| Basic Information | |
|---|---|
| Family ID | F076550 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AVSHYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.07 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.220 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (7.627 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.017 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 52.63% Coil/Unstructured: 47.37% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF02915 | Rubrerythrin | 2.54 |
| PF00166 | Cpn10 | 1.69 |
| PF07883 | Cupin_2 | 1.69 |
| PF00291 | PALP | 1.69 |
| PF01207 | Dus | 1.69 |
| PF00881 | Nitroreductase | 0.85 |
| PF02687 | FtsX | 0.85 |
| PF00210 | Ferritin | 0.85 |
| PF00691 | OmpA | 0.85 |
| PF00809 | Pterin_bind | 0.85 |
| PF07589 | PEP-CTERM | 0.85 |
| PF07521 | RMMBL | 0.85 |
| PF06580 | His_kinase | 0.85 |
| PF01833 | TIG | 0.85 |
| PF00754 | F5_F8_type_C | 0.85 |
| PF13517 | FG-GAP_3 | 0.85 |
| PF02661 | Fic | 0.85 |
| PF01980 | TrmO | 0.85 |
| PF04972 | BON | 0.85 |
| PF09509 | Hypoth_Ymh | 0.85 |
| PF00282 | Pyridoxal_deC | 0.85 |
| PF12680 | SnoaL_2 | 0.85 |
| PF13432 | TPR_16 | 0.85 |
| PF13470 | PIN_3 | 0.85 |
| PF00106 | adh_short | 0.85 |
| PF00072 | Response_reg | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.69 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.85 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.85 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.22 % |
| Unclassified | root | N/A | 6.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_3462465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300000955|JGI1027J12803_101221015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1427 | Open in IMG/M |
| 3300000955|JGI1027J12803_103228940 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300001083|JGI12678J13193_1002219 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101407660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300004643|Ga0062591_102522412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300005171|Ga0066677_10777614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300005179|Ga0066684_10020578 | All Organisms → cellular organisms → Bacteria | 3427 | Open in IMG/M |
| 3300005330|Ga0070690_100725882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300005331|Ga0070670_101698345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300005332|Ga0066388_101777607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300005335|Ga0070666_10372264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300005355|Ga0070671_100642317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300005435|Ga0070714_102016726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300005437|Ga0070710_10788680 | Not Available | 678 | Open in IMG/M |
| 3300005454|Ga0066687_10343050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300005455|Ga0070663_102172428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300005457|Ga0070662_100923772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300005467|Ga0070706_100985479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300005529|Ga0070741_10398339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1265 | Open in IMG/M |
| 3300005530|Ga0070679_100381866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1355 | Open in IMG/M |
| 3300005530|Ga0070679_101567314 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 606 | Open in IMG/M |
| 3300005532|Ga0070739_10371788 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005535|Ga0070684_101644100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300005542|Ga0070732_10096167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1742 | Open in IMG/M |
| 3300005577|Ga0068857_100934219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 833 | Open in IMG/M |
| 3300005577|Ga0068857_102381463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300005578|Ga0068854_100951851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300005598|Ga0066706_10123193 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300005614|Ga0068856_100520561 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005614|Ga0068856_101379766 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005842|Ga0068858_102313239 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006028|Ga0070717_11930897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300006041|Ga0075023_100157465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300006163|Ga0070715_10293994 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006237|Ga0097621_100870642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300006358|Ga0068871_100786129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300006800|Ga0066660_10821286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300006806|Ga0079220_10463990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300006914|Ga0075436_101537272 | Not Available | 506 | Open in IMG/M |
| 3300009029|Ga0066793_10232554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300009137|Ga0066709_100790094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1374 | Open in IMG/M |
| 3300009137|Ga0066709_101055913 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300009545|Ga0105237_11691207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300009545|Ga0105237_11790182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300009545|Ga0105237_11819734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300009551|Ga0105238_10726197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300009553|Ga0105249_13171779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 528 | Open in IMG/M |
| 3300010043|Ga0126380_10078073 | Not Available | 1906 | Open in IMG/M |
| 3300010375|Ga0105239_10776568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300010396|Ga0134126_10469363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1454 | Open in IMG/M |
| 3300010403|Ga0134123_10013559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 5619 | Open in IMG/M |
| 3300011120|Ga0150983_10014457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
| 3300012209|Ga0137379_10289384 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300012209|Ga0137379_10583000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300012211|Ga0137377_10659944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300012469|Ga0150984_121366799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300012511|Ga0157332_1031256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300012922|Ga0137394_10065513 | All Organisms → cellular organisms → Bacteria | 3020 | Open in IMG/M |
| 3300012930|Ga0137407_11925897 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012961|Ga0164302_10215951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
| 3300012984|Ga0164309_11814727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300013104|Ga0157370_10689538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 933 | Open in IMG/M |
| 3300013105|Ga0157369_10258052 | Not Available | 1818 | Open in IMG/M |
| 3300013105|Ga0157369_10787886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300013296|Ga0157374_10056989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3649 | Open in IMG/M |
| 3300013296|Ga0157374_10646224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300013297|Ga0157378_10551469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300013297|Ga0157378_10710603 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300013297|Ga0157378_10896851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300014325|Ga0163163_12036144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300014501|Ga0182024_11537523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300014657|Ga0181522_10202218 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300014968|Ga0157379_11065401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300015262|Ga0182007_10088448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300015265|Ga0182005_1253938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300015372|Ga0132256_100037013 | All Organisms → cellular organisms → Bacteria | 4458 | Open in IMG/M |
| 3300015373|Ga0132257_102399175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300015374|Ga0132255_100354069 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300017936|Ga0187821_10153661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300017936|Ga0187821_10437570 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 540 | Open in IMG/M |
| 3300018042|Ga0187871_10802171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300020579|Ga0210407_11001314 | Not Available | 637 | Open in IMG/M |
| 3300021180|Ga0210396_11474033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300021403|Ga0210397_10013181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4999 | Open in IMG/M |
| 3300021420|Ga0210394_10968910 | Not Available | 738 | Open in IMG/M |
| 3300021432|Ga0210384_11533825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300021445|Ga0182009_10199481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300022726|Ga0242654_10401856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300025906|Ga0207699_10343988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300025906|Ga0207699_10413742 | Not Available | 962 | Open in IMG/M |
| 3300025906|Ga0207699_10829872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300025910|Ga0207684_10267829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1474 | Open in IMG/M |
| 3300025911|Ga0207654_11181559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300025914|Ga0207671_11595437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300025917|Ga0207660_11467013 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300025924|Ga0207694_11263847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300025925|Ga0207650_10572347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300025928|Ga0207700_11278161 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300025929|Ga0207664_10371124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1269 | Open in IMG/M |
| 3300025929|Ga0207664_10753748 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300025929|Ga0207664_10759178 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300025929|Ga0207664_11601878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300025933|Ga0207706_10870856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300025945|Ga0207679_11264970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300025945|Ga0207679_12142747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300025961|Ga0207712_11911534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 531 | Open in IMG/M |
| 3300026078|Ga0207702_10822695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300026527|Ga0209059_1156685 | Not Available | 824 | Open in IMG/M |
| 3300027674|Ga0209118_1192700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300031152|Ga0307501_10278201 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031184|Ga0307499_10069511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300031716|Ga0310813_10755894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300031718|Ga0307474_10592614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300031720|Ga0307469_10436623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300031938|Ga0308175_101071886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 893 | Open in IMG/M |
| 3300032180|Ga0307471_101458796 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300033412|Ga0310810_10715141 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 4.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.39% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.39% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.85% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001083 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0227.00000390 | 2162886012 | Miscanthus Rhizosphere | AVSHYTFTYDAELQGKHRERTVICSDTWVNDSGTWKTASTHCSLVKGQ |
| JGI1027J12803_1012210153 | 3300000955 | Soil | YTFTYDAELQGKHRARTVICSDTWINDSGTWKTASTHCSLVKGE* |
| JGI1027J12803_1032289401 | 3300000955 | Soil | LQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ* |
| JGI12678J13193_10022191 | 3300001083 | Forest Soil | YDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ* |
| JGIcombinedJ26739_1014076602 | 3300002245 | Forest Soil | VATFGPNTAVAHYKLAYDATFNGTHRARTVICSDTWINQSGAWKLASNHCSHVEGT* |
| Ga0062591_1025224121 | 3300004643 | Soil | AHYKFTYDADIGGTHRARSVICSDTWVNDSGTWKSASTHCSLVQGK* |
| Ga0066677_107776141 | 3300005171 | Soil | SHYTFTYDAELQGKHRARTVICSDTWVNDSGSWKTASTHCSLVKGQ* |
| Ga0066684_100205786 | 3300005179 | Soil | SHYTFTYDAELQGKHRARTVICSDTWVNDSGAWKTASTHCSLVKGE* |
| Ga0070690_1007258821 | 3300005330 | Switchgrass Rhizosphere | NTAVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKDT* |
| Ga0070670_1016983451 | 3300005331 | Switchgrass Rhizosphere | AVSHYTFTYDAELQGKHRARTVICSDSWVNDSGTWKTASTHCSLVKGE* |
| Ga0066388_1017776071 | 3300005332 | Tropical Forest Soil | HYKFTYDATFNGTHRARPVICSDTWVNDSGTWKLAATHCSVSEGK* |
| Ga0070666_103722642 | 3300005335 | Switchgrass Rhizosphere | TYDAELQGKHRERTVICSDTWVNDSGTWKTASTHCSLVKGQ* |
| Ga0070671_1006423171 | 3300005355 | Switchgrass Rhizosphere | YTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT* |
| Ga0070714_1020167261 | 3300005435 | Agricultural Soil | KFAYDATFNGTHRARTVICSDTWVNQSGAWKLISDHCSHVEGT* |
| Ga0070710_107886801 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ* |
| Ga0066687_103430502 | 3300005454 | Soil | AAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ* |
| Ga0070663_1021724281 | 3300005455 | Corn Rhizosphere | TFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT* |
| Ga0070662_1009237721 | 3300005457 | Corn Rhizosphere | IAHYKFIYDATFNGTHRARTVICSDTWINQSGAWKLASNHCSHVEGT* |
| Ga0070706_1009854791 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AVSHYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK* |
| Ga0070741_103983391 | 3300005529 | Surface Soil | AELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGI* |
| Ga0070679_1003818662 | 3300005530 | Corn Rhizosphere | FTYEAELQGTHRARTVLCSDTWVNDSGTWKTASTHCSLVKGK* |
| Ga0070679_1015673142 | 3300005530 | Corn Rhizosphere | FTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSMVKGL* |
| Ga0070739_103717882 | 3300005532 | Surface Soil | LQGKHRARTVICSDTWINDSGTWKTASTHCSLVKGL* |
| Ga0070684_1016441001 | 3300005535 | Corn Rhizosphere | TAVSHYTFTYDAELKGTHRARTVICSDTWINDSGTWKTAATHCSMVKGK* |
| Ga0070732_100961674 | 3300005542 | Surface Soil | ATFGPNAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGL* |
| Ga0068857_1009342191 | 3300005577 | Corn Rhizosphere | TFTYDADFKGTHRARTVICSDTWLNDSGTWKTASTHCTLVKGM* |
| Ga0068857_1023814631 | 3300005577 | Corn Rhizosphere | FTYDATFNGTHRARTVICSDTWIDQSGAWKLASNHCSHVEGT* |
| Ga0068854_1009518511 | 3300005578 | Corn Rhizosphere | DADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVRGT* |
| Ga0066706_101231931 | 3300005598 | Soil | GTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK* |
| Ga0068856_1005205613 | 3300005614 | Corn Rhizosphere | ATFGANTAVAHYKFTYDADIGGTHRARSVICSDTWVNDSGTWKSAATHCSLVQGK* |
| Ga0068856_1013797661 | 3300005614 | Corn Rhizosphere | TAVARYKLVYDATFSGTHRARTVICSDTWVNQSGVWTLVADHCSHVEGT* |
| Ga0068858_1023132392 | 3300005842 | Switchgrass Rhizosphere | TYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK* |
| Ga0070717_119308971 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TFGSNTAVSHYTFTYDAELRGTHRARTVICSDTWINDSGTWKTAATHCSMVKGK* |
| Ga0075023_1001574651 | 3300006041 | Watersheds | FGSNIAVSHYTFTYDAELQGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGM* |
| Ga0070715_102939943 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | FTYDAELRGKHRARTVICSDTWVNDAGTWKTLSTHCSLVKGE* |
| Ga0097621_1008706422 | 3300006237 | Miscanthus Rhizosphere | DFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGT* |
| Ga0068871_1007861291 | 3300006358 | Miscanthus Rhizosphere | AVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGT* |
| Ga0066660_108212862 | 3300006800 | Soil | AVSHYKFTYDAEIKGTHRARTVICSDTWINDSGTWKTAATHCSMVKGK* |
| Ga0079220_104639902 | 3300006806 | Agricultural Soil | HYKFTYDATFGGTHRARPVICSDTWVNDSGTWKSAANHCSVSEDK* |
| Ga0075436_1015372722 | 3300006914 | Populus Rhizosphere | FTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ* |
| Ga0066793_102325544 | 3300009029 | Prmafrost Soil | LQFTYDATFNGTHRARTVICSDTWLNQSGGWKLASSHCSHVEGK* |
| Ga0066709_1007900942 | 3300009137 | Grasslands Soil | MVATFGSNTAVSHYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCALVK |
| Ga0066709_1010559131 | 3300009137 | Grasslands Soil | NTAVSHYKFTYDAELRGKHRARTVICSDTWVNDSGTWKTAATHCSMVEGSGK* |
| Ga0105237_116912072 | 3300009545 | Corn Rhizosphere | YDAELQGKHRARTVICSDTWVNDSGTWKTAATHCSMVKGV* |
| Ga0105237_117901821 | 3300009545 | Corn Rhizosphere | SNTAISHYSFTYDAQFKGTHRARTVICSDTWVYDSGTWKTASTHCTLVKGI* |
| Ga0105237_118197341 | 3300009545 | Corn Rhizosphere | TFGSNTAVSHYTFTYEADFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGK* |
| Ga0105238_107261973 | 3300009551 | Corn Rhizosphere | YDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVKGT* |
| Ga0105249_131717792 | 3300009553 | Switchgrass Rhizosphere | TFGSNTAVSHYTFTYEAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK* |
| Ga0126380_100780731 | 3300010043 | Tropical Forest Soil | TYDADIGGQHRARTVICSDTWVNDSGTWKSAATHCSLVQGK* |
| Ga0105239_107765682 | 3300010375 | Corn Rhizosphere | TYDADIGGTHRARSVICSDTWVNDSGAWKSASTHCSLVQGK* |
| Ga0134126_104693632 | 3300010396 | Terrestrial Soil | ATFGANTAVAHYKFTYDADIGGTHRARSVICSDTWVNDSGTWKSASTHCSLVQGK* |
| Ga0134123_100135598 | 3300010403 | Terrestrial Soil | FGANTAVSHYTFTYEAELQGTHRARTVLCSDTWVNDSGTWKTASTHCSLVKGK* |
| Ga0150983_100144571 | 3300011120 | Forest Soil | GPNAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGE* |
| Ga0137379_102893841 | 3300012209 | Vadose Zone Soil | YTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVKGM* |
| Ga0137379_105830002 | 3300012209 | Vadose Zone Soil | VAFGSNTAVSHYTFTYDADFEGTHRARTVICSDTWVKDSGTWKTASTHCTLVKGM* |
| Ga0137377_106599443 | 3300012211 | Vadose Zone Soil | ELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ* |
| Ga0150984_1213667992 | 3300012469 | Avena Fatua Rhizosphere | YTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ* |
| Ga0157332_10312562 | 3300012511 | Soil | SHYTFTYEADLQGKHRARTVLCSDTWVNDSGTWKTASTHCSLVKGK* |
| Ga0137394_100655135 | 3300012922 | Vadose Zone Soil | QGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ* |
| Ga0137407_119258971 | 3300012930 | Vadose Zone Soil | QGKHRARTVICSDTWVNDSGTWKTASTHCSMVKGE* |
| Ga0164302_102159512 | 3300012961 | Soil | VSHYTFTYDAELRGTHRARTVICSDTWINDSGTWKTAATHCSMVKGK* |
| Ga0164309_118147271 | 3300012984 | Soil | TFTYDAELQGKHRARTVICSDAWVNDSGTWKTASTHCSLVKGQ* |
| Ga0157370_106895382 | 3300013104 | Corn Rhizosphere | FGPNTAIARYKFAYDATFNGTHRARTVICSDTWVNQSGAWKLVSDHCSHVEGT* |
| Ga0157369_102580522 | 3300013105 | Corn Rhizosphere | FTYDADIGGTHRARSVICSDTWVNDSGTWKSASTHCSLVQGK* |
| Ga0157369_107878863 | 3300013105 | Corn Rhizosphere | TFTYDADFKGTHRARTVICSDTWVNYSGTWKTASTHCTLVRGT* |
| Ga0157374_100569891 | 3300013296 | Miscanthus Rhizosphere | TYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVKGT* |
| Ga0157374_106462242 | 3300013296 | Miscanthus Rhizosphere | VSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT* |
| Ga0157378_105514693 | 3300013297 | Miscanthus Rhizosphere | TFGSNTAVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGT* |
| Ga0157378_107106031 | 3300013297 | Miscanthus Rhizosphere | TFTYDAELQGKHRERTVICSDTWVNDSGTWKTASTHCSLVNGQ* |
| Ga0157378_108968511 | 3300013297 | Miscanthus Rhizosphere | TFTYDAELQGKHRERTVICSDTWVNDSGTWKTASTHCSLVKGQ* |
| Ga0163163_120361441 | 3300014325 | Switchgrass Rhizosphere | FGPNAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTAATHCSMVKGV* |
| Ga0182024_115375231 | 3300014501 | Permafrost | AVAHYKFVYDATFTGTHRARTVICSDTWINESGAWKVASSHCSHVEGK* |
| Ga0181522_102022181 | 3300014657 | Bog | TYDAELNGTHRARTILCSDTWINDSGAWKTAASHCSLVKGI* |
| Ga0157379_110654013 | 3300014968 | Switchgrass Rhizosphere | AVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT* |
| Ga0182007_100884481 | 3300015262 | Rhizosphere | YKFTYDAEIKGEHRARTVICSDTWINDSGTWKTASTHCSMVKGK* |
| Ga0182005_12539381 | 3300015265 | Rhizosphere | TFGSNAAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ* |
| Ga0132256_1000370136 | 3300015372 | Arabidopsis Rhizosphere | SNVAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ* |
| Ga0132257_1023991751 | 3300015373 | Arabidopsis Rhizosphere | GPNAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTAATHCSMVKGV* |
| Ga0132255_1003540694 | 3300015374 | Arabidopsis Rhizosphere | AVSHYTFTYDAELNGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ* |
| Ga0187821_101536611 | 3300017936 | Freshwater Sediment | ELQGKHRARTVICSDTWINDSGTWKTVSTHCSLVKGE |
| Ga0187821_104375702 | 3300017936 | Freshwater Sediment | NAAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSMVKGL |
| Ga0187871_108021711 | 3300018042 | Peatland | TFTYDADLNGTHRARTILCSDTWVDDSGAWKTAASHCSFVKGM |
| Ga0210407_110013142 | 3300020579 | Soil | YDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ |
| Ga0210396_114740331 | 3300021180 | Soil | SYDADLKGTHRARTVICSDTWVNDSGTWKTASTHCSMVKGM |
| Ga0210397_100131818 | 3300021403 | Soil | DINGTHRARSVICSDTWFNDSGTWKSASTHCSLVQGK |
| Ga0210394_109689101 | 3300021420 | Soil | VSHYTFTYEAELQGTHRARTVICSDTWLNDSGTWKTASTHCSMVKGM |
| Ga0210384_115338251 | 3300021432 | Soil | IAHYKFTYDATFNGTHRARSVICSDTWISQSGEWKIASNHCSHVEGT |
| Ga0182009_101994811 | 3300021445 | Soil | PNIAVSHYTFTYDAEIRGTHRARTVICSDTWINDSGTWKTATTHCSMVKGK |
| Ga0242654_104018561 | 3300022726 | Soil | VATFGPNTAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ |
| Ga0207699_103439881 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGL |
| Ga0207699_104137421 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ |
| Ga0207699_108298721 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DMATFGPNTAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGT |
| Ga0207684_102678291 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AVSHYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK |
| Ga0207654_111815591 | 3300025911 | Corn Rhizosphere | QVATFGPNVAVSHYTFTYEADLQGKHRARTVLCSDTWVNDSGTWKTASTHCSLVKGK |
| Ga0207671_115954371 | 3300025914 | Corn Rhizosphere | TFGSNTAVSHYTFTYEADFKGTHRARTVICSDTWVNDSGTWKTASTQCTLVKGK |
| Ga0207660_114670131 | 3300025917 | Corn Rhizosphere | TFSGTHRARTVICSDTWVNQSGVWTLVADHCSHVEGT |
| Ga0207694_112638472 | 3300025924 | Corn Rhizosphere | TYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTLVKGT |
| Ga0207650_105723471 | 3300025925 | Switchgrass Rhizosphere | VKVATFGSNTAVSHYTFTYDADFKGTHRARTVICSDTWVNDSGTWKTASTHCTMVKGT |
| Ga0207700_112781611 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IGGTHRARSVICSDTWVNDSGTWKSAATHCSLVQGK |
| Ga0207664_103711243 | 3300025929 | Agricultural Soil | YDATFNGTHRARTVICSDTWLNQSGAWKLVSDHCSHVEGT |
| Ga0207664_107537481 | 3300025929 | Agricultural Soil | DAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ |
| Ga0207664_107591781 | 3300025929 | Agricultural Soil | FTYDADIGGTHRARSVICSDTWVNDSGTWKSAATHCSLVQGK |
| Ga0207664_116018782 | 3300025929 | Agricultural Soil | RFAYDATFSGTHRARTVICSDTWVNQSGTWKIISSHCSHVEGT |
| Ga0207706_108708562 | 3300025933 | Corn Rhizosphere | IAHYKFIYDATFNGTHRARTVICSDTWINQSGAWKLASNHCSHVEGT |
| Ga0207679_112649701 | 3300025945 | Corn Rhizosphere | AAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTAATHCSMVKGV |
| Ga0207679_121427471 | 3300025945 | Corn Rhizosphere | TAVSHYTFTYDADFKGTHRARTVICSDTWLNDSGTWKTASTHCTLVKGM |
| Ga0207712_119115342 | 3300025961 | Switchgrass Rhizosphere | ATFGSNTAVSHYTFTYEAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK |
| Ga0207702_108226952 | 3300026078 | Corn Rhizosphere | HYKFTYDADIGGTHRARSVICSDTWVNDSGTWKSAATHCSLVQGK |
| Ga0209059_11566851 | 3300026527 | Soil | QVATFGSNAAVSHYTFTYDAELRGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK |
| Ga0209118_11927001 | 3300027674 | Forest Soil | NAAVSHYTFTYDAELQGKHRARTVICSDTWVNDSGTWKTASTHCSLVKGQ |
| Ga0307501_102782011 | 3300031152 | Soil | ISHYTFTYEADMNGTHRARTVICSDTWVNDSGTWKTATTHCSMVKGK |
| Ga0307499_100695111 | 3300031184 | Soil | FTYDAELQGKHRARTVICSDTWVNDSTWKTASTHCSLVKGQ |
| Ga0310813_107558941 | 3300031716 | Soil | GANTAVAHYKFIYDADIGGTHRAPSVICSDTWVNDSGTWKSASTHCSLVQGK |
| Ga0307474_105926141 | 3300031718 | Hardwood Forest Soil | GPNAAVSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGQ |
| Ga0307469_104366231 | 3300031720 | Hardwood Forest Soil | SHYTFTYDAELQGTHRARTVICSDTWLNDSGTWKTASTHCSLVKGK |
| Ga0308175_1010718862 | 3300031938 | Soil | KFAYDATFNGTHRARTVICSDTWLNQSGAWKLVSDHCSHVEGT |
| Ga0307471_1014587961 | 3300032180 | Hardwood Forest Soil | VSRYTFTYDAELKGTHRARTVICSDTWVNDSGTWKTASTHCSLVKGK |
| Ga0310810_107151411 | 3300033412 | Soil | VSHYTFTYDAELQGKHRARTVICSDTWLNDSGTWKTASTHCSLVKGT |
| ⦗Top⦘ |