| Basic Information | |
|---|---|
| Family ID | F076546 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 47 residues |
| Representative Sequence | KYAVRATRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPAR |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.22 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.712 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.661 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.983 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.220 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.79% β-sheet: 0.00% Coil/Unstructured: 59.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01568 | Molydop_binding | 6.78 |
| PF08818 | DUF1801 | 5.08 |
| PF00589 | Phage_integrase | 3.39 |
| PF00291 | PALP | 3.39 |
| PF04199 | Cyclase | 2.54 |
| PF03575 | Peptidase_S51 | 2.54 |
| PF13280 | WYL | 1.69 |
| PF00326 | Peptidase_S9 | 1.69 |
| PF02566 | OsmC | 1.69 |
| PF01042 | Ribonuc_L-PSP | 1.69 |
| PF01641 | SelR | 1.69 |
| PF01609 | DDE_Tnp_1 | 0.85 |
| PF04185 | Phosphoesterase | 0.85 |
| PF00392 | GntR | 0.85 |
| PF02839 | CBM_5_12 | 0.85 |
| PF13631 | Cytochrom_B_N_2 | 0.85 |
| PF13560 | HTH_31 | 0.85 |
| PF13751 | DDE_Tnp_1_6 | 0.85 |
| PF00768 | Peptidase_S11 | 0.85 |
| PF08241 | Methyltransf_11 | 0.85 |
| PF05649 | Peptidase_M13_N | 0.85 |
| PF13676 | TIR_2 | 0.85 |
| PF07690 | MFS_1 | 0.85 |
| PF07730 | HisKA_3 | 0.85 |
| PF05960 | DUF885 | 0.85 |
| PF02899 | Phage_int_SAM_1 | 0.85 |
| PF13434 | Lys_Orn_oxgnase | 0.85 |
| PF00011 | HSP20 | 0.85 |
| PF00041 | fn3 | 0.85 |
| PF08922 | DUF1905 | 0.85 |
| PF00805 | Pentapeptide | 0.85 |
| PF04024 | PspC | 0.85 |
| PF01546 | Peptidase_M20 | 0.85 |
| PF04542 | Sigma70_r2 | 0.85 |
| PF05721 | PhyH | 0.85 |
| PF00440 | TetR_N | 0.85 |
| PF12680 | SnoaL_2 | 0.85 |
| PF08281 | Sigma70_r4_2 | 0.85 |
| PF00196 | GerE | 0.85 |
| PF00496 | SBP_bac_5 | 0.85 |
| PF00582 | Usp | 0.85 |
| PF10861 | DUF2784 | 0.85 |
| PF00106 | adh_short | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 5.08 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 5.08 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 5.08 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 2.54 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.69 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.69 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.69 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.85 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.85 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.85 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.85 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.85 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.85 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.85 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.85 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.85 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.85 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.85 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.85 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.85 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.85 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.71 % |
| Unclassified | root | N/A | 37.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004479|Ga0062595_100181824 | Not Available | 1274 | Open in IMG/M |
| 3300005330|Ga0070690_100537104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea jiangxiensis | 880 | Open in IMG/M |
| 3300005332|Ga0066388_107975238 | Not Available | 530 | Open in IMG/M |
| 3300005336|Ga0070680_101269840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 637 | Open in IMG/M |
| 3300005529|Ga0070741_10652930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 933 | Open in IMG/M |
| 3300005533|Ga0070734_10698289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → unclassified Actinomycetales → Actinomycetales bacterium | 577 | Open in IMG/M |
| 3300005568|Ga0066703_10893150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium phytohabitans | 506 | Open in IMG/M |
| 3300005764|Ga0066903_101304987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1356 | Open in IMG/M |
| 3300005764|Ga0066903_102091761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1089 | Open in IMG/M |
| 3300005764|Ga0066903_103681955 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005841|Ga0068863_101593209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 662 | Open in IMG/M |
| 3300006028|Ga0070717_10103473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2421 | Open in IMG/M |
| 3300006163|Ga0070715_10330668 | Not Available | 826 | Open in IMG/M |
| 3300006163|Ga0070715_10335079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300006175|Ga0070712_100067733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2541 | Open in IMG/M |
| 3300006176|Ga0070765_101503625 | Not Available | 634 | Open in IMG/M |
| 3300006806|Ga0079220_10058493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1850 | Open in IMG/M |
| 3300006903|Ga0075426_10364887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 1062 | Open in IMG/M |
| 3300009147|Ga0114129_10113480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 3736 | Open in IMG/M |
| 3300009174|Ga0105241_12399438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 526 | Open in IMG/M |
| 3300009177|Ga0105248_10440416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea jiangxiensis | 1468 | Open in IMG/M |
| 3300009792|Ga0126374_10629931 | Not Available | 796 | Open in IMG/M |
| 3300010043|Ga0126380_11382839 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300010048|Ga0126373_10075167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3063 | Open in IMG/M |
| 3300010048|Ga0126373_10693205 | Not Available | 1076 | Open in IMG/M |
| 3300010048|Ga0126373_11986209 | Not Available | 644 | Open in IMG/M |
| 3300010048|Ga0126373_13062373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus spadix | 521 | Open in IMG/M |
| 3300010358|Ga0126370_10740685 | Not Available | 869 | Open in IMG/M |
| 3300010358|Ga0126370_11508878 | Not Available | 639 | Open in IMG/M |
| 3300010359|Ga0126376_12538601 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010360|Ga0126372_13029685 | Not Available | 521 | Open in IMG/M |
| 3300010361|Ga0126378_10893666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella shirazensis | 995 | Open in IMG/M |
| 3300010371|Ga0134125_12728235 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010376|Ga0126381_102995115 | Not Available | 671 | Open in IMG/M |
| 3300010398|Ga0126383_12591157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300010868|Ga0124844_1132254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 950 | Open in IMG/M |
| 3300011269|Ga0137392_11116556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300011270|Ga0137391_10156456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1986 | Open in IMG/M |
| 3300012199|Ga0137383_10713175 | Not Available | 733 | Open in IMG/M |
| 3300012201|Ga0137365_10981225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300012356|Ga0137371_11046042 | Not Available | 617 | Open in IMG/M |
| 3300012971|Ga0126369_10605251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
| 3300012971|Ga0126369_11925552 | Not Available | 679 | Open in IMG/M |
| 3300014968|Ga0157379_11183332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
| 3300016270|Ga0182036_10439557 | Not Available | 1024 | Open in IMG/M |
| 3300016294|Ga0182041_10722808 | Not Available | 884 | Open in IMG/M |
| 3300016294|Ga0182041_11947830 | Not Available | 546 | Open in IMG/M |
| 3300016319|Ga0182033_10710581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 880 | Open in IMG/M |
| 3300016319|Ga0182033_12218141 | Not Available | 501 | Open in IMG/M |
| 3300016357|Ga0182032_10157411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1688 | Open in IMG/M |
| 3300016387|Ga0182040_11085077 | Not Available | 670 | Open in IMG/M |
| 3300016387|Ga0182040_11437739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
| 3300016422|Ga0182039_11806453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300016445|Ga0182038_10361950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300020581|Ga0210399_10990714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 678 | Open in IMG/M |
| 3300020582|Ga0210395_11390358 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021181|Ga0210388_10358859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1281 | Open in IMG/M |
| 3300021406|Ga0210386_11043963 | Not Available | 696 | Open in IMG/M |
| 3300021475|Ga0210392_10793423 | Not Available | 707 | Open in IMG/M |
| 3300021560|Ga0126371_10803402 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1087 | Open in IMG/M |
| 3300021560|Ga0126371_13356850 | Not Available | 541 | Open in IMG/M |
| 3300025898|Ga0207692_10322065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 946 | Open in IMG/M |
| 3300025898|Ga0207692_10921488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300025903|Ga0207680_11004400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea jiangxiensis | 597 | Open in IMG/M |
| 3300025910|Ga0207684_10715539 | Not Available | 850 | Open in IMG/M |
| 3300025916|Ga0207663_10235370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1340 | Open in IMG/M |
| 3300026078|Ga0207702_10194629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1876 | Open in IMG/M |
| 3300026095|Ga0207676_10678545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea jiangxiensis | 996 | Open in IMG/M |
| 3300027505|Ga0209218_1040760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 923 | Open in IMG/M |
| 3300027882|Ga0209590_10313099 | Not Available | 1009 | Open in IMG/M |
| 3300031544|Ga0318534_10064479 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
| 3300031545|Ga0318541_10348577 | Not Available | 827 | Open in IMG/M |
| 3300031573|Ga0310915_10625317 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031679|Ga0318561_10636603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300031681|Ga0318572_10649077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrithrix → Ferrithrix thermotolerans → Ferrithrix thermotolerans DSM 19514 | 628 | Open in IMG/M |
| 3300031682|Ga0318560_10277887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300031713|Ga0318496_10319512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus spadix | 857 | Open in IMG/M |
| 3300031715|Ga0307476_10110482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1949 | Open in IMG/M |
| 3300031723|Ga0318493_10177999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1114 | Open in IMG/M |
| 3300031723|Ga0318493_10646401 | Not Available | 591 | Open in IMG/M |
| 3300031744|Ga0306918_10471375 | Not Available | 982 | Open in IMG/M |
| 3300031751|Ga0318494_10881594 | Not Available | 525 | Open in IMG/M |
| 3300031754|Ga0307475_11532100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300031764|Ga0318535_10140045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrithrix → Ferrithrix thermotolerans → Ferrithrix thermotolerans DSM 19514 | 1075 | Open in IMG/M |
| 3300031770|Ga0318521_10713586 | Not Available | 609 | Open in IMG/M |
| 3300031770|Ga0318521_10771004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300031778|Ga0318498_10426248 | Not Available | 588 | Open in IMG/M |
| 3300031780|Ga0318508_1106188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 782 | Open in IMG/M |
| 3300031798|Ga0318523_10338397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 750 | Open in IMG/M |
| 3300031819|Ga0318568_10849267 | Not Available | 565 | Open in IMG/M |
| 3300031821|Ga0318567_10352000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 833 | Open in IMG/M |
| 3300031821|Ga0318567_10902064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 501 | Open in IMG/M |
| 3300031879|Ga0306919_11165111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 586 | Open in IMG/M |
| 3300031912|Ga0306921_12067817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300031941|Ga0310912_10257464 | Not Available | 1344 | Open in IMG/M |
| 3300031942|Ga0310916_10598722 | Not Available | 937 | Open in IMG/M |
| 3300031945|Ga0310913_10765455 | Not Available | 682 | Open in IMG/M |
| 3300032001|Ga0306922_10707964 | Not Available | 1059 | Open in IMG/M |
| 3300032001|Ga0306922_12332877 | Not Available | 512 | Open in IMG/M |
| 3300032009|Ga0318563_10758335 | Not Available | 520 | Open in IMG/M |
| 3300032043|Ga0318556_10212516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
| 3300032054|Ga0318570_10482606 | Not Available | 565 | Open in IMG/M |
| 3300032064|Ga0318510_10266360 | Not Available | 707 | Open in IMG/M |
| 3300032065|Ga0318513_10284077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 803 | Open in IMG/M |
| 3300032089|Ga0318525_10172249 | Not Available | 1112 | Open in IMG/M |
| 3300032261|Ga0306920_101552894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
| 3300032783|Ga0335079_11335283 | Not Available | 715 | Open in IMG/M |
| 3300032828|Ga0335080_10104533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3143 | Open in IMG/M |
| 3300032828|Ga0335080_10162938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2466 | Open in IMG/M |
| 3300032828|Ga0335080_10288100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1786 | Open in IMG/M |
| 3300032898|Ga0335072_10682283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1010 | Open in IMG/M |
| 3300032898|Ga0335072_11291466 | Not Available | 640 | Open in IMG/M |
| 3300032898|Ga0335072_11466326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300033134|Ga0335073_11100412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
| 3300033158|Ga0335077_10032564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 6475 | Open in IMG/M |
| 3300033289|Ga0310914_11593237 | Not Available | 557 | Open in IMG/M |
| 3300033290|Ga0318519_10465575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 758 | Open in IMG/M |
| 3300034820|Ga0373959_0111794 | Not Available | 660 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.24% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062595_1001818241 | 3300004479 | Soil | AVRATRQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEENPAPWQPR* |
| Ga0070690_1005371041 | 3300005330 | Switchgrass Rhizosphere | TLGAGGQARDRALAAARNLTVFFPEARVRAVIRAAAEENPAR* |
| Ga0066388_1079752382 | 3300005332 | Tropical Forest Soil | KYAVRATRQLGGEARDRAVAAARNLTVFFPEARVHAVIRAAAEGHPAR* |
| Ga0070680_1012698402 | 3300005336 | Corn Rhizosphere | VRATRQLGGQARDRALAAARNLTVFFPEAKVHAVIRAAAEATPPADRPG* |
| Ga0070741_106529301 | 3300005529 | Surface Soil | RRRAAKYAVRSTLQLGGEARDRALAAARNLTVFFPEERVHAVIRAAADGRISERGHG* |
| Ga0070734_106982892 | 3300005533 | Surface Soil | RAATYAVRATRQLGREARDRALAAARNLTVFYPAARVRAVIRAAAEEAPPSNAR* |
| Ga0066703_108931502 | 3300005568 | Soil | RRRAATYAVRATRQLGGEARDRALAAARNLTVFFPEARVHGVIRAAAEGSD* |
| Ga0066903_1013049873 | 3300005764 | Tropical Forest Soil | KYAVRTTRELGREARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPAR* |
| Ga0066903_1020917611 | 3300005764 | Tropical Forest Soil | YAVRATRQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGNLSH* |
| Ga0066903_1036819551 | 3300005764 | Tropical Forest Soil | RRAAKYAVRATRELGGEARDRALAAARNLTVFFPEGRVHAVIREAAEGNPAR* |
| Ga0068863_1015932091 | 3300005841 | Switchgrass Rhizosphere | YAVRATRQLGGEARDRALAAARNLTVFFPEARVRAVIRAAAEGNPAR* |
| Ga0070717_101034734 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGEARDRALAAARNLTVFFPAARVRALIRAAANSSPDR* |
| Ga0070715_103306682 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRRAAIYAVRATRQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEENPAPWQPR* |
| Ga0070715_103350793 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EARDRALAAARSLTVFFPEGSVHAVIRAAAEGTGPR* |
| Ga0070712_1000677334 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ARDRALAAARNLTVFFPAARVRALIRAAANSSPDR* |
| Ga0070765_1015036251 | 3300006176 | Soil | ATYAVRATRQLGGEARGRALAAARNLTVFFPEGRVHAVIRAAAEQNPAR* |
| Ga0079220_100584931 | 3300006806 | Agricultural Soil | AGGEARDRALAQARNLTVFFPEAKVRALIRAAAKGSPAR* |
| Ga0075426_103648871 | 3300006903 | Populus Rhizosphere | VRATRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAKGTRPADRLG* |
| Ga0114129_101134807 | 3300009147 | Populus Rhizosphere | AAKYAVRATRQLGAGARDRALAAARNLTVFFPEGRVHAVIRAAADGNPAADSLG* |
| Ga0105241_123994382 | 3300009174 | Corn Rhizosphere | RRAAIYAVRATLGDGGEARDRALAAARNLTVFFPEARVRAVIRAAAEENPAR* |
| Ga0105248_104404164 | 3300009177 | Switchgrass Rhizosphere | YAVRATLGAGGQARDRALAAARNLTVFFPEARVRAVIRAAAEENPAR* |
| Ga0126374_106299311 | 3300009792 | Tropical Forest Soil | KYAVRATRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPAR* |
| Ga0126380_113828391 | 3300010043 | Tropical Forest Soil | RATRQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGNPAR* |
| Ga0126373_100751671 | 3300010048 | Tropical Forest Soil | QLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPAR* |
| Ga0126373_106932051 | 3300010048 | Tropical Forest Soil | RAAKYAVRTTRELGGEARERALAAARNLTVFFPEGRVHAVIRAAAEGNPAR* |
| Ga0126373_119862092 | 3300010048 | Tropical Forest Soil | RATRRLGGEARDRALAAASNLTVFFPEARVHAVIRAAAEENPAP* |
| Ga0126373_130623732 | 3300010048 | Tropical Forest Soil | RQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGNPAR* |
| Ga0126370_107406851 | 3300010358 | Tropical Forest Soil | LGGEARDRALAAARNLTVFFPEGRVHAVIKAAAEGNPAADPRGQPYT* |
| Ga0126370_115088782 | 3300010358 | Tropical Forest Soil | VRRRAAKYAVRATRQLDSAARDRALATARNLTVFFPEAWVNAAIRAAAEGTLPSDSLG* |
| Ga0126376_125386012 | 3300010359 | Tropical Forest Soil | RRAAIYAVRSTRQLGGPARDRAVAAARDLTVFFPEARVHAVIRAAAEGTRPAGSRG* |
| Ga0126372_130296851 | 3300010360 | Tropical Forest Soil | TYAVRATRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPAR* |
| Ga0126378_108936662 | 3300010361 | Tropical Forest Soil | DPAARDRALAAARNLTVFFPEATVNAVIRAAAEGTRSTDSFG* |
| Ga0134125_127282351 | 3300010371 | Terrestrial Soil | RLGGEARERALAAARNLTVFYPEATVNALIRAAAEGTSPAGRPG* |
| Ga0126381_1029951151 | 3300010376 | Tropical Forest Soil | RRAAKYAVRATRQLDGEARDRALAAARNLTVFFPEARVHAVIRAAAEGTRPASSLG* |
| Ga0126383_125911571 | 3300010398 | Tropical Forest Soil | RRRAAKYAVRATRQLGGEARGRALAAARNLTVFFPEARVHAVIRGAAEGNPAR* |
| Ga0124844_11322541 | 3300010868 | Tropical Forest Soil | VRRRAAVYAVRATRQLGGQARDRALAAARNLTVFFPEARVRAVIRAAAEGNPAR* |
| Ga0137392_111165561 | 3300011269 | Vadose Zone Soil | LGGEARGRALAAARNLTVFFPEGRVHAVIRAAAEGNPAR* |
| Ga0137391_101564562 | 3300011270 | Vadose Zone Soil | AATYAGRATLRLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGNTAR* |
| Ga0137383_107131752 | 3300012199 | Vadose Zone Soil | ATRQLGGEARDRAVAAARNLTVFFPEGRVHAVIRAAAEGNPAR* |
| Ga0137365_109812252 | 3300012201 | Vadose Zone Soil | GGEARDRALAAARNLTVFFPEARVHAVIRAAAEGNPAR* |
| Ga0137371_110460421 | 3300012356 | Vadose Zone Soil | YAVRATRQLGGEARDRALAAARNLTVFFPEGKVHAVIRAAAEGDPAR* |
| Ga0126369_106052511 | 3300012971 | Tropical Forest Soil | LGGEARGRALAAARNLTVFFPEGRVHAVIRAAAEGNSAR* |
| Ga0126369_119255522 | 3300012971 | Tropical Forest Soil | REARDRALAAARNLTVFFPEGRVHAVIKAAAEGNPAADRRGQPYT* |
| Ga0157379_111833322 | 3300014968 | Switchgrass Rhizosphere | AAIYAVRSTVGAGGEARDRALAQARNLTVFFPEAKVRALIRAAAKGSPAR* |
| Ga0182036_104395572 | 3300016270 | Soil | AATYAVRATRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPPADSLG |
| Ga0182041_107228082 | 3300016294 | Soil | GGEARDRALAAARNLTVFFPEARVHAVIRAAAEGTRPPDSLG |
| Ga0182041_119478301 | 3300016294 | Soil | QLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPPP |
| Ga0182033_107105812 | 3300016319 | Soil | AATYAVRATRELGGEARDRALAAARNLTVFFPEGRVHAIIRAAAEGNQPAGS |
| Ga0182033_122181411 | 3300016319 | Soil | VRATRQLGGEARDRALAAARNLTVFFPEARVRAVIRAAAEGNPSR |
| Ga0182032_101574112 | 3300016357 | Soil | ARDRALAAARNLTVFFPEGRVHAIIRAAAEGNRHAGC |
| Ga0182040_110850771 | 3300016387 | Soil | LGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGTRPSDSLG |
| Ga0182040_114377391 | 3300016387 | Soil | RRRAATYAVRATRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPAKAE |
| Ga0182039_118064532 | 3300016422 | Soil | QLGGEARDRALAAARNLTVFSPEGRVHAVIRAAAEGTSPADSLG |
| Ga0182038_103619503 | 3300016445 | Soil | RQLGGEARDRALAAARNLTVFSPEGRVHAVIRAAAEGTSPADSLG |
| Ga0210399_109907142 | 3300020581 | Soil | VRATRQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGTWPADSLG |
| Ga0210395_113903581 | 3300020582 | Soil | RRAVKYAVRVTRQLGGEARDRALAAARNLTVFFPEGKVHAVIRAAAEGTRAADSRR |
| Ga0210388_103588592 | 3300021181 | Soil | RAATYAVRSTRQAGSDARQRALAAARNLTVFFPEARVHAVIRAAAEGTRPADSLG |
| Ga0210386_110439631 | 3300021406 | Soil | VRSTRQASSEARDRALAAAKNLTVFFPEGRVHAVIRAAAEGTRPADSLG |
| Ga0210392_107934232 | 3300021475 | Soil | RRRAAIYAVRATRQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGTR |
| Ga0126371_108034021 | 3300021560 | Tropical Forest Soil | RRAAKYAVRATRQLGGEARDRALAAARNLTVFFPERRVQAVISAAAEGNPAR |
| Ga0126371_133568502 | 3300021560 | Tropical Forest Soil | QLGGEARDRALAAARNLTVFFPEATVHAVIRAAAEGTRPAGSLG |
| Ga0207692_103220651 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GVRRRAAKYAVRATRQLGAEARDRALAAARSLTVFFPEGSVHAVIRAAAEGTGPR |
| Ga0207692_109214882 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VRATRQLDGEARDRALAAARNLTVFFPEARVRAVIRAAAEGNPAR |
| Ga0207680_110044001 | 3300025903 | Switchgrass Rhizosphere | AAVYAVRATLGDGGQARDRALAAARNLTVFFPEARVRAVIRAAAEENPAR |
| Ga0207684_107155392 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AVRATRPLGGEARDRAVAAARNLTVFFPEGKVHAVIRAAAEGDPAR |
| Ga0207663_102353703 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AAIYAVRSTLQAGREARDRALAQARNLTVFFPEAKVRALIRAAAEGSPAADSHG |
| Ga0207702_101946294 | 3300026078 | Corn Rhizosphere | VGAGGEARDRALAQARNLTVFFPEAKVRALIRAAAKGSPAQL |
| Ga0207676_106785451 | 3300026095 | Switchgrass Rhizosphere | AIYAVRATLGAGGQARDRALAAARNLTVFFPEARVRAVIRAAAEENPAR |
| Ga0209218_10407601 | 3300027505 | Forest Soil | RSTRELGGEARDRALAAARNLTVFFPEGMVHAVIRAAAEETQPADSRG |
| Ga0209590_103130992 | 3300027882 | Vadose Zone Soil | GEARDRALAAARNLTVFFPEGRVHAAIRAAAEGNPPR |
| Ga0318534_100644794 | 3300031544 | Soil | ATYAVRATRQLGGEARDRALAAARNLTVFSPEGRVHAVIRAAAEGTSPADSLG |
| Ga0318541_103485771 | 3300031545 | Soil | TYAVRATRQLGGEARDRALAAARNLTVFSPEGRVHAVIRAAAEGTSPADSLG |
| Ga0310915_106253171 | 3300031573 | Soil | RAAKYAVRATRGLGGEARDRAVAAARNLTVFFPEGRVHAVIRAAAEGNSAR |
| Ga0318561_106366032 | 3300031679 | Soil | TYAVRATRQLGGEARDRALAAARNLTVFSPEGRVHAVIRAAAEGASPADSLG |
| Ga0318572_106490772 | 3300031681 | Soil | AKYAVRATRGLGGEARDRAVAAARNLTVFFPEGRVHAVIRAAAEGNPAR |
| Ga0318560_102778871 | 3300031682 | Soil | YAVRVTRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEEDPAR |
| Ga0318496_103195121 | 3300031713 | Soil | GVRRRAATYAVRATRQLGGEARDRALAAARNLTVYFPEGRVRAVIRAAAEGNPAP |
| Ga0307476_101104823 | 3300031715 | Hardwood Forest Soil | RRAAIYAVRATRQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGNSAR |
| Ga0318493_101779991 | 3300031723 | Soil | AKYAVRATRQLGGEARDRALAAARNLTVFFPEGRVHAIIRAAAEGNQPAGS |
| Ga0318493_106464011 | 3300031723 | Soil | YAVRATRQLGREARDRALAAARNLTVFFPEGKVHAVIRAAAEGNPAR |
| Ga0306918_104713752 | 3300031744 | Soil | AVRATRELGGEARGRALAAARNLTVFFPEGRVHAVIRAAAEGNPAR |
| Ga0318494_108815941 | 3300031751 | Soil | LGGEARDRALAAARNLTVFFPEGMVHAVIRAAAEGNPAR |
| Ga0307475_115321002 | 3300031754 | Hardwood Forest Soil | TRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPPR |
| Ga0318535_101400452 | 3300031764 | Soil | GLGGEARDRAVAAARNLTVFFPEGRVHAVIRAAAEGNPAR |
| Ga0318521_107135861 | 3300031770 | Soil | LQLGGEARGRALAAARTLTVFFPEGTVHAVIRAAAEGDPAR |
| Ga0318521_107710041 | 3300031770 | Soil | RQLGGEARDRALAAARNLTVFFPEERVHAVIRAAAEGNPAR |
| Ga0318498_104262481 | 3300031778 | Soil | AVRATRQLGREARDRALAAARNLTVFFPEGKVHAVIRAAAEGNPAR |
| Ga0318508_11061882 | 3300031780 | Soil | YAVRATHQLRGEARDRALAAARNLTVFFPEGRVHAIIRAAAEGNRHAGC |
| Ga0318523_103383972 | 3300031798 | Soil | ATHQLRGEARDRALAAARNLTVFFPEGRVHAIIRAAAEGNRHAGC |
| Ga0318568_108492672 | 3300031819 | Soil | TYAVRATRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPPP |
| Ga0318567_103520001 | 3300031821 | Soil | LGGEARDRALAAARNLTVFFPEGKVRAVIRAAAEGNPAR |
| Ga0318567_109020642 | 3300031821 | Soil | VRRRAATYAVRATRELGGEARGRALAAARNLTVFFPEGRVHAVIRAAAEGNPAC |
| Ga0306919_111651111 | 3300031879 | Soil | RRAATYAVRATRELGGEARGRALAAARNLTVFFPEGRVHAVIRAAAEGNPAC |
| Ga0306921_120678172 | 3300031912 | Soil | AVRTTRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPAR |
| Ga0310912_102574643 | 3300031941 | Soil | RATRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPPP |
| Ga0310916_105987222 | 3300031942 | Soil | YAVRATRELGGEARGRALAAARNLTVFFPEGRVHAVIREAAEGKLPR |
| Ga0310913_107654552 | 3300031945 | Soil | KYAVRATHQLRGEARDRALAAARNLTVFFPEGRVHAIIRAAAEGNQPAGS |
| Ga0306922_107079641 | 3300032001 | Soil | AVRATRELGGEARGRALAAARNLTVFFPEGRVHAVIRAAAEGNPAC |
| Ga0306922_123328771 | 3300032001 | Soil | ATRELGGEARGRALAAARNLTVFFPEGRVHAVIREAAEGKLPR |
| Ga0318563_107583351 | 3300032009 | Soil | QLGGEARDRALAAARNLTVFFPEGRVHAIIRAAAEGNRHAGC |
| Ga0318556_102125161 | 3300032043 | Soil | ARDRALAAARNLTVYFPEGRVHAVIRAAAEGNPAR |
| Ga0318570_104826062 | 3300032054 | Soil | TRQLGGEARDRALAAARNLTVFFPEGRVHAVIRAAAEGNPPP |
| Ga0318510_102663601 | 3300032064 | Soil | AIYAVRATRQLGGEARDRALAAARNLTVFFPERRVHAVIKTAAEGTLPAAGHW |
| Ga0318513_102840773 | 3300032065 | Soil | TRQLGGEARDRALAAARNLTVFFPERRVHAVIKTAAEGTLPAAGHW |
| Ga0318525_101722492 | 3300032089 | Soil | VRRRAATYAVRATRQLGGEARDRALAAARNLTVFSPEGRVHAVIRAAAEGASPADSLG |
| Ga0306920_1015528941 | 3300032261 | Soil | AVRATRQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGTRPPDSLG |
| Ga0335079_113352831 | 3300032783 | Soil | ATRQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGNPAADSLG |
| Ga0335080_101045331 | 3300032828 | Soil | EARDRALAAARNLTVFFPEAGVHAVIRAAAEGNPAR |
| Ga0335080_101629381 | 3300032828 | Soil | RQLGGEARDRALAAARNLTVFFPEARVHAVIRAAAEGNPAR |
| Ga0335080_102881001 | 3300032828 | Soil | QLGGGARDRALAAARNLTVFFPEARVHAVIRAAAEGNPAR |
| Ga0335072_106822831 | 3300032898 | Soil | RRAAIYAVRSTRHLGGEARDRALAAARNLTVFFPEARIHAVIRAAAEGNSAR |
| Ga0335072_112914661 | 3300032898 | Soil | AAIYAVRATRQLGGEARDRALAAARNLTVFFPEARVHAIIRAAAEENPAR |
| Ga0335072_114663261 | 3300032898 | Soil | AAIYAVRATRQLDRTARDRALAAARNLTVFFPERKVRAVIRAAGEGSPRTG |
| Ga0335073_111004122 | 3300033134 | Soil | YAVRATRQLGSEARDRALATARNLTVFFPEGRVHALIRAAAEETRAADGPG |
| Ga0335077_100325641 | 3300033158 | Soil | RAAVYAVRATRQLGGGARDRALAAARNLTVFFPEARVHAVIRAAAEGNPAR |
| Ga0310914_115932371 | 3300033289 | Soil | AVRATRDLGGEARERALAAARNLTVFFPEGRVHAVIRAAAEGNPAS |
| Ga0318519_104655751 | 3300033290 | Soil | HQLRGEARDRALAAARNLTVFFPEGRVHAIIRAAAEGNRHAGC |
| Ga0373959_0111794_513_659 | 3300034820 | Rhizosphere Soil | RATRQLGGQARDRALAAARNLTVFFPEAKVNAVIRAAAEATPPTDRPG |
| ⦗Top⦘ |