| Basic Information | |
|---|---|
| Family ID | F076471 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.20 % |
| % of genes near scaffold ends (potentially truncated) | 27.97 % |
| % of genes from short scaffolds (< 2000 bps) | 79.66 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.864 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (12.712 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.169 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (75.424 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00326 | Peptidase_S9 | 33.05 |
| PF00733 | Asn_synthase | 14.41 |
| PF07676 | PD40 | 8.47 |
| PF13471 | Transglut_core3 | 5.93 |
| PF13537 | GATase_7 | 3.39 |
| PF00664 | ABC_membrane | 0.85 |
| PF04542 | Sigma70_r2 | 0.85 |
| PF02239 | Cytochrom_D1 | 0.85 |
| PF04264 | YceI | 0.85 |
| PF06114 | Peptidase_M78 | 0.85 |
| PF13435 | Cytochrome_C554 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.85 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.85 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.85 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.85 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.86 % |
| Unclassified | root | N/A | 38.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_8216588 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300000953|JGI11615J12901_12717543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1055 | Open in IMG/M |
| 3300001464|JGI12363J15224_100088 | All Organisms → cellular organisms → Bacteria | 22413 | Open in IMG/M |
| 3300002568|C688J35102_120683876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1348 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10098589 | Not Available | 533 | Open in IMG/M |
| 3300003203|JGI25406J46586_10007123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5124 | Open in IMG/M |
| 3300003267|soilL1_10042251 | All Organisms → cellular organisms → Bacteria | 4934 | Open in IMG/M |
| 3300003267|soilL1_10073571 | All Organisms → cellular organisms → Bacteria | 5496 | Open in IMG/M |
| 3300003319|soilL2_10066406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5485 | Open in IMG/M |
| 3300004156|Ga0062589_100284112 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300004156|Ga0062589_101870991 | Not Available | 604 | Open in IMG/M |
| 3300004479|Ga0062595_100168157 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300004479|Ga0062595_102268508 | Not Available | 534 | Open in IMG/M |
| 3300004480|Ga0062592_100797542 | Not Available | 837 | Open in IMG/M |
| 3300004801|Ga0058860_10580202 | Not Available | 556 | Open in IMG/M |
| 3300005289|Ga0065704_10230684 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300005289|Ga0065704_10550260 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005290|Ga0065712_10023927 | All Organisms → cellular organisms → Bacteria | 2731 | Open in IMG/M |
| 3300005293|Ga0065715_10137379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 1907 | Open in IMG/M |
| 3300005293|Ga0065715_10524557 | Not Available | 761 | Open in IMG/M |
| 3300005331|Ga0070670_100035022 | All Organisms → cellular organisms → Bacteria | 4321 | Open in IMG/M |
| 3300005334|Ga0068869_100833170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 795 | Open in IMG/M |
| 3300005334|Ga0068869_101087579 | Not Available | 699 | Open in IMG/M |
| 3300005338|Ga0068868_101513401 | Not Available | 629 | Open in IMG/M |
| 3300005345|Ga0070692_10577683 | Not Available | 740 | Open in IMG/M |
| 3300005345|Ga0070692_10887254 | Not Available | 615 | Open in IMG/M |
| 3300005347|Ga0070668_102110602 | Not Available | 520 | Open in IMG/M |
| 3300005353|Ga0070669_100029712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 3942 | Open in IMG/M |
| 3300005355|Ga0070671_100298297 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300005364|Ga0070673_102203394 | Not Available | 524 | Open in IMG/M |
| 3300005441|Ga0070700_100658534 | Not Available | 828 | Open in IMG/M |
| 3300005444|Ga0070694_100022478 | All Organisms → cellular organisms → Bacteria | 4041 | Open in IMG/M |
| 3300005459|Ga0068867_100599100 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005459|Ga0068867_101975093 | Not Available | 551 | Open in IMG/M |
| 3300005539|Ga0068853_100469971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1184 | Open in IMG/M |
| 3300005543|Ga0070672_101096752 | Not Available | 707 | Open in IMG/M |
| 3300005546|Ga0070696_102008337 | Not Available | 502 | Open in IMG/M |
| 3300005564|Ga0070664_101768427 | Not Available | 586 | Open in IMG/M |
| 3300005578|Ga0068854_100701890 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300005615|Ga0070702_100159688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 1456 | Open in IMG/M |
| 3300005617|Ga0068859_100147216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 2430 | Open in IMG/M |
| 3300005617|Ga0068859_100188283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 2148 | Open in IMG/M |
| 3300005617|Ga0068859_100298248 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 1705 | Open in IMG/M |
| 3300005617|Ga0068859_101201769 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005617|Ga0068859_103172280 | Not Available | 500 | Open in IMG/M |
| 3300005618|Ga0068864_100792826 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300005840|Ga0068870_10581899 | Not Available | 758 | Open in IMG/M |
| 3300005841|Ga0068863_100473025 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300005841|Ga0068863_100557696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1132 | Open in IMG/M |
| 3300005842|Ga0068858_100334999 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300005843|Ga0068860_102644383 | Not Available | 521 | Open in IMG/M |
| 3300006169|Ga0082029_1586324 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300006358|Ga0068871_100968512 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300006755|Ga0079222_10062986 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300009174|Ga0105241_10429806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1164 | Open in IMG/M |
| 3300009176|Ga0105242_12830347 | Not Available | 535 | Open in IMG/M |
| 3300009545|Ga0105237_10558204 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300009545|Ga0105237_11207271 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300009551|Ga0105238_10000779 | All Organisms → cellular organisms → Bacteria | 33108 | Open in IMG/M |
| 3300009840|Ga0126313_10018255 | All Organisms → cellular organisms → Bacteria | 4616 | Open in IMG/M |
| 3300010042|Ga0126314_10333616 | Not Available | 1086 | Open in IMG/M |
| 3300010044|Ga0126310_10555247 | Not Available | 849 | Open in IMG/M |
| 3300010044|Ga0126310_11209035 | Not Available | 607 | Open in IMG/M |
| 3300010045|Ga0126311_10000025 | All Organisms → cellular organisms → Bacteria | 88634 | Open in IMG/M |
| 3300010045|Ga0126311_10102651 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 1966 | Open in IMG/M |
| 3300010045|Ga0126311_10518713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 934 | Open in IMG/M |
| 3300010371|Ga0134125_12849144 | Not Available | 525 | Open in IMG/M |
| 3300010397|Ga0134124_10006123 | All Organisms → cellular organisms → Bacteria | 9648 | Open in IMG/M |
| 3300010397|Ga0134124_11147616 | Not Available | 795 | Open in IMG/M |
| 3300010399|Ga0134127_10031090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 4264 | Open in IMG/M |
| 3300010400|Ga0134122_10471641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1128 | Open in IMG/M |
| 3300010400|Ga0134122_12391316 | Not Available | 575 | Open in IMG/M |
| 3300010401|Ga0134121_10001137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 25818 | Open in IMG/M |
| 3300011332|Ga0126317_10608402 | Not Available | 683 | Open in IMG/M |
| 3300012212|Ga0150985_118879352 | Not Available | 636 | Open in IMG/M |
| 3300012469|Ga0150984_112805259 | Not Available | 599 | Open in IMG/M |
| 3300013297|Ga0157378_11197669 | Not Available | 799 | Open in IMG/M |
| 3300013297|Ga0157378_11213561 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300013306|Ga0163162_10003205 | All Organisms → cellular organisms → Bacteria | 15652 | Open in IMG/M |
| 3300013306|Ga0163162_13438188 | Not Available | 505 | Open in IMG/M |
| 3300014325|Ga0163163_12059557 | Not Available | 630 | Open in IMG/M |
| 3300014326|Ga0157380_12812780 | Not Available | 553 | Open in IMG/M |
| 3300014745|Ga0157377_10540061 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300014745|Ga0157377_11354501 | Not Available | 559 | Open in IMG/M |
| 3300014968|Ga0157379_10642914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 993 | Open in IMG/M |
| 3300018476|Ga0190274_11226580 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300018476|Ga0190274_13777597 | Not Available | 512 | Open in IMG/M |
| 3300025900|Ga0207710_10002173 | All Organisms → cellular organisms → Bacteria | 9219 | Open in IMG/M |
| 3300025900|Ga0207710_10209350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 965 | Open in IMG/M |
| 3300025904|Ga0207647_10069457 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 2130 | Open in IMG/M |
| 3300025911|Ga0207654_10019148 | All Organisms → cellular organisms → Bacteria | 3606 | Open in IMG/M |
| 3300025913|Ga0207695_11490457 | Not Available | 557 | Open in IMG/M |
| 3300025914|Ga0207671_11040373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300025923|Ga0207681_10144706 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 1774 | Open in IMG/M |
| 3300025923|Ga0207681_10276177 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300025924|Ga0207694_10079529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 2571 | Open in IMG/M |
| 3300025925|Ga0207650_10753318 | Not Available | 824 | Open in IMG/M |
| 3300025926|Ga0207659_10607301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 933 | Open in IMG/M |
| 3300025930|Ga0207701_10332110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1317 | Open in IMG/M |
| 3300025931|Ga0207644_10883054 | Not Available | 749 | Open in IMG/M |
| 3300025935|Ga0207709_10154106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1595 | Open in IMG/M |
| 3300025935|Ga0207709_10690912 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300025941|Ga0207711_10026872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 4831 | Open in IMG/M |
| 3300025941|Ga0207711_11005745 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300025942|Ga0207689_11016752 | Not Available | 699 | Open in IMG/M |
| 3300025945|Ga0207679_10402456 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300025960|Ga0207651_11583980 | Not Available | 590 | Open in IMG/M |
| 3300025960|Ga0207651_11878952 | Not Available | 539 | Open in IMG/M |
| 3300025981|Ga0207640_11629617 | Not Available | 582 | Open in IMG/M |
| 3300026041|Ga0207639_10462288 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300026089|Ga0207648_10174674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1900 | Open in IMG/M |
| 3300026089|Ga0207648_10399012 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300026095|Ga0207676_12173675 | Not Available | 553 | Open in IMG/M |
| 3300028379|Ga0268266_10431866 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter | 1250 | Open in IMG/M |
| 3300028380|Ga0268265_10363043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1326 | Open in IMG/M |
| 3300028380|Ga0268265_12386473 | Not Available | 535 | Open in IMG/M |
| 3300028381|Ga0268264_10068770 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
| 3300028381|Ga0268264_10178259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1928 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 12.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 10.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 7.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.39% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.69% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001464 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0019.00002110 | 2162886013 | Switchgrass Rhizosphere | MKKNEYDAAEVVEIGLAQAVVLGQKTVDLDLDSTGMDPIDRRYEE |
| JGI11615J12901_127175433 | 3300000953 | Soil | MKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSG |
| JGI12363J15224_1000883 | 3300001464 | Soil | MKQNEYDAAEVVEIGPAQSIVLGEKVSIPDLDSTGGEPMEWQYKD* |
| C688J35102_1206838763 | 3300002568 | Soil | MKKNEYDAAEVVELGEVRSIVLGHKTVTPELDSTAMEPMDRQYEE* |
| JGIcombinedJ43975_100985892 | 3300002899 | Soil | MKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE* |
| JGI25406J46586_100071235 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MKKNEYDAAEVVEIGAAQAVVLGQKILLPDFDSSGMDPIDRHYEE* |
| soilL1_100422514 | 3300003267 | Sugarcane Root And Bulk Soil | MKKNEYDAAEVVELGEARSVVLGQKAITLDLDSSGMEPMDRQYED* |
| soilL1_100735713 | 3300003267 | Sugarcane Root And Bulk Soil | MKKNEYDAAEVVEIGLAQAVVLGQKTIELDLDSTGMDPIDRHYEE* |
| soilL2_100664063 | 3300003319 | Sugarcane Root And Bulk Soil | MKNNEYDAAAVVEIGQAQSLVLGTKTVDPDLDSTLMEPIDCRYQE* |
| Ga0062589_1002841122 | 3300004156 | Soil | MKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE* |
| Ga0062589_1018709911 | 3300004156 | Soil | AAEVVEIGAARAIVQGEKTVVPDLDSSGMEPIQRHYEEG* |
| Ga0062595_1001681572 | 3300004479 | Soil | MKNNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE* |
| Ga0062595_1022685083 | 3300004479 | Soil | MKNNEYDAAEVVEIGKAQSVVLGTKTIVPDLDSSGMEPIERWYVE* |
| Ga0062592_1007975421 | 3300004480 | Soil | MKNNEYDAAEVVEIGQAQAIVLGSKTAMPDFDSTLMDPLDHHYEE* |
| Ga0058860_105802022 | 3300004801 | Host-Associated | MKKNEYDAAEVVEIGEAQSVVLGVKINEPGLDFMEPWDLRYEP* |
| Ga0065704_102306842 | 3300005289 | Switchgrass Rhizosphere | MKKNEYDAAEVVEIGLAQAVVLGQKTVDLDLDSTGMDPIDRRYEE* |
| Ga0065704_105502602 | 3300005289 | Switchgrass Rhizosphere | MKNNEYDAAEVVEIGPAQAIVLGEKTIVPDLDSTLMEPIDQHYQE* |
| Ga0065712_100239274 | 3300005290 | Miscanthus Rhizosphere | MKKNEYDAAEVVELGEAQSVVLGGKILMPGLDNPGMEPFDRQYEE* |
| Ga0065715_101373792 | 3300005293 | Miscanthus Rhizosphere | MKNNEYNAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE* |
| Ga0065715_105245571 | 3300005293 | Miscanthus Rhizosphere | MKKNEYDAAEVVELGEAQSVVLGGKILMPGLDNPGMEPFDRQ |
| Ga0070670_1000350225 | 3300005331 | Switchgrass Rhizosphere | MKKNEYDAAEVVEIGEARSVVLGYKTSVPELDCPGMEPFDRQYQE* |
| Ga0068869_1008331703 | 3300005334 | Miscanthus Rhizosphere | MKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLD |
| Ga0068869_1010875792 | 3300005334 | Miscanthus Rhizosphere | MKTNEYDAAEVVEIGPAQEIVLGGKIGMVGLDSSGMEPIDRVYEDD* |
| Ga0068868_1015134012 | 3300005338 | Miscanthus Rhizosphere | NAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE* |
| Ga0070692_105776833 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKNEYDAAEVVEIGEARSVVLGEKLLMPGLDSSGMEPIDRQYQE* |
| Ga0070692_108872543 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQH |
| Ga0070668_1021106022 | 3300005347 | Switchgrass Rhizosphere | MKNNEYDAAEVVEIGQAQAIVLGEKINLPDLDSLGVEPMDWRYQE* |
| Ga0070669_1000297123 | 3300005353 | Switchgrass Rhizosphere | MKNNEYDAAEVAEIGQAQAIVLGEKTIVPDLDSTLLEPLEQHYQE* |
| Ga0070671_1002982972 | 3300005355 | Switchgrass Rhizosphere | MKNNEYDAAEVVEIGQAQAIVLGEKINLPDLDSLGVEPMDWHYQE* |
| Ga0070673_1022033942 | 3300005364 | Switchgrass Rhizosphere | MKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEW |
| Ga0070700_1006585342 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQNEYNAAEVVEIGPAQAIVLGQKIDERDFDSLGVEPMDWQYKD* |
| Ga0070694_1000224781 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE* |
| Ga0068867_1005991002 | 3300005459 | Miscanthus Rhizosphere | RKMKQNEYNAAEVVEIGPAQEIVLGEKIDVRDFDSLTMDPFDWRYVEP* |
| Ga0068867_1019750933 | 3300005459 | Miscanthus Rhizosphere | MKKNEYDAAEVVEIGPARAIVLGSKILMPDLDSSGMDPIDRHYEE* |
| Ga0068853_1004699712 | 3300005539 | Corn Rhizosphere | MKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQHYQP* |
| Ga0070672_1010967522 | 3300005543 | Miscanthus Rhizosphere | MKNNEYDAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQHYQP* |
| Ga0070696_1020083372 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLEMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE* |
| Ga0070664_1017684271 | 3300005564 | Corn Rhizosphere | MKQNEYDAAEVVEVGKAQSVVLGEKTPVIELDSAGMEPPERQYLW* |
| Ga0068854_1007018902 | 3300005578 | Corn Rhizosphere | MKKNEYDAAEVVEIGPARAIVLGSKILMPDLDSSGMDPMDRHYEE* |
| Ga0070702_1001596882 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | SRKMKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE* |
| Ga0068859_1001472162 | 3300005617 | Switchgrass Rhizosphere | MKHNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYEE* |
| Ga0068859_1001882832 | 3300005617 | Switchgrass Rhizosphere | AEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE* |
| Ga0068859_1002982482 | 3300005617 | Switchgrass Rhizosphere | SGVRKMKNNEYDAAEVVEIGQAQAIVLGSKTAMPDFDSTLMDPLDHHYEE* |
| Ga0068859_1012017692 | 3300005617 | Switchgrass Rhizosphere | VRRLEMKNNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE* |
| Ga0068859_1031722801 | 3300005617 | Switchgrass Rhizosphere | MKQNEYNAAEVIEIGPAQAIVLGEKIPVPDLDSTGGEPMEWRYQE* |
| Ga0068864_1007928262 | 3300005618 | Switchgrass Rhizosphere | KMKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYQE* |
| Ga0068870_105818992 | 3300005840 | Miscanthus Rhizosphere | MKHNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYQE* |
| Ga0068863_1004730252 | 3300005841 | Switchgrass Rhizosphere | VVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE* |
| Ga0068863_1005576962 | 3300005841 | Switchgrass Rhizosphere | MKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYQE* |
| Ga0068858_1003349993 | 3300005842 | Switchgrass Rhizosphere | MKKNEYDAAEVVELGEARSVVLGGKILMPGLDNPGMEPFDRQYEE* |
| Ga0068860_1026443831 | 3300005843 | Switchgrass Rhizosphere | MKNNEYDAAEVVEIGAAQALVLGVKTIDPDLDSTLMEPLEKHYQE* |
| Ga0082029_15863242 | 3300006169 | Termite Nest | MKKNEYDAAEVVELGAAQSVVLGEKTWVPELDSSGMEPLDRQFVE* |
| Ga0068871_1009685122 | 3300006358 | Miscanthus Rhizosphere | EVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYEE* |
| Ga0079222_100629861 | 3300006755 | Agricultural Soil | MKQNEYDAAEVVELGPAREIVLGEKISVPDLDSTGGEPMEWRYKE* |
| Ga0105241_104298062 | 3300009174 | Corn Rhizosphere | MKQNEYNAAEVVELGPAQAIVLGEKIPVPDLDSTGGEPMEWRY |
| Ga0105242_128303472 | 3300009176 | Miscanthus Rhizosphere | MKQNEYNAAEVVELGPAQAIVLGEKIIVLDLDSTGGEPMEWRYQE* |
| Ga0105237_105582042 | 3300009545 | Corn Rhizosphere | MKQNEYNAAEVVEIGPAQEIVLGEKIDVRDFDSLTMDPFDWRYVEP* |
| Ga0105237_112072711 | 3300009545 | Corn Rhizosphere | VRRLEMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE* |
| Ga0105238_1000077910 | 3300009551 | Corn Rhizosphere | MKQNEYNAAEVVEIGPAQAIVLGQKIDERDLDSLGVDPMDWQYKE* |
| Ga0126313_100182553 | 3300009840 | Serpentine Soil | MKKNEYDAAEVVEIGDAQSVVLGGKTIVLDFDWTGMEPIERRYEI* |
| Ga0126314_103336164 | 3300010042 | Serpentine Soil | MKNNEYNAAEVVEIGPAQAIVLGGKILMSGPDSSGMEPFDRVYEAE* |
| Ga0126310_105552472 | 3300010044 | Serpentine Soil | MQKNEYNAAEVVEIGKAKSVVLGGKTIIPDLDSSGMEPLDVRYEE* |
| Ga0126310_112090351 | 3300010044 | Serpentine Soil | MEKNEYDAAEVIEIGEAQSVVLGIKVSVPDLDSSLMEPIERRYQE* |
| Ga0126311_1000002544 | 3300010045 | Serpentine Soil | MKQNEYDAAEVVEIGSARAVVLGEKVNIPDLDSTGGEPMEWQYKD* |
| Ga0126311_101026512 | 3300010045 | Serpentine Soil | MKKNEYDAAEVVEIGEAQSVVLGGKTSVPELDCAGMDPFDRQYEY* |
| Ga0126311_105187131 | 3300010045 | Serpentine Soil | MKNNEYDAAEAVEIGQAAALVLGEKILVPDLDSSGGEPIDFHYRVDF* |
| Ga0134125_128491442 | 3300010371 | Terrestrial Soil | MKQNEYDAAEVVEIGPARAIVLGEKVSIPDLDSTGGEPMEWQYKD* |
| Ga0134124_100061231 | 3300010397 | Terrestrial Soil | MKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMDPIEQHYQP* |
| Ga0134124_111476162 | 3300010397 | Terrestrial Soil | MKQNEYNAAEVVEIGPARAIVLGEKIPVPDLDSTGGEPMEWQYKE* |
| Ga0134127_100310902 | 3300010399 | Terrestrial Soil | MKKNEYDAAEVVEIGEARSVVLGTKVFVPELDSSGMEPIQRRYEE* |
| Ga0134122_104716411 | 3300010400 | Terrestrial Soil | MKQNEYDAAEVVEIGAARAIVLGEKINVPDLDSTGGEPMQWQYKD* |
| Ga0134122_123913161 | 3300010400 | Terrestrial Soil | MKQNDYDAAEVVELGPAEAIVLGEKISVPDLDFTGGDPMEWRYRE* |
| Ga0134121_100011379 | 3300010401 | Terrestrial Soil | MKNNEYDAAEVVEIGQAQAIVLGEKTIVPDLDSTLMEPLEQHYQE* |
| Ga0126317_106084022 | 3300011332 | Soil | MKKNEYDAAEVVELGEARSIVLGEKILMPGLDSSGMEPFDRQYQE* |
| Ga0150985_1188793522 | 3300012212 | Avena Fatua Rhizosphere | MKKNEYDAAEVVELGEVRSIVLGHKTVTPELDSTAMEPMDRLYEE* |
| Ga0150984_1128052592 | 3300012469 | Avena Fatua Rhizosphere | MKKNEYDAAEVVEIGEARAIVLGQKILMQGLDSSGMEPIDRQYEE* |
| Ga0157378_111976692 | 3300013297 | Miscanthus Rhizosphere | MKQNEYDAAEVVEIGPARAIVLGEKVSIPDLDSTGGEPMQWQYKD* |
| Ga0157378_112135612 | 3300013297 | Miscanthus Rhizosphere | AEVVEIGEARAVVLGRKIDTLDLDFSGMDPMDRQYEL* |
| Ga0163162_100032055 | 3300013306 | Switchgrass Rhizosphere | MKQNEYNAAEVVEIGPAQAIVLGQKIIVPDLDSTGGEPMEWRYEE* |
| Ga0163162_134381881 | 3300013306 | Switchgrass Rhizosphere | MKKNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE* |
| Ga0163163_120595571 | 3300014325 | Switchgrass Rhizosphere | MKNNEYDASEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQHYQP* |
| Ga0157380_128127801 | 3300014326 | Switchgrass Rhizosphere | MKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE |
| Ga0157377_105400612 | 3300014745 | Miscanthus Rhizosphere | SGVRRLEMKNNEYDAAEVVEIGPAQEIVLGEKILAQGLDSSGMEPIDRQYQE* |
| Ga0157377_113545012 | 3300014745 | Miscanthus Rhizosphere | MKDNEYDAAEVVEIGPAQEIVLGGKIMLAGLDSSGMEPMDRVYEDW* |
| Ga0157379_106429141 | 3300014968 | Switchgrass Rhizosphere | MKNNEYDAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPI |
| Ga0190274_112265801 | 3300018476 | Soil | MKKNEYDAAEVVEVGDAQSVVLGGKTTVLELDWTGMEPIQRRYEF |
| Ga0190274_137775972 | 3300018476 | Soil | MKKNEYDAAEVVEIGEAQSVVLGGKTIDQDVDWSGMEPLDRHYEF |
| Ga0207710_100021734 | 3300025900 | Switchgrass Rhizosphere | MKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPIEQHYQP |
| Ga0207710_102093502 | 3300025900 | Switchgrass Rhizosphere | MKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYQE |
| Ga0207647_100694574 | 3300025904 | Corn Rhizosphere | MKNNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE |
| Ga0207654_100191482 | 3300025911 | Corn Rhizosphere | MKQNEYDAAEVVEIGPAQSIVLGEKVSIPDLDSTGGEPMEWQYKD |
| Ga0207695_114904572 | 3300025913 | Corn Rhizosphere | MKKNEYDAAEVVEIGPARAIVLGSKILMPDLDSSGMDPMDRHYEE |
| Ga0207671_110403732 | 3300025914 | Corn Rhizosphere | MKKNEYDAAEVVEIGEAHSVVLGVKTVDPGLDSSGMEPIDRWYQE |
| Ga0207681_101447062 | 3300025923 | Switchgrass Rhizosphere | MKNNEYDAAEVAEIGQAQAIVLGEKTIVPDLDSTLLEPLEQHYQE |
| Ga0207681_102761772 | 3300025923 | Switchgrass Rhizosphere | MKNNEYDAAEVVEIGQAQAIVLGSKTAMPDFDSTLMDPLDHHYEE |
| Ga0207694_100795292 | 3300025924 | Corn Rhizosphere | MKQNEYNAAEVVEIGPAQAIVLGQKIDERDLDSLGVDPMDWQYKE |
| Ga0207650_107533182 | 3300025925 | Switchgrass Rhizosphere | MKKNEYDAAEVVEIGEARSVVLGYKTSVPELDCPGMEPFDRQYQE |
| Ga0207659_106073011 | 3300025926 | Miscanthus Rhizosphere | MKNNEYDAAEVVEIGQAQAIVLGSKTAMPDFDSTL |
| Ga0207701_103321102 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKNNEYDAAEVVEIGQAQAIVLGEKINLPDLDSLGVEPMDWRYQE |
| Ga0207644_108830542 | 3300025931 | Switchgrass Rhizosphere | MKNNEYDAAEVVEIGQAQAIVLGEKINLPDLDSLGVEPMDWHYQE |
| Ga0207709_101541062 | 3300025935 | Miscanthus Rhizosphere | MKKNEYDAAEVVEIGPARAIVLGSKILMPDLDSSGMDPIDRHYEE |
| Ga0207709_106909122 | 3300025935 | Miscanthus Rhizosphere | MKQNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE |
| Ga0207711_100268722 | 3300025941 | Switchgrass Rhizosphere | MKHNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMDWRYEE |
| Ga0207711_110057451 | 3300025941 | Switchgrass Rhizosphere | AAEVVELGEAQSVVLGGKILMPGLDNPGMEPFDRQYEE |
| Ga0207689_110167522 | 3300025942 | Miscanthus Rhizosphere | MKTNEYDAAEVVEIGPAQEIVLGGKIGMVGLDSSGMEPIDRVYEDD |
| Ga0207679_104024562 | 3300025945 | Corn Rhizosphere | MKQNEYNAAEVVEIGPAQEIVLGEKIDVRDFDSLIMDTFDWRYLEP |
| Ga0207651_115839802 | 3300025960 | Switchgrass Rhizosphere | MKKNEYDAAEVVEIGEAQSVVLGVKINEPGLDFMEPWDLRYEP |
| Ga0207651_118789521 | 3300025960 | Switchgrass Rhizosphere | MKKNEYDAAEVVEIGEARAIVLGQKILMPDLDSSGMEPID |
| Ga0207640_116296171 | 3300025981 | Corn Rhizosphere | MKNNEYDAAEVVEIGKAQSVVLGTKTIVPDLDSSGMEPIERWYVE |
| Ga0207639_104622881 | 3300026041 | Corn Rhizosphere | GVRRLEMKNNEYDAAEVVEIGKAQSVVLGTKTIVPDLDSSGMEPIERWYVE |
| Ga0207648_101746742 | 3300026089 | Miscanthus Rhizosphere | MKHNEYNAAEVVELGPAQAIVLGEKIFVPDLDSTGGEPMEWRYQE |
| Ga0207648_103990121 | 3300026089 | Miscanthus Rhizosphere | PLSRVRRLEMKNNEYDAAEVVEIGQAQAIVLGEKIYLPDLDSSGMEPLDWHYQE |
| Ga0207676_121736751 | 3300026095 | Switchgrass Rhizosphere | MKKNEYDAAEVVEIGEARSVVMGQKILLPDLDSSGMDPVDRHYEE |
| Ga0268266_104318663 | 3300028379 | Switchgrass Rhizosphere | MKNNEYNAAEVVEIGAAQAIVRGEKTIDPDLDSTLMEPI |
| Ga0268265_103630432 | 3300028380 | Switchgrass Rhizosphere | MKQNEYNAAEVVEIGPAQAIVLGQKIDERDFDSLGVEPMDWQYKE |
| Ga0268265_123864731 | 3300028380 | Switchgrass Rhizosphere | NDMKKNEYDAAEVVELGEAQSVVLGGKILMPGLDNPGMEPFDRQYEE |
| Ga0268264_100687701 | 3300028381 | Switchgrass Rhizosphere | KMKQNEYNAAEVVEIGPAQAIVLGQKIDERDFDSLGVEPMDWQYKD |
| Ga0268264_101782592 | 3300028381 | Switchgrass Rhizosphere | MKQNEYNAAEVVEIGPAQAIVLGQKIDERDFDSLGVEPMDWQYK |
| ⦗Top⦘ |