosphereVAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ
Ga0207699_1082987213300025906Corn, Switchgrass And Miscanthus RhizosphereDMATFGPNTAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGT
Ga0207684_1026782913300025910Corn, Switchgrass And Miscanthus RhizosphereAVSHYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK
Ga0207654_1118155913300025911Corn RhizosphereQVATFGPNVAVSHYTFTYEADLQGKHRARTVLCSDTWVNDSGTWKTASTHCSLVKGK
Ga0207671_1159543713300025914Corn RhizosphereTFGSNTAVSHYTFTYEADFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGK
Ga0207660_1146701313300025917Corn RhizosphereTFSGTHRARTVICSDTWVNQSGVWTLVADHCSHVEGT
Ga0207694_1126384723300025924Corn RhizosphereTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVKGT
Ga0207650_1057234713300025925Switchgrass RhizosphereVKVATFGSNTAVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT
Ga0207700_1127816113300025928Corn, Switchgrass And Miscanthus RhizosphereIGGTHRARSVICSDTWVNDSGTWKSAATHCSLVQGK
Ga0207664_1037112433300025929Agricultural SoilYDATFNGTHRARTVICSDTWLNQSGAWKLVSDHCSHVEGT
Ga0207664_1075374813300025929Agricultural SoilDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ
Ga0207664_1075917813300025929Agricultural SoilFTYDADIGGTHRARSVICSDTWVNDSGTWKSAATHCSLVQGK
Ga0207664_1160187823300025929Agricultural SoilRFAYDATFSGTHRARTVICSDTWVNQSGTWKIISSHCSHVEGT
Ga0207706_1087085623300025933Corn RhizosphereIAHYKFIYDATFNGTHRARTVICSDTWINQSGAWKLASNHCSHVEGT
Ga0207679_1126497013300025945Corn RhizosphereAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTAATHCSMVKGV
Ga0207679_1214274713300025945Corn RhizosphereTAVSHYTFTYDADFKGTHRARTVICSDTWLNDSGTWKTASTHCTLVKGM
Ga0207712_1191153423300025961Switchgrass RhizosphereATFGSNTAVSHYTFTYEAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK
Ga0207702_1082269523300026078Corn RhizosphereHYKFTYDADIGGTHRARSVICSDTWVNDSGTWKSAATHCSLVQGK
Ga0209059_115668513300026527SoilQVATFGSNAAVSHYTFTYDAELRGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK
Ga0209118_119270013300027674Forest SoilNAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ
Ga0307501_1027820113300031152SoilISHYTFTYEADMNGTHRARTVICSDTWVNDSGTWKTATTHCSMVKGK
Ga0307499_1006951113300031184SoilFTYDAELQGKHRARTVICSDTWVNDSTWKTASTHCSLVKGQ
Ga0310813_1075589413300031716SoilGANTAVAHYKFIYDADIGGTHRAPSVICSDTWVNDSGTWKSASTHCSLVQGK
Ga0307474_1059261413300031718Hardwood Forest SoilGPNAAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ
Ga0307469_1043662313300031720Hardwood Forest SoilSHYTFTYDAELQGTHRARTVICSDTWLNDSGTWKTASTHCSLVKGK
Ga0308175_10107188623300031938SoilKFAYDATFNGTHRARTVICSDTWLNQSGAWKLVSDHCSHVEGT
Ga0307471_10145879613300032180Hardwood Forest SoilVSRYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK
Ga0310810_1071514113300033412SoilVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.