| Basic Information | |
|---|---|
| Family ID | F076476 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 45 residues |
| Representative Sequence | KIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 97.46 % |
| % of genes from short scaffolds (< 2000 bps) | 90.68 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (9.322 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.695 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (71.186 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.11% β-sheet: 27.40% Coil/Unstructured: 68.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00692 | dUTPase | 8.47 |
| PF04389 | Peptidase_M28 | 1.69 |
| PF01593 | Amino_oxidase | 0.85 |
| PF01370 | Epimerase | 0.85 |
| PF08899 | DUF1844 | 0.85 |
| PF13393 | tRNA-synt_His | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 8.47 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 8.47 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886011|MRS1b_contig_4784216 | All Organisms → cellular organisms → Bacteria | 3816 | Open in IMG/M |
| 3300003319|soilL2_10006913 | All Organisms → cellular organisms → Bacteria | 19670 | Open in IMG/M |
| 3300004156|Ga0062589_100669545 | Not Available | 915 | Open in IMG/M |
| 3300004156|Ga0062589_101378920 | Not Available | 686 | Open in IMG/M |
| 3300004156|Ga0062589_101499240 | Not Available | 663 | Open in IMG/M |
| 3300004480|Ga0062592_100243382 | Not Available | 1312 | Open in IMG/M |
| 3300004643|Ga0062591_100119110 | Not Available | 1760 | Open in IMG/M |
| 3300004643|Ga0062591_102681754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300005290|Ga0065712_10482272 | Not Available | 660 | Open in IMG/M |
| 3300005290|Ga0065712_10655094 | Not Available | 565 | Open in IMG/M |
| 3300005331|Ga0070670_101720113 | Not Available | 577 | Open in IMG/M |
| 3300005332|Ga0066388_108464613 | Not Available | 512 | Open in IMG/M |
| 3300005336|Ga0070680_100495540 | Not Available | 1045 | Open in IMG/M |
| 3300005345|Ga0070692_10100116 | Not Available | 1587 | Open in IMG/M |
| 3300005353|Ga0070669_100375043 | Not Available | 1159 | Open in IMG/M |
| 3300005440|Ga0070705_100244580 | Not Available | 1256 | Open in IMG/M |
| 3300005444|Ga0070694_101064132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300005457|Ga0070662_101868967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300005459|Ga0068867_102072391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005468|Ga0070707_101406058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300005535|Ga0070684_101058555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300005539|Ga0068853_102049651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300005545|Ga0070695_101852663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300005546|Ga0070696_101534648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300005547|Ga0070693_100352564 | Not Available | 1007 | Open in IMG/M |
| 3300005547|Ga0070693_100392687 | Not Available | 960 | Open in IMG/M |
| 3300005547|Ga0070693_100810586 | Not Available | 695 | Open in IMG/M |
| 3300005564|Ga0070664_102225863 | Not Available | 520 | Open in IMG/M |
| 3300005577|Ga0068857_100649502 | Not Available | 1000 | Open in IMG/M |
| 3300005577|Ga0068857_101440119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 671 | Open in IMG/M |
| 3300005578|Ga0068854_100741505 | Not Available | 851 | Open in IMG/M |
| 3300005578|Ga0068854_101068070 | Not Available | 718 | Open in IMG/M |
| 3300005614|Ga0068856_101625273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300005617|Ga0068859_101376478 | Not Available | 778 | Open in IMG/M |
| 3300005719|Ga0068861_100343943 | Not Available | 1306 | Open in IMG/M |
| 3300005840|Ga0068870_10239572 | Not Available | 1119 | Open in IMG/M |
| 3300005841|Ga0068863_102464973 | Not Available | 530 | Open in IMG/M |
| 3300005842|Ga0068858_100092028 | Not Available | 2822 | Open in IMG/M |
| 3300005842|Ga0068858_101018905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300005888|Ga0075289_1015327 | Not Available | 1059 | Open in IMG/M |
| 3300006169|Ga0082029_1081510 | Not Available | 1100 | Open in IMG/M |
| 3300006806|Ga0079220_11574641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300006844|Ga0075428_100055283 | All Organisms → cellular organisms → Bacteria | 4349 | Open in IMG/M |
| 3300006854|Ga0075425_102561748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300006954|Ga0079219_10839294 | Not Available | 730 | Open in IMG/M |
| 3300006969|Ga0075419_10734023 | Not Available | 702 | Open in IMG/M |
| 3300006969|Ga0075419_10878049 | Not Available | 646 | Open in IMG/M |
| 3300009094|Ga0111539_10341111 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300009101|Ga0105247_10231294 | Not Available | 1255 | Open in IMG/M |
| 3300009101|Ga0105247_11682597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300009147|Ga0114129_10092754 | All Organisms → cellular organisms → Bacteria | 4183 | Open in IMG/M |
| 3300009147|Ga0114129_12264642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300009148|Ga0105243_11693509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300009156|Ga0111538_12190217 | Not Available | 694 | Open in IMG/M |
| 3300009156|Ga0111538_12538798 | Not Available | 643 | Open in IMG/M |
| 3300009162|Ga0075423_10947727 | Not Available | 913 | Open in IMG/M |
| 3300009176|Ga0105242_11241273 | Not Available | 766 | Open in IMG/M |
| 3300009177|Ga0105248_13325726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300010036|Ga0126305_10595230 | Not Available | 743 | Open in IMG/M |
| 3300010039|Ga0126309_10878317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300010360|Ga0126372_10180725 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
| 3300010396|Ga0134126_12352795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300010397|Ga0134124_11124628 | Not Available | 803 | Open in IMG/M |
| 3300010397|Ga0134124_11162284 | Not Available | 790 | Open in IMG/M |
| 3300010397|Ga0134124_11352741 | Not Available | 737 | Open in IMG/M |
| 3300010399|Ga0134127_11369456 | Not Available | 778 | Open in IMG/M |
| 3300010399|Ga0134127_11886653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300010399|Ga0134127_12709012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300010399|Ga0134127_12907460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300010400|Ga0134122_10326691 | Not Available | 1327 | Open in IMG/M |
| 3300010403|Ga0134123_11328020 | Not Available | 756 | Open in IMG/M |
| 3300012484|Ga0157333_1037795 | Not Available | 509 | Open in IMG/M |
| 3300012927|Ga0137416_10646955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 925 | Open in IMG/M |
| 3300012930|Ga0137407_10862508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300012948|Ga0126375_11287301 | Not Available | 613 | Open in IMG/M |
| 3300013306|Ga0163162_11175621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300013306|Ga0163162_13181129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300014326|Ga0157380_11182437 | Not Available | 808 | Open in IMG/M |
| 3300014326|Ga0157380_12542958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300014497|Ga0182008_10179129 | Not Available | 1072 | Open in IMG/M |
| 3300014745|Ga0157377_11713143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300014968|Ga0157379_10572374 | Not Available | 1052 | Open in IMG/M |
| 3300015245|Ga0137409_10173790 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
| 3300015262|Ga0182007_10326396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300015371|Ga0132258_10914620 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300015373|Ga0132257_100003633 | All Organisms → cellular organisms → Bacteria | 14378 | Open in IMG/M |
| 3300019360|Ga0187894_10266344 | Not Available | 805 | Open in IMG/M |
| 3300025313|Ga0209431_10916351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 627 | Open in IMG/M |
| 3300025908|Ga0207643_10464313 | Not Available | 807 | Open in IMG/M |
| 3300025911|Ga0207654_10386216 | Not Available | 971 | Open in IMG/M |
| 3300025922|Ga0207646_11086857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300025923|Ga0207681_10366185 | Not Available | 1157 | Open in IMG/M |
| 3300025925|Ga0207650_10205944 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300025925|Ga0207650_10747602 | Not Available | 827 | Open in IMG/M |
| 3300025925|Ga0207650_10777902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300025926|Ga0207659_11526404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300025941|Ga0207711_10306409 | Not Available | 1466 | Open in IMG/M |
| 3300025942|Ga0207689_10536243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 982 | Open in IMG/M |
| 3300025960|Ga0207651_11016411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300025972|Ga0207668_10613800 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300025981|Ga0207640_10489955 | Not Available | 1021 | Open in IMG/M |
| 3300025981|Ga0207640_10886225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300025981|Ga0207640_12107436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300025986|Ga0207658_11665812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300026035|Ga0207703_11161539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300026078|Ga0207702_11442921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300026088|Ga0207641_10081939 | All Organisms → cellular organisms → Bacteria | 2803 | Open in IMG/M |
| 3300026095|Ga0207676_12268126 | Not Available | 541 | Open in IMG/M |
| 3300026116|Ga0207674_10056470 | All Organisms → cellular organisms → Bacteria | 3987 | Open in IMG/M |
| 3300026118|Ga0207675_100403457 | Not Available | 1347 | Open in IMG/M |
| 3300026118|Ga0207675_102348443 | Not Available | 546 | Open in IMG/M |
| 3300026469|Ga0257169_1075414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 548 | Open in IMG/M |
| 3300028381|Ga0268264_11842278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300032002|Ga0307416_100845117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1013 | Open in IMG/M |
| 3300032005|Ga0307411_10081943 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
| 3300032012|Ga0310902_10525420 | Not Available | 775 | Open in IMG/M |
| 3300032126|Ga0307415_101888905 | Not Available | 579 | Open in IMG/M |
| 3300033412|Ga0310810_10229831 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 9.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 8.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.39% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.69% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.69% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.85% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.85% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MRS1b_0421.00002860 | 2162886011 | Miscanthus Rhizosphere | LNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR |
| soilL2_1000691323 | 3300003319 | Sugarcane Root And Bulk Soil | RKIALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR* |
| Ga0062589_1006695452 | 3300004156 | Soil | NDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFMRK* |
| Ga0062589_1013789202 | 3300004156 | Soil | ALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0062589_1014992402 | 3300004156 | Soil | FWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0062592_1002433821 | 3300004480 | Soil | PARRILLNDFWNNNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFMRR* |
| Ga0062591_1001191103 | 3300004643 | Soil | SPARRILLNDFWNNNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFMRR* |
| Ga0062591_1026817542 | 3300004643 | Soil | ASPARKITLGDFWNNGFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0065712_104822721 | 3300005290 | Miscanthus Rhizosphere | ALNDFWNNNLKTHDGRKYVGDVGDGRSSVSIINFSGQITFMRR* |
| Ga0065712_106550941 | 3300005290 | Miscanthus Rhizosphere | IALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFMRR* |
| Ga0070670_1017201132 | 3300005331 | Switchgrass Rhizosphere | ALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR* |
| Ga0066388_1084646131 | 3300005332 | Tropical Forest Soil | PARKITLGEFWNNGFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0070680_1004955402 | 3300005336 | Corn Rhizosphere | VSLGQFWNNNFRTQDGRRYVGDVGDGRSSVSVTNFSGGITFLRR* |
| Ga0070692_101001164 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | SPARRIALNDFWNNNFKSQDGRRITGDVGDGRSSVSVTNFSGQITFMRK* |
| Ga0070669_1003750431 | 3300005353 | Switchgrass Rhizosphere | VAASPARRIALNDFWNDNFKSQDARRYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0070705_1002445801 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVAASPMRKIALNNFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0070694_1010641322 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0070662_1018689672 | 3300005457 | Corn Rhizosphere | LNDFWNKNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRK* |
| Ga0068867_1020723912 | 3300005459 | Miscanthus Rhizosphere | SPARKIALNDFWNKNFQSQDGRKIVGDVGDGRSSVSIINFSGQITFLRK* |
| Ga0070707_1014060581 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK* |
| Ga0070684_1010585552 | 3300005535 | Corn Rhizosphere | SPARKIALGDFWNNGFKTQDGRKYTGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0068853_1020496511 | 3300005539 | Corn Rhizosphere | IALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR* |
| Ga0070695_1018526632 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | FWNNGFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0070696_1015346481 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PTKQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK* |
| Ga0070693_1003525642 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0070693_1003926871 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RKIALNDFWNKNFKSTDGRKIVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0070693_1008105861 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | KQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK* |
| Ga0070664_1022258631 | 3300005564 | Corn Rhizosphere | SPARKIALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFMRR* |
| Ga0068857_1006495022 | 3300005577 | Corn Rhizosphere | KIALNDFWNKNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRK* |
| Ga0068857_1014401193 | 3300005577 | Corn Rhizosphere | PTRRIALGDFWNNGFKTQDGRRYTGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0068854_1007415051 | 3300005578 | Corn Rhizosphere | LVAASPAKKIALGDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0068854_1010680701 | 3300005578 | Corn Rhizosphere | DFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0068856_1016252732 | 3300005614 | Corn Rhizosphere | ASPTKQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK* |
| Ga0068859_1013764782 | 3300005617 | Switchgrass Rhizosphere | FKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0068861_1003439433 | 3300005719 | Switchgrass Rhizosphere | ILLNDFWNNNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFMRR* |
| Ga0068870_102395722 | 3300005840 | Miscanthus Rhizosphere | KIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0068863_1024649731 | 3300005841 | Switchgrass Rhizosphere | ALNDFWNKNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0068858_1000920281 | 3300005842 | Switchgrass Rhizosphere | QFWNDGFKTQDGRRYFGDVGDGRSSVSVTNFSGAITFLRR* |
| Ga0068858_1010189052 | 3300005842 | Switchgrass Rhizosphere | LVAASPARKIALGDFWNNGFKTQDGRKYTGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0075289_10153271 | 3300005888 | Rice Paddy Soil | RIALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0082029_10815101 | 3300006169 | Termite Nest | LNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR* |
| Ga0079220_115746411 | 3300006806 | Agricultural Soil | KLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK* |
| Ga0075428_1000552835 | 3300006844 | Populus Rhizosphere | FWNNGFKTQDGRKYVGDVGDGRSSVSVTNFTGQITFMRK* |
| Ga0075425_1025617482 | 3300006854 | Populus Rhizosphere | KQIKLNDFWNNGFRTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK* |
| Ga0079219_108392941 | 3300006954 | Agricultural Soil | LVAASPARRIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0075419_107340232 | 3300006969 | Populus Rhizosphere | DFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR* |
| Ga0075419_108780491 | 3300006969 | Populus Rhizosphere | TLGQFWNDNFKTQDGRRYVGDVGDGRSSVSVTNFSGAITFIRR* |
| Ga0111539_103411111 | 3300009094 | Populus Rhizosphere | SAAKKVSLGQFWNNNFRTQDGRRYVGDVGDGRSSVSVTNFSGSITFLRR* |
| Ga0105247_102312941 | 3300009101 | Switchgrass Rhizosphere | AASPARRIALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0105247_116825972 | 3300009101 | Switchgrass Rhizosphere | AASPTKQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK* |
| Ga0114129_100927545 | 3300009147 | Populus Rhizosphere | WNNNMKTHDGRRIVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0114129_122646422 | 3300009147 | Populus Rhizosphere | RLVVASPAKKITLGQFWNSNFKTQDGRRYVGDVGDGRSSVSVTNFSGAITFIRR* |
| Ga0105243_116935092 | 3300009148 | Miscanthus Rhizosphere | IALNDFWNNNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR* |
| Ga0111538_121902171 | 3300009156 | Populus Rhizosphere | QFWNNGFKTTGDGRRVIGDVGDGRSSVSVINFSGSITFLRK* |
| Ga0111538_125387981 | 3300009156 | Populus Rhizosphere | KIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0075423_109477271 | 3300009162 | Populus Rhizosphere | IALNDFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0105242_112412732 | 3300009176 | Miscanthus Rhizosphere | FLEYYFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0105248_133257261 | 3300009177 | Switchgrass Rhizosphere | AASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0126305_105952302 | 3300010036 | Serpentine Soil | RIALGDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFFRR* |
| Ga0126309_108783172 | 3300010039 | Serpentine Soil | LNDFWNKNFKTQDGRKMVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0126372_101807251 | 3300010360 | Tropical Forest Soil | NDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0134126_123527951 | 3300010396 | Terrestrial Soil | IALNDFWNKNFKTQDGRKVVGDVGDGRSSVSIINFSGQITFMRR* |
| Ga0134124_111246281 | 3300010397 | Terrestrial Soil | AASPARKIALGEFWNNGFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0134124_111622841 | 3300010397 | Terrestrial Soil | PARRIALNDFWNSNFKSQDGRKVVGDVGDGRASVSIINFNGQISFMRR* |
| Ga0134124_113527411 | 3300010397 | Terrestrial Soil | ARRIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR* |
| Ga0134127_113694561 | 3300010399 | Terrestrial Soil | NNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0134127_118866531 | 3300010399 | Terrestrial Soil | SAAKKVSLGQFWNNNFRTQDGRRYVGDVGDGRSSVSVTNFSGGITFLRR* |
| Ga0134127_127090121 | 3300010399 | Terrestrial Soil | RRIALNDFWNNNFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0134127_129074602 | 3300010399 | Terrestrial Soil | FWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0134122_103266911 | 3300010400 | Terrestrial Soil | RKITLNQFWNNGFKTLGDGRRVIGDVGDGRSSVSVMNFSGSITFLRK* |
| Ga0134123_113280202 | 3300010403 | Terrestrial Soil | WNDGFKTQDGRRYFGDVGDGRSSVSVTNFSGAITFLRR* |
| Ga0157333_10377952 | 3300012484 | Soil | WNTNFKKLGDGRKFVGDVGDGRASVSVTNFSGGITFIRR* |
| Ga0137416_106469551 | 3300012927 | Vadose Zone Soil | FWNDGFKAFSDGRRYIGDVGDGRSSVSVTTFSGTITFMRK* |
| Ga0137407_108625081 | 3300012930 | Vadose Zone Soil | PFWNDGFKALGDGRKYVGDVGDGRSSVSVTTFSGTITFMRR* |
| Ga0126375_112873011 | 3300012948 | Tropical Forest Soil | FWNNGFKTLGDGRRLVGDVGDGRSSVSVTNFSGQITFMRR* |
| Ga0163162_111756211 | 3300013306 | Switchgrass Rhizosphere | KIALGDFWNNGFKTQDGRKYTGDVGDGRSSVSVTNFSGQITFLRK* |
| Ga0163162_131811291 | 3300013306 | Switchgrass Rhizosphere | LVAASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRYSVSVTNFRGQITFLRR* |
| Ga0157380_111824371 | 3300014326 | Switchgrass Rhizosphere | RLEAASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0157380_125429581 | 3300014326 | Switchgrass Rhizosphere | ASPARRIALNDFWNNNLKTHDGRTYVGDVGDGRSSVSIINFSGQITFMRR* |
| Ga0182008_101791292 | 3300014497 | Rhizosphere | DFWNNNFKTQDGRKIVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0157377_117131432 | 3300014745 | Miscanthus Rhizosphere | RIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0157379_105723742 | 3300014968 | Switchgrass Rhizosphere | LEAASPARRIALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR* |
| Ga0137409_101737901 | 3300015245 | Vadose Zone Soil | NGFKALGDGRKYVGDVGDGRSSVSVTTFSGTITFMRR* |
| Ga0182007_103263961 | 3300015262 | Rhizosphere | RLVAASPARRIALNDFWNNNFKTQDGRKIVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0132258_109146204 | 3300015371 | Arabidopsis Rhizosphere | LNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR* |
| Ga0132257_10000363317 | 3300015373 | Arabidopsis Rhizosphere | FWNDGFKTQDGRRYFGDVGDGRSSVSVTNFSGAITFLRR* |
| Ga0187894_102663442 | 3300019360 | Microbial Mat On Rocks | NNGLKTQDGRKYVGDVGDGRSSVSVTNFSGSITFMRR |
| Ga0209431_109163511 | 3300025313 | Soil | KKFVLGQFWNSGFKTLGDGRKYMGDVGDGRSSVTVTNFRGSITFLRR |
| Ga0207643_104643132 | 3300025908 | Miscanthus Rhizosphere | AASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR |
| Ga0207654_103862162 | 3300025911 | Corn Rhizosphere | IALNDFWNQNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR |
| Ga0207646_110868571 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLARTAAEGVKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRK |
| Ga0207681_103661852 | 3300025923 | Switchgrass Rhizosphere | VAASPARRIALNDFWNDNFKSQDARRYVGDVGDGRSSVSVTNFSGQITFLRR |
| Ga0207650_102059441 | 3300025925 | Switchgrass Rhizosphere | NFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR |
| Ga0207650_107476022 | 3300025925 | Switchgrass Rhizosphere | NNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFLRR |
| Ga0207650_107779022 | 3300025925 | Switchgrass Rhizosphere | GDFWNDGFKTQDGRKYVGDVGDGRSSVSVTNFNGSITFMRR |
| Ga0207659_115264041 | 3300025926 | Miscanthus Rhizosphere | ASPARKIALNDFWNKNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRK |
| Ga0207711_103064092 | 3300025941 | Switchgrass Rhizosphere | FWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK |
| Ga0207689_105362432 | 3300025942 | Miscanthus Rhizosphere | MVATSPARKIKLGDFWNDGFKTQDGRKYVGDVGDGRSSVSVTNFNGSITFMRR |
| Ga0207651_110164111 | 3300025960 | Switchgrass Rhizosphere | DRFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK |
| Ga0207668_106138001 | 3300025972 | Switchgrass Rhizosphere | VAASPARKIALGDFWNNGFKTQDGRKYTGDVGDGRSSVSVTNFSGQITFLRK |
| Ga0207640_104899551 | 3300025981 | Corn Rhizosphere | FRLVAASPTKQIKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGSITFLRR |
| Ga0207640_108862253 | 3300025981 | Corn Rhizosphere | IALNDFWNSNFKNQDGRKLVGDVGDGRSSVSVMNFSGQITFLRR |
| Ga0207640_121074362 | 3300025981 | Corn Rhizosphere | ALNDFWNSNFKSQDGRKIVGDVGDGRSSVSIINFSGQITFLRR |
| Ga0207658_116658121 | 3300025986 | Switchgrass Rhizosphere | SPAKRVNLGDFWNDRFKTQDGRRYVGDVGDGRSSVSVTNFSGQITFLRK |
| Ga0207703_111615391 | 3300026035 | Switchgrass Rhizosphere | SPARKIKLGDFWNDGFKTQDGRKYVGDVGDGRSSVSVTNFNGSITFMRR |
| Ga0207702_114429212 | 3300026078 | Corn Rhizosphere | RRIALNDFWNKNFKTQDGRKVVGDVGDGRSSVSIINFSGQITFMRR |
| Ga0207641_100819391 | 3300026088 | Switchgrass Rhizosphere | NNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR |
| Ga0207676_122681262 | 3300026095 | Switchgrass Rhizosphere | WNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRR |
| Ga0207674_100564701 | 3300026116 | Corn Rhizosphere | RLEAASQARRIALNDFWNDRLKTHDGRKYVGDVGDGRSSVSIINFSGQITFMRR |
| Ga0207675_1004034573 | 3300026118 | Switchgrass Rhizosphere | ILLNDFWNNNMKTQDGRKIVGDVGDGRSSVSVTNFSGQITFMRR |
| Ga0207675_1023484432 | 3300026118 | Switchgrass Rhizosphere | IKLNDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK |
| Ga0257169_10754141 | 3300026469 | Soil | LVAASSAKRIAIGPFWNDGFKALGDGRKYVGDVGDGRSSVSVTTFSGTITFMRR |
| Ga0268264_118422782 | 3300028381 | Switchgrass Rhizosphere | RLEAASPARKIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSIINFSGQITFLRR |
| Ga0307416_1008451171 | 3300032002 | Rhizosphere | ASPARKIALGDFWNNGFKTQDGRKYVGDVGDGRSSVSVTNFGGQITFLRR |
| Ga0307411_100819431 | 3300032005 | Rhizosphere | WNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR |
| Ga0310902_105254201 | 3300032012 | Soil | LGQFWNNNFRTQDGRRYVGDVGDGRSSVSVTNFSGAITFLRR |
| Ga0307415_1018889052 | 3300032126 | Rhizosphere | WNNGFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFLRK |
| Ga0310810_102298311 | 3300033412 | Soil | LVAASPARRIALNDFWNNNFKTQDGRKYVGDVGDGRSSVSVTNFSGQITFMRR |
| ⦗Top⦘ |