| Basic Information | |
|---|---|
| Family ID | F076534 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LNHKHPIADSMYWSNSWAGGVLIALAAASLAAVALRRPARR |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 98.31 % |
| % of genes from short scaffolds (< 2000 bps) | 94.92 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.797 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.051 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.508 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.831 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF11239 | DUF3040 | 69.49 |
| PF01734 | Patatin | 8.47 |
| PF05762 | VWA_CoxE | 1.69 |
| PF05995 | CDO_I | 0.85 |
| PF00196 | GerE | 0.85 |
| PF13561 | adh_short_C2 | 0.85 |
| PF01047 | MarR | 0.85 |
| PF04055 | Radical_SAM | 0.85 |
| PF00571 | CBS | 0.85 |
| PF14378 | PAP2_3 | 0.85 |
| PF00892 | EamA | 0.85 |
| PF00561 | Abhydrolase_1 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 8.47 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 8.47 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 8.47 |
| COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.80 % |
| All Organisms | root | All Organisms | 32.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.69% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_06959070 | 2189573002 | Grass Soil | PPILDHKHSIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAH |
| Ga0062387_1011729132 | 3300004091 | Bog Forest Soil | ILSQKFSIADPMFWSNSVAGGVLIALAAVALAAVAMRRPARR* |
| Ga0066388_1029282713 | 3300005332 | Tropical Forest Soil | PILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR* |
| Ga0070709_115107521 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR* |
| Ga0070714_1011111651 | 3300005435 | Agricultural Soil | ILNHKHPIADSMYWSNSWAGGVLIALAAASLAAVALRRPARR* |
| Ga0070713_1005584373 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TRKHPIADSMYWSNSWAGGVLIALAAASLAVVALRWPARR* |
| Ga0070706_1006856711 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SHKHPIADSMYWSNSWAGGVLIALAAASLAAVVLRWPTRG* |
| Ga0070706_1009305701 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HKHPIADSMYWSNSWAGGVLIALAAASLAAIAPRRPARR* |
| Ga0070706_1009785441 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRPAR* |
| Ga0070699_1010235001 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRPAR* |
| Ga0070730_105706051 | 3300005537 | Surface Soil | LSQKFSIADPMFWSNSWAGGVLIALAALGLTAVAMRRPARR* |
| Ga0070733_111013111 | 3300005541 | Surface Soil | ILSQKHPIADAMYWSNSWAGGLLIVVAAAGLAAVALRRPARR* |
| Ga0070665_1017493312 | 3300005548 | Switchgrass Rhizosphere | GPILNHKHPIADSMYWSNSWAGGVLIALAAASLAAVALRRPARR* |
| Ga0070762_107271283 | 3300005602 | Soil | AGPILSQKFSIADPMFWSNSVAGGVLIAVAALGLTAVAMRRPARR* |
| Ga0070762_111020631 | 3300005602 | Soil | FTIADPMFWSNSWAGGVLIALAAAGLAAVGLRRPARR* |
| Ga0068856_1004074494 | 3300005614 | Corn Rhizosphere | DHKHPIAHAMYWSNSFSGGVLIALTAAGLGFAALRRTAR* |
| Ga0068866_107739561 | 3300005718 | Miscanthus Rhizosphere | DHKHPIAHAMYWSNSFSGGVLIAVAAAGLGFAALRRTAR* |
| Ga0066903_1075096031 | 3300005764 | Tropical Forest Soil | SPPILDHKHPIAPAMYWSNSFSGGALIALAAAGLGFAALRRTAR* |
| Ga0070717_110258461 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR* |
| Ga0070715_107154221 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PPILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR* |
| Ga0070716_1013313411 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | NHKHPIADSMYWSNSWAGGVLIALAAASLAAVALRRPARR* |
| Ga0070712_1011294491 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ADSMYWSNSWAGGVLIALAAASLAAIALRWPARR* |
| Ga0070765_1005587383 | 3300006176 | Soil | IADPMFWSNSWAGGVLIALAAAGLAAVGLRRPARR* |
| Ga0070765_1008837123 | 3300006176 | Soil | KHPIADSMYWSNSWAGGVLIALAAASLAAITITLRRPARR* |
| Ga0070765_1012447263 | 3300006176 | Soil | PILSQKFSIADPMFWSNSVAGGVLIAVAALGLTAVAMRRPARR* |
| Ga0075425_1002267501 | 3300006854 | Populus Rhizosphere | KHSIAHAMYWSNSFSGGVLIALAAADLGFAALRRTAR* |
| Ga0073928_109529491 | 3300006893 | Iron-Sulfur Acid Spring | KHPIADSMFWSNSWTGGVLIALAILGLAAAATRRPARS* |
| Ga0075426_100947271 | 3300006903 | Populus Rhizosphere | MPSFSDSMYWPNSLAGGVLIALAAASLAVVALRRP |
| Ga0099829_113137711 | 3300009038 | Vadose Zone Soil | ADSMYWSNSWAGGVLIALAAASLAAVALRGPARR* |
| Ga0105240_116536241 | 3300009093 | Corn Rhizosphere | IAHAMYWSNSFSGGVLIAVAAAGLGFAALRRTAR* |
| Ga0105245_114070521 | 3300009098 | Miscanthus Rhizosphere | ADSMYWSSSWAGGVLIALAAASLAVVALRWPARR* |
| Ga0126384_106777023 | 3300010046 | Tropical Forest Soil | HPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAL* |
| Ga0126373_119093112 | 3300010048 | Tropical Forest Soil | QKDAIADPMYWSNSWAGGLLIALAAAGLAAVALRRPARR* |
| Ga0134080_106357861 | 3300010333 | Grasslands Soil | ILDHKHPIAHAMYWSNSFSGGVLITLAAAGLGFAALRRTAR* |
| Ga0126370_100660925 | 3300010358 | Tropical Forest Soil | KFPIAHPMYWSNSWSGGVLMALALAGLAVLLRPAR* |
| Ga0126372_107698891 | 3300010360 | Tropical Forest Soil | HPIAHAMYWSNSFSGGVLIALAAAGLGFAALRLTAR* |
| Ga0126378_127843641 | 3300010361 | Tropical Forest Soil | IICPPILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR* |
| Ga0134128_116749891 | 3300010373 | Terrestrial Soil | IADSMYWSNSWAGGVLIALAAASLAAVALRRSAHR* |
| Ga0134128_118207471 | 3300010373 | Terrestrial Soil | IADSMYWSNSWAGGVLIALAAASLAAVALRRPARR* |
| Ga0137379_113122841 | 3300012209 | Vadose Zone Soil | IAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAH* |
| Ga0137384_100183031 | 3300012357 | Vadose Zone Soil | PIADPMYWSNSWAGAVLIALAAAGLAAVALPRPARR* |
| Ga0137398_108133431 | 3300012683 | Vadose Zone Soil | ILNHKHPIADSMYWSDSWAGGVLIALAAASLAAVALRRPARR* |
| Ga0137398_109647541 | 3300012683 | Vadose Zone Soil | ADPMFWSNSVAGGVLIVLAATGLGAVALRRPVGR* |
| Ga0137407_116887101 | 3300012930 | Vadose Zone Soil | KHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR* |
| Ga0126375_103052781 | 3300012948 | Tropical Forest Soil | APPILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR* |
| Ga0163163_117932212 | 3300014325 | Switchgrass Rhizosphere | DHKHPIAHAMYWSNSFSGGVLIALAAAGLGFATLRRTAR* |
| Ga0132258_129148743 | 3300015371 | Arabidopsis Rhizosphere | MISPPILYHKHPIAHAMHWSDSFSGGVLIALTAAGLGFAALRRTAR* |
| Ga0182033_117160171 | 3300016319 | Soil | LDHKHPIAHAMYWSNGFSGGVLIALAAAGLGFAALRRTAR |
| Ga0182035_115059312 | 3300016341 | Soil | LNHKHPIADSMYWSNSWAGGALIALAAASLAAIAPRRPARR |
| Ga0182032_110817921 | 3300016357 | Soil | DHKHPIAHAMYWSNGFSGGVLIALAAAGLGFAALRRTAR |
| Ga0182039_119885041 | 3300016422 | Soil | PIADPMFWSNSWAGGVLIAVAAAGLAAVAMRRPARR |
| Ga0187812_11501591 | 3300017821 | Freshwater Sediment | LDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0066662_125684871 | 3300018468 | Grasslands Soil | LDHKHPIAHAMYWSNSFSGGVLIALATAGLGFAALRRTGR |
| Ga0179592_102604892 | 3300020199 | Vadose Zone Soil | LNHKHPIADSMYWSNSWAGGVLIALAAASLAAVALRRPARR |
| Ga0210407_103257053 | 3300020579 | Soil | ILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAL |
| Ga0210396_109665871 | 3300021180 | Soil | LNRKHPIADSMYWSNSWAGGVLIALAAVTLRWPAPR |
| Ga0210393_112228592 | 3300021401 | Soil | AGPILSSKFTIADPMFWSNSLAGGVLIVLAAAGLGAVALRRPAGR |
| Ga0210385_108431563 | 3300021402 | Soil | PILSQKFSIADPMFWSNSVAGGVLIAVAALGLTAVAMRRPARR |
| Ga0210397_101577063 | 3300021403 | Soil | IADSMFWSNSWAGGVLIALAILGLAAAAMRRPARS |
| Ga0210389_110113151 | 3300021404 | Soil | KHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0210387_109049633 | 3300021405 | Soil | GPILNRKHPIADSMYWSNSWAGGVLIALAAVTLRWPAPR |
| Ga0210383_107053983 | 3300021407 | Soil | GPILSQKFSIADPMFWSNSVAGGVLIAVAAVGLAAVAMRRPARR |
| Ga0210402_108960561 | 3300021478 | Soil | PAIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0210410_105161213 | 3300021479 | Soil | ILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0126371_128081692 | 3300021560 | Tropical Forest Soil | WLIISSPILDHKHPIAHAMYWSNSFSGGVLIAVAAAGLGFAALRRTAR |
| Ga0207692_103416711 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LSQKFAITDSMYWSNSWAGGALIVLAAASLAAIALRRPARR |
| Ga0207705_112095281 | 3300025909 | Corn Rhizosphere | HKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0207663_104430382 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QKFAITDSMYWSNSWAGGALIVLAAASLAAIALRRPARR |
| Ga0207646_102715901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | HILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRPAR |
| Ga0207646_104106743 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PVLNQKHPVADSMYWSNSWAGAVLIALAAAGLAAVALRRPVRR |
| Ga0207700_103761071 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PIAHAMYWSNSFSGGVLIALTAAGLGFAALRRTAR |
| Ga0207667_120199972 | 3300025949 | Corn Rhizosphere | YRHAIADSMYWSNSWAGGVLIALAAASLAVVTLRWSDRR |
| Ga0257160_10665302 | 3300026489 | Soil | LGVWLIVAGPILSQKFSIADPMFWSNSVAGGVLIAVAAIGLAAVAMRRPARR |
| Ga0209648_105958531 | 3300026551 | Grasslands Soil | VLNQKHPIADPMYWSNSWAGAVLIALAAAGLAAVALPRPARR |
| Ga0209525_10744043 | 3300027575 | Forest Soil | LAGPILAQKFSIADPMFWSNSVAGGVLIAVAALGLTAVAMRRPARR |
| Ga0209178_13724341 | 3300027725 | Agricultural Soil | LTRKHPIADSMYWSNSWAGGVLIALAAASLAAIALRRPVRR |
| Ga0209180_105564863 | 3300027846 | Vadose Zone Soil | KHPIADSMYWSNSWAGGVLIALAAASLAAVALRRPARR |
| Ga0209167_107496431 | 3300027867 | Surface Soil | ILSQKHPIADAMYWSNSWAGGLLIVVAAAGLAAVALRRPARR |
| Ga0209488_101736541 | 3300027903 | Vadose Zone Soil | ILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFATLRRTAR |
| Ga0308309_106949903 | 3300028906 | Soil | LIADSMYWSNSVAGAVLIAVAAAGLAAVAMRRPARR |
| Ga0308309_109146431 | 3300028906 | Soil | HPITDSMFWSNSWAGALLIALAAIGLATVAMRRPARR |
| Ga0302182_103970802 | 3300030054 | Palsa | KNPITDSMFWSNSWAGGVLIAVAAIGLAAAAMRRPARR |
| Ga0318534_106201062 | 3300031544 | Soil | PILSQKHPIADPMFWSNSWAGGVLIAVAAAGLAAVAMRRPARR |
| Ga0318571_100252884 | 3300031549 | Soil | ILHHKHPIADSMYWSNSWAGGVLIALAAASLAAVALRRPARR |
| Ga0318574_107554412 | 3300031680 | Soil | ILNHKHPIADSMYWSNSWAGGVLIALAAASLAAVALRRPARR |
| Ga0318572_105992181 | 3300031681 | Soil | LSQKYPIADPMYWSNSWAGGVLIAVAIAGLAAVAMRRPARR |
| Ga0318496_105286242 | 3300031713 | Soil | VSPPILDQKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0307474_104101991 | 3300031718 | Hardwood Forest Soil | SKFTIADPMFWSNSVAGGVLIVLAAAGLGAVALRRPAGR |
| Ga0318502_104286751 | 3300031747 | Soil | IAGPILNHKHPIADSMYWSNSWAGGVLIALAAASLAAIALRRPARR |
| Ga0318492_105147501 | 3300031748 | Soil | ILNHKHPIAGSMYWSNSWAGGALIALAAASLAAVALRRPARR |
| Ga0318543_103238612 | 3300031777 | Soil | PILNQKHPIADPMYWSNSWAGGVLIAVAIAGLAAVAMRRPARR |
| Ga0318498_100594824 | 3300031778 | Soil | PIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0318497_100504781 | 3300031805 | Soil | LIISPPILDHKHPIAHAMYWSNSFSGGALIALAAAGLGFAALRRTAR |
| Ga0307473_105800983 | 3300031820 | Hardwood Forest Soil | LIISPPILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0318564_101438473 | 3300031831 | Soil | NHKHPIADSMYWSNSWAGGVLIALAAASLAAVALRRPARR |
| Ga0318564_101584601 | 3300031831 | Soil | CPPILDHKHPIAHAMYWSNSFSGGALIALAAAGLGFAALRRTAR |
| Ga0318564_102560923 | 3300031831 | Soil | EPILNHKHPIADSMYWSNSWAGGVLIALAAASLAAIALRRPARR |
| Ga0318517_102946281 | 3300031835 | Soil | KHAIADSMYWSNSWAGGALIALAAASLAAVALRRPARR |
| Ga0318511_103275401 | 3300031845 | Soil | AGPILNQKHPIADPMYWSNSWAGGVLIAVAIAGLAAVAMRRPARR |
| Ga0318512_102863203 | 3300031846 | Soil | ILDHKYPIAHAMYWSNSFSGGVLIALAAAGLGLAALARTAR |
| Ga0318551_105998642 | 3300031896 | Soil | LNHKHAIADSMYWSNSWAGGALIALAAASLAAVALRRPARR |
| Ga0318520_104244533 | 3300031897 | Soil | NHKHPIADSMYWSNSWAGGVLIALAAASLAAIALRRPARR |
| Ga0318520_108234731 | 3300031897 | Soil | GPILSQKHAIADSMYWSNSWAGAVLIALAATSVAAIALRRPARR |
| Ga0306926_116377473 | 3300031954 | Soil | PIAHAMYWSNSFSGGALIALAAAGLGFAALRRTAR |
| Ga0307479_115414672 | 3300031962 | Hardwood Forest Soil | KHPVADSMYWSNSWAGGVLVALAAASLTAVALRRPARR |
| Ga0318562_106859262 | 3300032008 | Soil | HPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0318562_107205172 | 3300032008 | Soil | ILSQKHAIADSMYWSNSWAGAVLIALAAASVAAIALRRPARR |
| Ga0318569_100948834 | 3300032010 | Soil | IAGPILNHKHPIADSMYWSNSWAGGVLIALAAASLAAVALRPARR |
| Ga0318569_103123953 | 3300032010 | Soil | PIAHAMYRSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0318556_100905991 | 3300032043 | Soil | IISPPILDHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAAPRRNAR |
| Ga0318524_101193643 | 3300032067 | Soil | ILDQKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0318524_107198501 | 3300032067 | Soil | ILNQKHPIADPMYWSNSWAGGVLIALAVAGLAAAALSRPARR |
| Ga0318553_100227493 | 3300032068 | Soil | IIAGPILSQKHPIADPMFWSNSWAGGVLIAVAAAGLAAVAMRRPARR |
| Ga0318553_101719323 | 3300032068 | Soil | ILNQKHPIADPMYWSNSWAGGVLIAVAIAGLAAVAMRRPARR |
| Ga0306924_105635761 | 3300032076 | Soil | KHPIAHAMYWSNSFSGGALIALAAAGLGFAALRRTAR |
| Ga0306920_1025343631 | 3300032261 | Soil | LSQKYSIADPLYWSNSWAGGVLIAVAAVGLAVVAMRRPARR |
| Ga0306920_1027960982 | 3300032261 | Soil | DHKHPIAHAMYWSNSFSGGVLIALAAAGLGFAALRRTAR |
| Ga0335074_112252111 | 3300032895 | Soil | TIADPMFWSNSVAGGVLIVLAAAGLGAVALRRPAAR |
| ⦗Top⦘ |