| Basic Information | |
|---|---|
| Family ID | F076529 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 97.46 % |
| % of genes from short scaffolds (< 2000 bps) | 96.61 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.593 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.034 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.203 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.373 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 24.66% Coil/Unstructured: 75.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF06999 | Suc_Fer-like | 8.47 |
| PF03483 | B3_4 | 5.08 |
| PF06305 | LapA_dom | 0.85 |
| PF14026 | DUF4242 | 0.85 |
| PF00873 | ACR_tran | 0.85 |
| PF02784 | Orn_Arg_deC_N | 0.85 |
| PF14833 | NAD_binding_11 | 0.85 |
| PF06276 | FhuF | 0.85 |
| PF03551 | PadR | 0.85 |
| PF13751 | DDE_Tnp_1_6 | 0.85 |
| PF03949 | Malic_M | 0.85 |
| PF13358 | DDE_3 | 0.85 |
| PF00521 | DNA_topoisoIV | 0.85 |
| PF12680 | SnoaL_2 | 0.85 |
| PF00561 | Abhydrolase_1 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG4759 | Uncharacterized conserved protein, contains thioredoxin-like domain | General function prediction only [R] | 8.47 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.85 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.85 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.85 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.85 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.85 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.85 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.85 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| COG4114 | Ferric iron reductase protein FhuF, involved in iron transport | Inorganic ion transport and metabolism [P] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.59 % |
| Unclassified | root | N/A | 14.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100504465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1087 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10452948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 519 | Open in IMG/M |
| 3300004092|Ga0062389_101588330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 836 | Open in IMG/M |
| 3300004479|Ga0062595_102351883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300004635|Ga0062388_101784391 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005436|Ga0070713_101228733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300005436|Ga0070713_102260931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 526 | Open in IMG/M |
| 3300005549|Ga0070704_101656293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
| 3300005560|Ga0066670_10898253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 539 | Open in IMG/M |
| 3300005591|Ga0070761_10119014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1532 | Open in IMG/M |
| 3300005614|Ga0068856_100399915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1393 | Open in IMG/M |
| 3300005614|Ga0068856_101101675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
| 3300005764|Ga0066903_106940944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 588 | Open in IMG/M |
| 3300006028|Ga0070717_11430399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300006028|Ga0070717_11575588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
| 3300006163|Ga0070715_10808061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300006175|Ga0070712_100812734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 802 | Open in IMG/M |
| 3300006175|Ga0070712_101955959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300006237|Ga0097621_102400989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 505 | Open in IMG/M |
| 3300006954|Ga0079219_10768394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → Kitasatospora setae | 749 | Open in IMG/M |
| 3300009545|Ga0105237_10757228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
| 3300009672|Ga0116215_1076163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1510 | Open in IMG/M |
| 3300009700|Ga0116217_10090943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2103 | Open in IMG/M |
| 3300010373|Ga0134128_12402125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300010375|Ga0105239_10418551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1517 | Open in IMG/M |
| 3300010876|Ga0126361_11051870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 910 | Open in IMG/M |
| 3300012357|Ga0137384_10585700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 911 | Open in IMG/M |
| 3300013308|Ga0157375_12247227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300014150|Ga0134081_10314447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300014169|Ga0181531_10283916 | Not Available | 1012 | Open in IMG/M |
| 3300014968|Ga0157379_10221675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1714 | Open in IMG/M |
| 3300014968|Ga0157379_10438282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1205 | Open in IMG/M |
| 3300016294|Ga0182041_10940231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 779 | Open in IMG/M |
| 3300016341|Ga0182035_10368152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1199 | Open in IMG/M |
| 3300016341|Ga0182035_10782236 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300016341|Ga0182035_11732872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 565 | Open in IMG/M |
| 3300016371|Ga0182034_10943028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300016387|Ga0182040_11666825 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300016422|Ga0182039_10289335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1352 | Open in IMG/M |
| 3300016422|Ga0182039_10539892 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300016422|Ga0182039_11936463 | Not Available | 541 | Open in IMG/M |
| 3300017821|Ga0187812_1024611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2074 | Open in IMG/M |
| 3300017928|Ga0187806_1391070 | Not Available | 500 | Open in IMG/M |
| 3300017942|Ga0187808_10595206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 514 | Open in IMG/M |
| 3300017970|Ga0187783_10302105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1167 | Open in IMG/M |
| 3300017973|Ga0187780_10289074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1151 | Open in IMG/M |
| 3300017973|Ga0187780_11024269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus | 602 | Open in IMG/M |
| 3300017975|Ga0187782_10348992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1120 | Open in IMG/M |
| 3300017975|Ga0187782_11092650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 622 | Open in IMG/M |
| 3300017995|Ga0187816_10114837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1159 | Open in IMG/M |
| 3300017995|Ga0187816_10180538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 916 | Open in IMG/M |
| 3300018001|Ga0187815_10082975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1348 | Open in IMG/M |
| 3300018001|Ga0187815_10255182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 742 | Open in IMG/M |
| 3300018058|Ga0187766_10797926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 659 | Open in IMG/M |
| 3300018089|Ga0187774_10588282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300020580|Ga0210403_11273469 | Not Available | 563 | Open in IMG/M |
| 3300020582|Ga0210395_10557207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 861 | Open in IMG/M |
| 3300021384|Ga0213876_10648500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 562 | Open in IMG/M |
| 3300021403|Ga0210397_10695175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 781 | Open in IMG/M |
| 3300021474|Ga0210390_11096073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 647 | Open in IMG/M |
| 3300022709|Ga0222756_1060271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 586 | Open in IMG/M |
| 3300025898|Ga0207692_10360524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 898 | Open in IMG/M |
| 3300025914|Ga0207671_11117326 | Not Available | 619 | Open in IMG/M |
| 3300025914|Ga0207671_11504528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300025915|Ga0207693_10217294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1502 | Open in IMG/M |
| 3300025916|Ga0207663_11684978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura alba | 510 | Open in IMG/M |
| 3300025917|Ga0207660_11033148 | Not Available | 670 | Open in IMG/M |
| 3300025928|Ga0207700_10347444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1291 | Open in IMG/M |
| 3300025929|Ga0207664_10972130 | Not Available | 761 | Open in IMG/M |
| 3300025938|Ga0207704_10353750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1144 | Open in IMG/M |
| 3300025941|Ga0207711_11406273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300025961|Ga0207712_11590805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 586 | Open in IMG/M |
| 3300026300|Ga0209027_1287066 | Not Available | 530 | Open in IMG/M |
| 3300027047|Ga0208730_1012298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 929 | Open in IMG/M |
| 3300027096|Ga0208099_1002400 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300027680|Ga0207826_1016876 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300027855|Ga0209693_10278453 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300027889|Ga0209380_10619989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 625 | Open in IMG/M |
| 3300028379|Ga0268266_11697355 | Not Available | 607 | Open in IMG/M |
| 3300030494|Ga0310037_10416791 | Not Available | 554 | Open in IMG/M |
| 3300030730|Ga0307482_1198517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria | 608 | Open in IMG/M |
| 3300031544|Ga0318534_10683390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 580 | Open in IMG/M |
| 3300031561|Ga0318528_10362060 | Not Available | 779 | Open in IMG/M |
| 3300031640|Ga0318555_10660934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 565 | Open in IMG/M |
| 3300031713|Ga0318496_10799525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 520 | Open in IMG/M |
| 3300031719|Ga0306917_10987432 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031744|Ga0306918_11442630 | Not Available | 527 | Open in IMG/M |
| 3300031748|Ga0318492_10169332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1108 | Open in IMG/M |
| 3300031751|Ga0318494_10133625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1389 | Open in IMG/M |
| 3300031753|Ga0307477_10681275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300031781|Ga0318547_10705900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 627 | Open in IMG/M |
| 3300031798|Ga0318523_10267765 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300031799|Ga0318565_10664614 | Not Available | 500 | Open in IMG/M |
| 3300031805|Ga0318497_10106543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1508 | Open in IMG/M |
| 3300031819|Ga0318568_10344370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 927 | Open in IMG/M |
| 3300031879|Ga0306919_10550263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 890 | Open in IMG/M |
| 3300031894|Ga0318522_10161295 | Not Available | 846 | Open in IMG/M |
| 3300031897|Ga0318520_10150703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1348 | Open in IMG/M |
| 3300031910|Ga0306923_10810688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1033 | Open in IMG/M |
| 3300031910|Ga0306923_11121005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 846 | Open in IMG/M |
| 3300031942|Ga0310916_10683938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 869 | Open in IMG/M |
| 3300031942|Ga0310916_11596092 | Not Available | 530 | Open in IMG/M |
| 3300031947|Ga0310909_10662664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 869 | Open in IMG/M |
| 3300031954|Ga0306926_11731791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 712 | Open in IMG/M |
| 3300032010|Ga0318569_10053944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1745 | Open in IMG/M |
| 3300032065|Ga0318513_10541396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 570 | Open in IMG/M |
| 3300032067|Ga0318524_10207118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1003 | Open in IMG/M |
| 3300032076|Ga0306924_11242758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 803 | Open in IMG/M |
| 3300032180|Ga0307471_103659660 | Not Available | 544 | Open in IMG/M |
| 3300032205|Ga0307472_100552969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1005 | Open in IMG/M |
| 3300032261|Ga0306920_103070553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 628 | Open in IMG/M |
| 3300032770|Ga0335085_12031334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 582 | Open in IMG/M |
| 3300032829|Ga0335070_10605634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1030 | Open in IMG/M |
| 3300032954|Ga0335083_10431363 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300033289|Ga0310914_10678039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 926 | Open in IMG/M |
| 3300033290|Ga0318519_10186690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1177 | Open in IMG/M |
| 3300034163|Ga0370515_0085602 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.39% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1005044652 | 3300002245 | Forest Soil | AQAXPAGVDVVEAGWPAGQPASASWPKHPAGWRIVASDQAAGWVAWRHS* |
| JGIcombinedJ51221_104529481 | 3300003505 | Forest Soil | APPAGVDVVETGWPAGQPASAGWPNHPAGWRIVASNQAAGWVAWRHS* |
| Ga0062389_1015883302 | 3300004092 | Bog Forest Soil | EPEVFNPASQSPPAGVTVVQMPWTAGQPARSSWPHAPAGWRIAASDASSGWVVWRKA* |
| Ga0062595_1023518831 | 3300004479 | Soil | LPAGTTVVETGWPAGKPAEAGWPNAPAGWRIVASNQDLGWVVWRQG* |
| Ga0062388_1017843911 | 3300004635 | Bog Forest Soil | ELEFFNPAQAPPAGVSVVETGWPTGQPASAGWAHHPAGWRIVASNQAAGWVAWRHS* |
| Ga0070713_1012287331 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVIWRKG* |
| Ga0070713_1022609311 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG* |
| Ga0070704_1016562932 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRNG* |
| Ga0066670_108982532 | 3300005560 | Soil | VIWRSFPGRAHPLLAGTTVVETGWPVGEPAQAGWPDAPAGWRIVASDQDVGWVVWRQG* |
| Ga0070761_101190142 | 3300005591 | Soil | SVVETGWPTGQPASASWPQHPAGWRIVASNQAAGWVAWRHS* |
| Ga0068856_1003999151 | 3300005614 | Corn Rhizosphere | GTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG* |
| Ga0068856_1011016752 | 3300005614 | Corn Rhizosphere | GWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG* |
| Ga0066903_1069409442 | 3300005764 | Tropical Forest Soil | VNVVETGWPSGQAAAAGWPNHPAGWRIVAANQAAGWVAWRKS* |
| Ga0070717_114303991 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QPLPPGTTVVEAGWPTGQPAQAGWPEAPAGWRIVASDQSAGWAVWRKG* |
| Ga0070717_115755881 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG* |
| Ga0070715_108080612 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QPLPPGTTVVEAGWPTGKPAQAGWPEAPAGWRIVASDQGAGWAVWRKA* |
| Ga0070712_1008127341 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HQALPPGTTVVEAGWPTGKPAQAGWPEAPAGWRIVASDQGAGWAVWRKA* |
| Ga0070712_1019559591 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG* |
| Ga0097621_1024009891 | 3300006237 | Miscanthus Rhizosphere | QPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG* |
| Ga0079219_107683941 | 3300006954 | Agricultural Soil | EAGWPTGKPAQAGWPQAPAGWRIVASDQSAGWVVWRKA* |
| Ga0105237_107572283 | 3300009545 | Corn Rhizosphere | RQPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG* |
| Ga0116215_10761631 | 3300009672 | Peatlands Soil | ELEFFNPAQAPPAGVNVVETGWPAGQPASAGWPVHPAGWRIVASNQAAGWVAWRKS* |
| Ga0116217_100909431 | 3300009700 | Peatlands Soil | PSGQPASAGWPNHPAGWRIVAANQAAGWVAWRKS* |
| Ga0134128_124021252 | 3300010373 | Terrestrial Soil | LPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVIWRKG* |
| Ga0105239_104185512 | 3300010375 | Corn Rhizosphere | PAGTTVVETGWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG* |
| Ga0126361_110518702 | 3300010876 | Boreal Forest Soil | WTTGQPASASWPQHPAGWRIVASDRTDGWVVWRRA* |
| Ga0137384_105857001 | 3300012357 | Vadose Zone Soil | PPAGVSVVEAAWPAGQDARAGWPDAPAGWRIVASDQASAWVLWRKS* |
| Ga0157375_122472271 | 3300013308 | Miscanthus Rhizosphere | RQPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG* |
| Ga0134081_103144472 | 3300014150 | Grasslands Soil | GWPTGQPARAGWSQAPAGWQIVASDQSAGWVVWRKG* |
| Ga0181531_102839162 | 3300014169 | Bog | AQAPPAGVNVVETGWPSGQPASAGWPDRPAGWRIVASNQAAGWVAWRKS* |
| Ga0157379_102216751 | 3300014968 | Switchgrass Rhizosphere | TTVVETGWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG* |
| Ga0157379_104382821 | 3300014968 | Switchgrass Rhizosphere | RQPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRNG* |
| Ga0182041_109402312 | 3300016294 | Soil | GWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLAPGR |
| Ga0182035_103681522 | 3300016341 | Soil | WPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA |
| Ga0182035_107822363 | 3300016341 | Soil | GWPTGQPAQAGWPEAPAGWRIFASDQAAGWVVWRRG |
| Ga0182035_117328721 | 3300016341 | Soil | VVETGWPAGPPASAGWPDHPAGWQIVASNQAAGWVAWRLAPGR |
| Ga0182034_109430281 | 3300016371 | Soil | PFTSDGQPLPAGTTVVESGWPAGHPAQAGWPGAPAGWRIVASDQNAGWVVWRKG |
| Ga0182040_116668251 | 3300016387 | Soil | GWPTGQSAQAGWPEAPAGWRIIASDQAAGWVVWRQG |
| Ga0182039_102893353 | 3300016422 | Soil | LPAGTTVVESGWPAGHPAQAGWPGAPAGWRIVASDQNAGWVVWRKG |
| Ga0182039_105398921 | 3300016422 | Soil | SAWPTGQPAQAGWPQAPAGWRIVASDQGAGWVIWRKG |
| Ga0182039_119364632 | 3300016422 | Soil | EFFDITQAPPVGVNVVEAGWPTGQPARASWPQVPAGWRIVASSQAGGWVTWRKA |
| Ga0187812_10246112 | 3300017821 | Freshwater Sediment | VNVVETGWPAGQPASAGWPEHPAGWRIVAANQAAGWVAWRKS |
| Ga0187806_13910701 | 3300017928 | Freshwater Sediment | NPAQPPPAGVNVVETGWPAGQTASAGWLDHPAGWRIVASNQAAGWVAWRKS |
| Ga0187808_105952061 | 3300017942 | Freshwater Sediment | TDVEFFNPTQAPPAGTTVVETGWPAGQPAWSGWPNHRAGWHIVAANQAAGWVAWRKS |
| Ga0187783_103021053 | 3300017970 | Tropical Peatland | PPAGVNVVEAGWPVGQPAQASWPHAPAGWRIVASSQAGGWVVWRKAPVS |
| Ga0187780_102890742 | 3300017973 | Tropical Peatland | GQPASAGWPDHPAGWRIVASNQAAGWVAWRLAPGRLSW |
| Ga0187780_110242692 | 3300017973 | Tropical Peatland | GINVVETGWPTGQPASASWPNHPAGWRIVASNQAAGWVAWRES |
| Ga0187782_103489922 | 3300017975 | Tropical Peatland | FDSTQAPPPGVNVVEAGWPAGQPARASWPQAPAGWRIVASSRAGGWVTWRKA |
| Ga0187782_110926502 | 3300017975 | Tropical Peatland | TGWPAGNPASADWPDHPAGWRIVAANQTAGWVAWRKS |
| Ga0187816_101148372 | 3300017995 | Freshwater Sediment | VVETEWLPGQSAQASWPQAPPGWRIVVSDQSAGWVAWRR |
| Ga0187816_101805382 | 3300017995 | Freshwater Sediment | AQPPPAGVNVVETGWPAGQAASAGWAVHPAGWRIVASNQAGGWVTWRKS |
| Ga0187815_100829752 | 3300018001 | Freshwater Sediment | VEFFNPAQAPPAGTTVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRKS |
| Ga0187815_102551822 | 3300018001 | Freshwater Sediment | VEFFNPAQAPPAGTTVVETGWPAGQPASAGWPDHSAGWRIVASGQAAGWVAWRKS |
| Ga0187766_107979261 | 3300018058 | Tropical Peatland | GQPASAGWPDHPAGWRIVASNQAAGWVAWRLAPGR |
| Ga0187774_105882821 | 3300018089 | Tropical Peatland | TQPVPAGINVVEAGWPSGQPARASWTQAPAGWRIVAASQAGGWVTWRKA |
| Ga0210403_112734692 | 3300020580 | Soil | SQPLPPGTTVVEAAWPTGQPARAGWPQAPAGWRIVGSDQTAGWVVWRKG |
| Ga0210395_105572071 | 3300020582 | Soil | APPAGVNVVETGWPAGQPASAGWPDHPAGWRIVAANQAAGWVAWRHSA |
| Ga0213876_106485001 | 3300021384 | Plant Roots | AGVSAVEMPWAGASAQASWPHAPAGWRVVASSQAGGWVLWQKS |
| Ga0210397_106951752 | 3300021403 | Soil | TVVETGWPTGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG |
| Ga0210390_110960732 | 3300021474 | Soil | VVETGWPAGQPASAGWPNHPAGWRIVASSQAAGWVAWRNS |
| Ga0222756_10602711 | 3300022709 | Soil | GGNVVETSWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRHS |
| Ga0207692_103605242 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEAGWPTGKPAQAGWPEAPAGWRIVASDQGAGWAVWRKA |
| Ga0207671_111173261 | 3300025914 | Corn Rhizosphere | GWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG |
| Ga0207671_115045281 | 3300025914 | Corn Rhizosphere | VVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVIWRKG |
| Ga0207693_102172941 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG |
| Ga0207663_116849782 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG |
| Ga0207660_110331482 | 3300025917 | Corn Rhizosphere | TVVETGWPAGQPAEAGWPDAPAGWRIVASDQDVGWVVWRKG |
| Ga0207700_103474443 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGTTVVETAWPTGQPATAGWPDSPAGWRIVASDQSADWVVWRKG |
| Ga0207664_109721301 | 3300025929 | Agricultural Soil | VGETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG |
| Ga0207704_103537502 | 3300025938 | Miscanthus Rhizosphere | GTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRNG |
| Ga0207711_114062732 | 3300025941 | Switchgrass Rhizosphere | GRQPLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVIWRKG |
| Ga0207712_115908052 | 3300025961 | Switchgrass Rhizosphere | PGRQPLPAGTTVVETGWPSGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG |
| Ga0209027_12870662 | 3300026300 | Grasslands Soil | EAGWPTGQAATAGWSEAPAGWRIVASDQSAGWVVWRKG |
| Ga0208730_10122981 | 3300027047 | Forest Soil | ETGWPTGQPASAGWPDHPAGWRIVASNQAAGWVAWRHS |
| Ga0208099_10024003 | 3300027096 | Forest Soil | AGVNVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRHS |
| Ga0207826_10168763 | 3300027680 | Tropical Forest Soil | RPVGQSARASWPQAPAGWRIVASGQVVASSQVGWVTWRKD |
| Ga0209693_102784532 | 3300027855 | Soil | ELEFFDITQPVPAGVNVVEAGWPTGQSARTSWPRAPAGWHIVASSPSGGWVTWRKS |
| Ga0209380_106199891 | 3300027889 | Soil | ETGWPAGQPASAGWPNHPAGWRIVAANQAAGWVAWRHA |
| Ga0268266_116973551 | 3300028379 | Switchgrass Rhizosphere | RPGRQPVPAGTTVVETGWPAGQPAQAGWPDAPAGWRIAASDQDVGWVVWRKG |
| Ga0311340_112369471 | 3300029943 | Palsa | EVSWTELEFFNLPGAPPAGTAVVETAWAAGQPAAASWPDTPAGWHIVAASQAAGWVAWRH |
| Ga0310037_104167911 | 3300030494 | Peatlands Soil | PPAGINVVETGWPAGQPAQASWPQAPTGWRIVASSRAGGWVVWRKA |
| Ga0307482_11985172 | 3300030730 | Hardwood Forest Soil | LPAGTTVVETGWPAGQPAQATWPQAPAGWQIAAANHATGWVVWRKGLPADRSLKR |
| Ga0318534_106833902 | 3300031544 | Soil | PAQAPPAGTTVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRLTPGR |
| Ga0318528_103620601 | 3300031561 | Soil | AVVDTAWPAGQLAQASWPDAPAGWRIVAANRFGSWVVWRR |
| Ga0318555_106609342 | 3300031640 | Soil | AGTTVVESGWPAGHPAQAGWPGAPAGWRIVASDQDAGWVVWRKG |
| Ga0318496_107995251 | 3300031713 | Soil | LEPFTSDGQPLPAGTTVVESGWPAGHPAQAGWPGAPAGWRIVASDQDAGWVVWRKG |
| Ga0306917_109874321 | 3300031719 | Soil | GTTVVESEWPAGQPAQAGWPEAPAGWRIVASDQAAGWVVWRQG |
| Ga0306918_114426301 | 3300031744 | Soil | PFTPGSQPVPAGTTVVESGWPTGQPAQAGWPEAPAGWRIFASDQAAGWVVWRQG |
| Ga0318492_101693321 | 3300031748 | Soil | ETGWPAGQPASSGWPNHPAGWRIVASNQAAGWVAWRKS |
| Ga0318494_101336251 | 3300031751 | Soil | GQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR |
| Ga0307477_106812752 | 3300031753 | Hardwood Forest Soil | APPAGVNVVETGWPAGQPASAGWPSHPAGWRIVASNQAAGWVAWRHS |
| Ga0318547_107059003 | 3300031781 | Soil | VEVPWTAGQAARASWPDAPAGWRIVGSDQAYAWVVWRKA |
| Ga0318523_102677651 | 3300031798 | Soil | AGTTVVESGWPTGQPARAGWPEAPAGWRIVASDQDAGWVIWRKG |
| Ga0318565_106646141 | 3300031799 | Soil | FNPASQPPPAGVTVVEVPWPAGQAARASWPDAPAGWRIVGSDQAYAWVVWRKA |
| Ga0318497_101065431 | 3300031805 | Soil | GPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA |
| Ga0318568_103443701 | 3300031819 | Soil | ITQAPPVGVNVVEAGWPTGQPARASWPQVPAGWRIVASSQAGGWVTWRKA |
| Ga0306919_105502632 | 3300031879 | Soil | VNVVEAGWPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA |
| Ga0318522_101612952 | 3300031894 | Soil | QPVPAGTTVVESGWPTGQPAQAGWPEAPAGWRIFASDQAAGWVVWRQG |
| Ga0318520_101507032 | 3300031897 | Soil | PPAGTTVVETGWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR |
| Ga0306923_108106881 | 3300031910 | Soil | QAPPAGTTVVETGWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR |
| Ga0306923_111210051 | 3300031910 | Soil | VETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRLTPGR |
| Ga0310916_106839382 | 3300031942 | Soil | GTTVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRLTPGR |
| Ga0310916_115960921 | 3300031942 | Soil | GVNVVEAGWPTGQPARASWPQVPAGWRIVASSQADGWVTWRKA |
| Ga0310909_106626641 | 3300031947 | Soil | VNVVEAGWPTGQPARASWPQVPAGWRIVASSQAGGWVTWRKA |
| Ga0306926_117317912 | 3300031954 | Soil | VVETGWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR |
| Ga0318569_100539441 | 3300032010 | Soil | ITQAPPVGVNVVEAGWPTGQPARASWPQVPAGWRIVASSQADGWVTWRKA |
| Ga0318513_105413961 | 3300032065 | Soil | AQAPPAGTTVVETGWPAGQPASAGWPDHPAGWRIVASNQAAGWVAWRLTPGR |
| Ga0318524_102071182 | 3300032067 | Soil | AQAPPAGTTVVETGWPAGQPASAGWPDHPAGWQIVASNQAAGWVAWRLTPGR |
| Ga0306924_112427582 | 3300032076 | Soil | APPARVNVVEAGWPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA |
| Ga0307471_1036596602 | 3300032180 | Hardwood Forest Soil | PLPAGTTVVETGWPAGQPAQAGWPDAPAGWRIVASDQDVGWVVWRKG |
| Ga0307472_1005529691 | 3300032205 | Hardwood Forest Soil | SRHPLPAGVNVVEAPWPTGQDAQASWPQAPAGWRIVASDQSAGWVVWRQG |
| Ga0306920_1030705532 | 3300032261 | Soil | LEFFNPAQAPPAGTTVVETGWPAGQSPSSGWPNHPAGWHIVASNQAAGWVAWRKS |
| Ga0335085_120313342 | 3300032770 | Soil | GSQPPPAGTTVVESGWPTGQPAQAGWPGAPAGWRIVASDQNAGWVVWRKG |
| Ga0335070_106056342 | 3300032829 | Soil | FTPGQQPPPAGTTVVESGWPTGQPARAGWPDAPAGWRIVASDQSAGWVVWRKG |
| Ga0335083_104313633 | 3300032954 | Soil | ADWPAGQPARASWPDAPAGWRIVAANRFGSWVVWRR |
| Ga0310914_106780392 | 3300033289 | Soil | GWPTGQPARASWPQVPAGWRIVASSQAGGWVTWRKA |
| Ga0318519_101866901 | 3300033290 | Soil | ITQAPPGRVNVVEAGWPPGQPARASWPQAPAGWRIVASSEFGGWVTWRKA |
| Ga0370515_0085602_3_122 | 3300034163 | Untreated Peat Soil | VETLWPNGQAASASWPHAPAGWRIVASNRSAGWVVWRHA |
| ⦗Top⦘ |