Basic Information | |
---|---|
Family ID | F076540 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 118 |
Average Sequence Length | 42 residues |
Representative Sequence | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAG |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 118 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 61.02 % |
% of genes near scaffold ends (potentially truncated) | 99.15 % |
% of genes from short scaffolds (< 2000 bps) | 89.83 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.153 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.746 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.356 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (35.593 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 118 Family Scaffolds |
---|---|---|
PF03544 | TonB_C | 72.88 |
PF02472 | ExbD | 15.25 |
PF01618 | MotA_ExbB | 1.69 |
PF13358 | DDE_3 | 0.85 |
COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
---|---|---|---|
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 72.88 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 15.25 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.15 % |
Unclassified | root | N/A | 0.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001661|JGI12053J15887_10092792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1644 | Open in IMG/M |
3300005337|Ga0070682_101498444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300005526|Ga0073909_10237241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
3300005529|Ga0070741_10133871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2528 | Open in IMG/M |
3300005563|Ga0068855_100398849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1508 | Open in IMG/M |
3300005614|Ga0068856_102432900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300005994|Ga0066789_10282888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
3300006163|Ga0070715_10570303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
3300006358|Ga0068871_100141161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2048 | Open in IMG/M |
3300006893|Ga0073928_10967300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
3300009177|Ga0105248_12786909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
3300010047|Ga0126382_12163111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
3300010048|Ga0126373_12248869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
3300010366|Ga0126379_13055802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
3300010375|Ga0105239_10317592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1756 | Open in IMG/M |
3300012388|Ga0134031_1247091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 828 | Open in IMG/M |
3300012923|Ga0137359_10154239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2048 | Open in IMG/M |
3300012927|Ga0137416_10557094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 994 | Open in IMG/M |
3300012929|Ga0137404_10546465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1037 | Open in IMG/M |
3300012929|Ga0137404_10817714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
3300012931|Ga0153915_10215056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2115 | Open in IMG/M |
3300012957|Ga0164303_10030015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2218 | Open in IMG/M |
3300012971|Ga0126369_12393663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
3300013105|Ga0157369_10202208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2085 | Open in IMG/M |
3300013297|Ga0157378_12347286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
3300014325|Ga0163163_10577411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
3300014501|Ga0182024_12649965 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300015242|Ga0137412_10061594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3054 | Open in IMG/M |
3300015242|Ga0137412_10139683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1958 | Open in IMG/M |
3300015242|Ga0137412_10212825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1540 | Open in IMG/M |
3300016270|Ga0182036_11327513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
3300017970|Ga0187783_10583319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
3300017975|Ga0187782_10859302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
3300019487|Ga0187893_10234377 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300020580|Ga0210403_10793863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
3300020580|Ga0210403_11488405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300020583|Ga0210401_11618017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
3300021088|Ga0210404_10122700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1336 | Open in IMG/M |
3300021180|Ga0210396_11117987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
3300021362|Ga0213882_10437017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
3300021407|Ga0210383_11666635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
3300021432|Ga0210384_11028595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
3300021439|Ga0213879_10125095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
3300021474|Ga0210390_11049747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
3300021479|Ga0210410_10075013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2967 | Open in IMG/M |
3300021560|Ga0126371_13858473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
3300021953|Ga0213880_10084715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
3300022878|Ga0247761_1124433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
3300024123|Ga0228600_1016645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
3300025898|Ga0207692_11156711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300025912|Ga0207707_11394697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
3300025913|Ga0207695_10310655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1466 | Open in IMG/M |
3300025913|Ga0207695_11372360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
3300025914|Ga0207671_10610095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
3300025921|Ga0207652_10460072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1147 | Open in IMG/M |
3300025929|Ga0207664_10026898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 4354 | Open in IMG/M |
3300025945|Ga0207679_11831795 | Not Available | 554 | Open in IMG/M |
3300026078|Ga0207702_10110928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2439 | Open in IMG/M |
3300026305|Ga0209688_1046959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
3300027313|Ga0207780_1078049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
3300027669|Ga0208981_1171979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
3300027671|Ga0209588_1093732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 967 | Open in IMG/M |
3300027842|Ga0209580_10482355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300027869|Ga0209579_10272400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 911 | Open in IMG/M |
3300027884|Ga0209275_10161920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1191 | Open in IMG/M |
3300028380|Ga0268265_11292485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
3300028381|Ga0268264_11727622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300028801|Ga0302226_10361116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300028879|Ga0302229_10496836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
3300029951|Ga0311371_10912719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
3300029999|Ga0311339_11834415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
3300030743|Ga0265461_13061346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
3300030967|Ga0075399_11254535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
3300031544|Ga0318534_10162037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 1292 | Open in IMG/M |
3300031549|Ga0318571_10253126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
3300031679|Ga0318561_10525829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
3300031708|Ga0310686_118171633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
3300031718|Ga0307474_10024344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 4418 | Open in IMG/M |
3300031718|Ga0307474_11467618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
3300031724|Ga0318500_10716941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300031764|Ga0318535_10540909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
3300031765|Ga0318554_10108998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1559 | Open in IMG/M |
3300031765|Ga0318554_10446758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
3300031777|Ga0318543_10409400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
3300031782|Ga0318552_10659881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
3300031793|Ga0318548_10095173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1421 | Open in IMG/M |
3300031793|Ga0318548_10407584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
3300031793|Ga0318548_10553031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
3300031805|Ga0318497_10873279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
3300031823|Ga0307478_10246388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 1451 | Open in IMG/M |
3300031845|Ga0318511_10432980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
3300031859|Ga0318527_10472849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300031880|Ga0318544_10260102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300031880|Ga0318544_10416458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300031894|Ga0318522_10278491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300031896|Ga0318551_10047612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2151 | Open in IMG/M |
3300031910|Ga0306923_11723593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
3300031912|Ga0306921_11730201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
3300031942|Ga0310916_10361026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 1234 | Open in IMG/M |
3300031942|Ga0310916_10653038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
3300031945|Ga0310913_10171620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1507 | Open in IMG/M |
3300031945|Ga0310913_10895421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
3300031954|Ga0306926_10455234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1576 | Open in IMG/M |
3300032001|Ga0306922_12396345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
3300032025|Ga0318507_10235371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
3300032041|Ga0318549_10354465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
3300032042|Ga0318545_10030564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1763 | Open in IMG/M |
3300032089|Ga0318525_10400881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
3300032094|Ga0318540_10462367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300032261|Ga0306920_101000206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1218 | Open in IMG/M |
3300032261|Ga0306920_104404779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
3300032783|Ga0335079_10283423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1812 | Open in IMG/M |
3300032828|Ga0335080_11467749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
3300032893|Ga0335069_10656728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1197 | Open in IMG/M |
3300032955|Ga0335076_10407983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 1243 | Open in IMG/M |
3300032955|Ga0335076_10521393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
3300033289|Ga0310914_10741105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 879 | Open in IMG/M |
3300033289|Ga0310914_10927354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.75% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.24% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.24% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.39% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.39% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.54% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.54% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.69% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.85% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.85% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.85% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
3300022878 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L111-311C-4 | Environmental | Open in IMG/M |
3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12053J15887_100927921 | 3300001661 | Forest Soil | MNLKSEIEYFTEMRLLDKARLLNMFLHELSQEARGTYG |
Ga0070682_1014984442 | 3300005337 | Corn Rhizosphere | MNLKSEIEYFTEMRLLDKARLLNLFLHELSEEARGTYGPTVEEVHDT |
Ga0073909_102372412 | 3300005526 | Surface Soil | MNLNSEIAFYSDLRLVDKARLLNLFLHELAEEARGTYGAGEQVHDGAHLR |
Ga0070741_101338715 | 3300005529 | Surface Soil | MNLNSEIEYFTEMRLVDKARLLNLFLHELAEEARGTYGPSMD |
Ga0068855_1003988491 | 3300005563 | Corn Rhizosphere | MNLRSEIEFYTELRLLDKARLLNLFLHELAEEARGTYGPGMEQVHDTAH |
Ga0068856_1024329001 | 3300005614 | Corn Rhizosphere | MNLKSEIEYFTEMRLLDKARLLNLFLHELAEEARGTYGPASDEVHDTAHLRF |
Ga0066789_102828881 | 3300005994 | Soil | VNLESEIQYFTELAYIDKARLLNLLLHELAEAARAT |
Ga0070715_105703031 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLNSEIAFYQELRPVDKARLLNLFLHELAQEARGTYGAGEQVHDGVHLR |
Ga0068871_1001411611 | 3300006358 | Miscanthus Rhizosphere | MNLKSEIEYFTEMRLLDKARLLNLFLHELSQEARGTYGP |
Ga0073928_109673002 | 3300006893 | Iron-Sulfur Acid Spring | VNLKSEIEYFSEMRLLDKARLLNLFLHELSEEARGT |
Ga0105248_127869092 | 3300009177 | Switchgrass Rhizosphere | VNLQSEIEYFAELAMLDKARLLNSFLHELAQEFRLTYGPGTE |
Ga0126382_121631111 | 3300010047 | Tropical Forest Soil | VNLQSEIEYFAELAMLDKARLLNSFLHELAQEARST |
Ga0126373_122488692 | 3300010048 | Tropical Forest Soil | MNLKSEIEYFSELRLIDKARLLNLFLHELAEEARGTYGP |
Ga0126379_130558022 | 3300010366 | Tropical Forest Soil | MNLNSEIAFYSELRPVDKARLLNLFLHELAEEARGTYGAG |
Ga0105239_103175923 | 3300010375 | Corn Rhizosphere | MNLNSEISFFSELRLLDKARLLNLLLHELADEARSTYGPGS |
Ga0134031_12470912 | 3300012388 | Grasslands Soil | MNLASEIEFYSELRLLDKARLLNLFMHELAQEARG |
Ga0137359_101542391 | 3300012923 | Vadose Zone Soil | MNLNSEIEFFAELRIVDKARLLNLFLHELAEEARGTYGPAEQVHDGAHLR |
Ga0137416_105570942 | 3300012927 | Vadose Zone Soil | MNLRSEIDFYSELRLLDKARLLNLFLHELAEEARGTYGPGVD |
Ga0137404_105464652 | 3300012929 | Vadose Zone Soil | MNLRSEIDFYSELQLIDKARLLNLFLHELAEEARATY |
Ga0137404_108177142 | 3300012929 | Vadose Zone Soil | MNLKSEIEYFTEMRLLDKARLLNLFLHELAEEARGTYGPTVEEVH |
Ga0153915_102150564 | 3300012931 | Freshwater Wetlands | MNLKSEIEYFTEMRLLDKARLLNLFLHELSEEARGTYGPAIEDVHDT |
Ga0164303_100300154 | 3300012957 | Soil | MNLNSEIQFYAELRLVDKARLLNLFLHELAEEARGTYGPGTEQVHD |
Ga0126369_123936631 | 3300012971 | Tropical Forest Soil | VNLQSEIEYFQELALLDKARLLNMFLHELAVEARTTYGPG |
Ga0157369_102022084 | 3300013105 | Corn Rhizosphere | MNLKSEIEYFTEMRLLDKARLLNLFLHELSEEARGTYGPTVE |
Ga0157378_123472862 | 3300013297 | Miscanthus Rhizosphere | MNLRSEIEFYSELRLLDKARLLNLFLHELAEEARGTYGP |
Ga0163163_105774111 | 3300014325 | Switchgrass Rhizosphere | VNLKSEIEYFTEMRLLDKARLLNLFLHELSEEARGTYGP |
Ga0182024_126499652 | 3300014501 | Permafrost | MNLRSEIEFYSELRLLDKARLLNLFLHELAEEARGTYGPGMDQVHDTA |
Ga0137412_100615941 | 3300015242 | Vadose Zone Soil | MNLKSEIEYFTEMRLLDKARLLNLFLHELSEEARGTYGPTV |
Ga0137412_101396835 | 3300015242 | Vadose Zone Soil | VNLKSEIEYFTEMRLLDKARLLNLFLHELSEEARGTYGPTVEEVHDTAHLR |
Ga0137412_102128251 | 3300015242 | Vadose Zone Soil | MNLKSEIEYFTEMRLLDKARLLNLFLHELAEEARGTYGPTVEEV |
Ga0182036_113275131 | 3300016270 | Soil | MNLNSEIAFYAELRPVDKARLLNLFLHELAEEARGTYGAGEQVHDGVHLRFVN |
Ga0187783_105833192 | 3300017970 | Tropical Peatland | MNLNSEIQFFMDLRMVDKARLLNLFLHELAEEARG |
Ga0187782_108593021 | 3300017975 | Tropical Peatland | MNLNSEIAFYAELRLVDKARLLNLFLHELADEARAT |
Ga0187893_102343773 | 3300019487 | Microbial Mat On Rocks | MNVQSEIEYFGELTMIDKARFLTLLVHELAEEAKATYGPGAEQVTDAAHLRFINELQ |
Ga0210403_107938632 | 3300020580 | Soil | MNLRSEIEFYSELRLLDKARLLNLFLHEIAEEARGTYGP |
Ga0210403_114884052 | 3300020580 | Soil | MNLNSEIQFYAELRLVDKARLLNLFLHELAEEARGTYG |
Ga0210401_116180172 | 3300020583 | Soil | MNLNSEIQFYAELRLVDKARLLNLFLHELAEEGRATYGPGAEQVHD |
Ga0210404_101227003 | 3300021088 | Soil | MNLNSEIEFFGELRSVDKARLLNLFLHELAEEARGTYGPGA |
Ga0210396_111179871 | 3300021180 | Soil | MNLNSEIQFYAELRLVDKARLLNLFLHELAEEARGT |
Ga0213882_104370171 | 3300021362 | Exposed Rock | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGEQVHDG |
Ga0210383_116666352 | 3300021407 | Soil | VNLRSEIDFFSELRLIDKARLLNLILHELAEEARGTYGPG |
Ga0210384_110285952 | 3300021432 | Soil | MNLNSEIQFYAELRLVDKARLLNLFLHELAEEGRATYGPGAEQV |
Ga0213879_101250952 | 3300021439 | Bulk Soil | VNLNSEIAFYSDLRLVDKARLLNLFLHELAEEARGTYG |
Ga0210390_110497471 | 3300021474 | Soil | MNLRSEIDYFTELRLLDKARLLNLFLHELADEARGTYGPSAEEVHD |
Ga0210410_100750135 | 3300021479 | Soil | MNLRSEIEFYSELRLLDKARLLNLFLHELAEEARGTYGPGMEQVHDA |
Ga0126371_138584732 | 3300021560 | Tropical Forest Soil | MNLNSEIAFYAELRTVDKARLLNLFLHELAEEARG |
Ga0213880_100847152 | 3300021953 | Exposed Rock | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGDQVHDGVHL |
Ga0247761_11244331 | 3300022878 | Plant Litter | VNLQSEIEYFAELAVLDKARLLNSFLHELAQEART |
Ga0228600_10166452 | 3300024123 | Roots | MNLRSEIEFYSELRLLDKARLLNLFLHEIAEEARGTYG |
Ga0207692_111567111 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLNSEIQFYAELRLVDKARLLNLFLHELAEEARGTYGPGTEQVHDG |
Ga0207707_113946971 | 3300025912 | Corn Rhizosphere | MNLNSEIDFFSELRLLDKARLLNLFLHELAEEARST |
Ga0207695_103106551 | 3300025913 | Corn Rhizosphere | MNLRSEIEFFSELRLLDKARLLNLFLHELAEEARGTYGPGVDQ |
Ga0207695_113723602 | 3300025913 | Corn Rhizosphere | MNLNSEIAFYSELRLLDKARLLNLFLHELAEEARSTYGPGTDQVHD |
Ga0207671_106100951 | 3300025914 | Corn Rhizosphere | MNLNSEIDFFSELRLLDKARLLNLFLHELAEEARS |
Ga0207652_104600721 | 3300025921 | Corn Rhizosphere | MNLNSEIEFYAELRLLDKARLLNLFLHELAEEGRAT |
Ga0207664_100268987 | 3300025929 | Agricultural Soil | MNLNSEIAFYQELRPVDKARLLNLFLHELAQEARGTYGAGEQ |
Ga0207679_118317952 | 3300025945 | Corn Rhizosphere | MNLNSEIDFFSELRLLDKARLLNLFLHELAEEARSTY |
Ga0207702_101109281 | 3300026078 | Corn Rhizosphere | MNLNSEIAFYQELRPVDKARLLNLFLHELAQEARGTYGAGEQVHDGVH |
Ga0209688_10469591 | 3300026305 | Soil | MNLASEIEFYSELRLLDKARLLNLFMHELAQEARGTYGAGADQVRAVVHL |
Ga0207780_10780491 | 3300027313 | Tropical Forest Soil | MNLNSEIAFYAELRLFDKARLLNLFLHELAEEARGTYGAGDQVHDGAHL |
Ga0208981_11719792 | 3300027669 | Forest Soil | MNLNSEIEFYAELRLLDKARLLNLFLHELAEEARGTYGAD |
Ga0209588_10937321 | 3300027671 | Vadose Zone Soil | MNLNSEIEFYAELRLLDKARLLNLFLHELAEEARG |
Ga0209580_104823552 | 3300027842 | Surface Soil | MNLNSEIEFFGDLRTVDKARLLNLFLHELAEEARGTYGPGVE |
Ga0209579_102724001 | 3300027869 | Surface Soil | MNLNSEIEFFGDLRTVDKARLLNLFLHELAEEARGTYGP |
Ga0209275_101619203 | 3300027884 | Soil | MNLRSEIEFYSELRLLDKARLLNLFLHEIAEEARGTYGPG |
Ga0268265_112924852 | 3300028380 | Switchgrass Rhizosphere | VNLQSEIEYFAELAVLDKARLLNSFLHELAQEARTT |
Ga0268264_117276222 | 3300028381 | Switchgrass Rhizosphere | VNLQSEIQYFQELTLLDKARLLNMFLHELAVEARTTYGP |
Ga0302226_103611162 | 3300028801 | Palsa | VNIDSEIQYFTELAYIDKARLLNLFLHELAEAARATYGPAADQVH |
Ga0302229_104968361 | 3300028879 | Palsa | VNIESEIQYFTELAYIDKARLLNLFLHELAEAARATYGPTADQ |
Ga0311371_109127192 | 3300029951 | Palsa | MNLDSEILYFSELAYIDKARLLNLFLHELAETARSTYGAAADQVHDALHLRFANELAH |
Ga0311339_118344152 | 3300029999 | Palsa | MNLDSEILYFSELAYIDKARLLNLFLHELAETARSTYGAAADQVHDALHLRFANE |
Ga0265461_130613462 | 3300030743 | Soil | MNLRSEIEFYSELRLLDKARLLNLFLHEIAEEARGTYGPGNGEVHDAA |
Ga0075399_112545352 | 3300030967 | Soil | VNLRSEIDFFSELRLVDKARLLNLILHELAEEARGTYGP |
Ga0318534_101620371 | 3300031544 | Soil | MNMQSEIDYFTELRLIDKARLLNLFLHELAQEARSTYGPGSEQV |
Ga0318571_102531262 | 3300031549 | Soil | MNINSEIAFYSELRPVDKARLLNLFLHELAEEARGTYGAGEQVHDGAHL |
Ga0318561_105258291 | 3300031679 | Soil | MNLNSEIAFYSDLRLVDKARLLNLFLHELAEEARGTYGAG |
Ga0310686_1181716332 | 3300031708 | Soil | MNLNSEIQFFVELRLVDKARLLNLFLHELAEEARAT |
Ga0307474_100243447 | 3300031718 | Hardwood Forest Soil | MNLNSEIAFYSELRPVDKARLLNLFLHELAEEARG |
Ga0307474_114676182 | 3300031718 | Hardwood Forest Soil | MNLNSEIEFYSDLRVVDKARLLNLFLHELAEEARGTYGPGV |
Ga0318500_107169412 | 3300031724 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGEQVHDGAHL |
Ga0318535_105409091 | 3300031764 | Soil | MNLNSEIAFYSELRPVDKARLLNLFLHELAQEARGTYGAGDQVHD |
Ga0318554_101089981 | 3300031765 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGEQVHDGMH |
Ga0318554_104467582 | 3300031765 | Soil | MNLNSEIAFYSDLRLVDKARLLNLFLHELAEEARGTYGAGEQVHD |
Ga0318543_104094002 | 3300031777 | Soil | MNLQSEIEYFSEMRLIDKARLLNKFLHELADEARST |
Ga0318552_106598811 | 3300031782 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAG |
Ga0318548_100951733 | 3300031793 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGEQVHDGMHL |
Ga0318548_104075841 | 3300031793 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGEQ |
Ga0318548_105530311 | 3300031793 | Soil | MNLNSEIAFYAELRTVDKARLLNLFLHELAEEARGTYG |
Ga0318497_108732791 | 3300031805 | Soil | MNLNSEIAFYAELRTVDKARLLNLFLHELAEEARGTYGPGSAEVHDALHLRF |
Ga0307478_102463881 | 3300031823 | Hardwood Forest Soil | MNLNSEIAFYSELRPVDKARLLNLFLHELAEEARGTYGAGDQVHDGAHL |
Ga0318511_104329802 | 3300031845 | Soil | MNLNSEIAFYSDLRLVDKARLLNLFLHELAEEARGTYGAGEQVHDGAHL |
Ga0318527_104728491 | 3300031859 | Soil | MNINSEIAFYSELRPVDKARLLNLFLHELAEEARGTYGAGEQVHDGAH |
Ga0318544_102601021 | 3300031880 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGEQVHDGM |
Ga0318544_104164581 | 3300031880 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGEQVH |
Ga0318522_102784912 | 3300031894 | Soil | MNLNSEIAFYEELRLVDKARLLNLFLHELAQEARGTYGAGEQVHDGLHM |
Ga0318551_100476121 | 3300031896 | Soil | MNLNSEIAYFAELRVVDKARLLNLFLHELAEEARGTYGAGDQVHDGAH |
Ga0306923_117235931 | 3300031910 | Soil | MNLNSEIAFYSDLRLVDKARLLNLFLHELAEEARGTYG |
Ga0306921_117302012 | 3300031912 | Soil | MNLNSEIAFYSELRPVDKARLLNLFLHELAEEARSTYGAGE |
Ga0310916_103610263 | 3300031942 | Soil | MNLNSEIAFYSDLRLVDKARLLNLFLHELAEEARGTYGAGEQV |
Ga0310916_106530382 | 3300031942 | Soil | MNLNSEIAFYAELRPVDKARLLNLFLHELAEEARGTYGAGDQVHDGAHLRFV |
Ga0310913_101716203 | 3300031945 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGDQVHDGA |
Ga0310913_108954212 | 3300031945 | Soil | MNLNSEIAFYSDLRLVDKARLLNLFLHELAEEARG |
Ga0306926_104552343 | 3300031954 | Soil | MNLNSEIAFYAELRTVDKARLLNLFLHELAEEARGTYGP |
Ga0306922_123963452 | 3300032001 | Soil | MNLNSEIAFYAELRPVDKARLLNLFLHELAEEARGTYGAGEQVHDGVH |
Ga0318507_102353712 | 3300032025 | Soil | MNINSEIAFYSELRPVDKARLLNLFLHELAEEARGTY |
Ga0318549_103544652 | 3300032041 | Soil | MNLNSEIAFYEELRLVDKARLLNLFLHELAQEARGTYGAGEQ |
Ga0318545_100305641 | 3300032042 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGEQVHD |
Ga0318525_104008812 | 3300032089 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYGAGDQVHDGAHLR |
Ga0318540_104623671 | 3300032094 | Soil | MNLNSEIAFYAELRPVDKARLLNLFLHELAEEARGTYGAGD |
Ga0306920_1010002061 | 3300032261 | Soil | MNLNSEIAFYAELRTVDKARLLNLFLHELAEEARGTYGPGSAE |
Ga0306920_1044047791 | 3300032261 | Soil | MNLNSEIAFYAELRTVDKARLLNLFLHELAEEARGTYGPGAEQVH |
Ga0335079_102834231 | 3300032783 | Soil | MNLNSEIEFFGELRTVDKARLLNLFLHELAEEARATY |
Ga0335080_114677492 | 3300032828 | Soil | VNLKSEIEYFTEMRLLDKARLLNLFLHELADEARGTYGPTVEDVHDTAHLRF |
Ga0335069_106567283 | 3300032893 | Soil | MNLQSEIEYFSELRLIDKARLLNLFLHELADEARGT |
Ga0335076_104079831 | 3300032955 | Soil | MNLNSEIEFFGELRVVDKARLLNLFLHELAEEARATY |
Ga0335076_105213931 | 3300032955 | Soil | MNLRSEIEFFMELRLVDKARLLNLLLHELADEARGTYGPGAEQVHDTAHLRF |
Ga0310914_107411052 | 3300033289 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARGTYG |
Ga0310914_109273541 | 3300033289 | Soil | MNLNSEIAFYAELRLVDKARLLNLFLHELAEEARG |
⦗Top⦘ |