| Basic Information | |
|---|---|
| Family ID | F076462 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TRVLLKLMHEIRSAARRTRGVDRIELVYKDRHAVRLHG |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.72 % |
| % of genes near scaffold ends (potentially truncated) | 93.22 % |
| % of genes from short scaffolds (< 2000 bps) | 88.14 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.542 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (14.407 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.729 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.763 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF03352 | Adenine_glyco | 49.15 |
| PF01042 | Ribonuc_L-PSP | 20.34 |
| PF09360 | zf-CDGSH | 9.32 |
| PF06751 | EutB | 5.93 |
| PF07676 | PD40 | 3.39 |
| PF04367 | DUF502 | 1.69 |
| PF02798 | GST_N | 1.69 |
| PF08501 | Shikimate_dh_N | 0.85 |
| PF07238 | PilZ | 0.85 |
| PF05985 | EutC | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 49.15 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 20.34 |
| COG4303 | Ethanolamine ammonia-lyase, large subunit | Amino acid transport and metabolism [E] | 5.93 |
| COG2928 | Uncharacterized membrane protein | Function unknown [S] | 1.69 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.85 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.54 % |
| Unclassified | root | N/A | 47.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100443128 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1176 | Open in IMG/M |
| 3300004082|Ga0062384_100275929 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300004082|Ga0062384_100412177 | Not Available | 873 | Open in IMG/M |
| 3300004092|Ga0062389_101750501 | Not Available | 802 | Open in IMG/M |
| 3300004152|Ga0062386_100703280 | Not Available | 829 | Open in IMG/M |
| 3300005921|Ga0070766_10511150 | Not Available | 799 | Open in IMG/M |
| 3300006172|Ga0075018_10224828 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300006176|Ga0070765_100298297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1489 | Open in IMG/M |
| 3300009500|Ga0116229_11266730 | Not Available | 587 | Open in IMG/M |
| 3300009520|Ga0116214_1188595 | Not Available | 774 | Open in IMG/M |
| 3300009624|Ga0116105_1211698 | Not Available | 539 | Open in IMG/M |
| 3300009665|Ga0116135_1193806 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300009701|Ga0116228_10239312 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300009701|Ga0116228_10680581 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300009787|Ga0116226_11963907 | Not Available | 531 | Open in IMG/M |
| 3300010860|Ga0126351_1007949 | Not Available | 669 | Open in IMG/M |
| 3300011271|Ga0137393_10131712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 2072 | Open in IMG/M |
| 3300012205|Ga0137362_11493313 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012683|Ga0137398_10214215 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300012922|Ga0137394_10063353 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
| 3300012924|Ga0137413_11608841 | Not Available | 531 | Open in IMG/M |
| 3300014164|Ga0181532_10739411 | Not Available | 529 | Open in IMG/M |
| 3300014168|Ga0181534_10415594 | Not Available | 747 | Open in IMG/M |
| 3300014168|Ga0181534_10644597 | Not Available | 614 | Open in IMG/M |
| 3300014168|Ga0181534_10992596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → Thauera aromatica → Thauera aromatica K172 | 506 | Open in IMG/M |
| 3300014489|Ga0182018_10332697 | Not Available | 821 | Open in IMG/M |
| 3300014501|Ga0182024_12113804 | Not Available | 619 | Open in IMG/M |
| 3300014638|Ga0181536_10192153 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300014838|Ga0182030_11127587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300015054|Ga0137420_1429414 | All Organisms → cellular organisms → Bacteria | 2806 | Open in IMG/M |
| 3300015160|Ga0167642_1002408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3730 | Open in IMG/M |
| 3300017933|Ga0187801_10433830 | Not Available | 550 | Open in IMG/M |
| 3300019786|Ga0182025_1323866 | Not Available | 2364 | Open in IMG/M |
| 3300020027|Ga0193752_1079578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1370 | Open in IMG/M |
| 3300020060|Ga0193717_1199068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → Thauera aromatica → Thauera aromatica K172 | 541 | Open in IMG/M |
| 3300020580|Ga0210403_10587281 | Not Available | 900 | Open in IMG/M |
| 3300020580|Ga0210403_10986885 | Not Available | 660 | Open in IMG/M |
| 3300020581|Ga0210399_10891975 | Not Available | 722 | Open in IMG/M |
| 3300021086|Ga0179596_10276798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300021171|Ga0210405_10022885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5051 | Open in IMG/M |
| 3300021181|Ga0210388_10528069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300021384|Ga0213876_10427825 | Not Available | 704 | Open in IMG/M |
| 3300021402|Ga0210385_10098058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 2040 | Open in IMG/M |
| 3300021402|Ga0210385_10371969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300021402|Ga0210385_10966570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300021406|Ga0210386_10535028 | Not Available | 1013 | Open in IMG/M |
| 3300021420|Ga0210394_10889793 | Not Available | 775 | Open in IMG/M |
| 3300021475|Ga0210392_11101396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300021478|Ga0210402_11063062 | Not Available | 736 | Open in IMG/M |
| 3300021479|Ga0210410_10252611 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300021855|Ga0213854_1214896 | Not Available | 536 | Open in IMG/M |
| 3300022508|Ga0222728_1088512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300024288|Ga0179589_10253934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300025484|Ga0208587_1051404 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300025579|Ga0207927_1000176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 26141 | Open in IMG/M |
| 3300026319|Ga0209647_1044452 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
| 3300027496|Ga0208987_1005204 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
| 3300027629|Ga0209422_1056697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300027667|Ga0209009_1089023 | Not Available | 782 | Open in IMG/M |
| 3300027674|Ga0209118_1222860 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027692|Ga0209530_1204024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → Thauera aromatica → Thauera aromatica K172 | 545 | Open in IMG/M |
| 3300027701|Ga0209447_10038959 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300027727|Ga0209328_10065758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
| 3300027729|Ga0209248_10002565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5786 | Open in IMG/M |
| 3300027807|Ga0209208_10105388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1887 | Open in IMG/M |
| 3300027857|Ga0209166_10002884 | All Organisms → cellular organisms → Bacteria | 12700 | Open in IMG/M |
| 3300027889|Ga0209380_10354044 | Not Available | 862 | Open in IMG/M |
| 3300027895|Ga0209624_10989326 | Not Available | 545 | Open in IMG/M |
| 3300027908|Ga0209006_10247131 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300028023|Ga0265357_1026332 | Not Available | 654 | Open in IMG/M |
| 3300028566|Ga0302147_10292065 | Not Available | 541 | Open in IMG/M |
| 3300028742|Ga0302220_10104111 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300028882|Ga0302154_10186896 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300029911|Ga0311361_10660375 | Not Available | 973 | Open in IMG/M |
| 3300029914|Ga0311359_10516282 | Not Available | 905 | Open in IMG/M |
| 3300029915|Ga0311358_10677745 | Not Available | 762 | Open in IMG/M |
| 3300029917|Ga0311326_10483910 | Not Available | 606 | Open in IMG/M |
| 3300029922|Ga0311363_10520371 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300029922|Ga0311363_11103305 | Not Available | 681 | Open in IMG/M |
| 3300029939|Ga0311328_10183820 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300029952|Ga0311346_10615363 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300030007|Ga0311338_10410622 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300030011|Ga0302270_10291763 | Not Available | 901 | Open in IMG/M |
| 3300030056|Ga0302181_10517189 | Not Available | 501 | Open in IMG/M |
| 3300030058|Ga0302179_10211063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
| 3300030225|Ga0302196_10372832 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300030399|Ga0311353_11496696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → Thauera aromatica → Thauera aromatica K172 | 547 | Open in IMG/M |
| 3300030520|Ga0311372_12721080 | Not Available | 547 | Open in IMG/M |
| 3300030524|Ga0311357_10788106 | Not Available | 855 | Open in IMG/M |
| 3300030524|Ga0311357_11340345 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300030580|Ga0311355_11817283 | Not Available | 517 | Open in IMG/M |
| 3300030677|Ga0302317_10399973 | Not Available | 606 | Open in IMG/M |
| 3300031028|Ga0302180_10096747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1697 | Open in IMG/M |
| 3300031047|Ga0073995_11980512 | Not Available | 904 | Open in IMG/M |
| 3300031231|Ga0170824_106171166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300031234|Ga0302325_11140064 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300031234|Ga0302325_12059364 | Not Available | 701 | Open in IMG/M |
| 3300031236|Ga0302324_102397382 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031236|Ga0302324_103166815 | Not Available | 542 | Open in IMG/M |
| 3300031247|Ga0265340_10177769 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300031525|Ga0302326_12424274 | Not Available | 661 | Open in IMG/M |
| 3300031616|Ga0307508_10612552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300031715|Ga0307476_10329741 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300031715|Ga0307476_10737204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300031718|Ga0307474_10546699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 910 | Open in IMG/M |
| 3300031718|Ga0307474_11547423 | Not Available | 521 | Open in IMG/M |
| 3300031788|Ga0302319_10442699 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300031788|Ga0302319_11152956 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031962|Ga0307479_10539074 | Not Available | 1150 | Open in IMG/M |
| 3300032205|Ga0307472_102203326 | Not Available | 556 | Open in IMG/M |
| 3300032896|Ga0335075_10324598 | Not Available | 1699 | Open in IMG/M |
| 3300032898|Ga0335072_10662678 | Not Available | 1032 | Open in IMG/M |
| 3300032898|Ga0335072_11279162 | Not Available | 644 | Open in IMG/M |
| 3300034091|Ga0326724_0543271 | Not Available | 587 | Open in IMG/M |
| 3300034163|Ga0370515_0145722 | Not Available | 1016 | Open in IMG/M |
| 3300034199|Ga0370514_183178 | Not Available | 544 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 14.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.71% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 10.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.78% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.08% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 5.08% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.69% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.69% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.85% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.85% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015160 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027807 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031047 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1004431281 | 3300002245 | Forest Soil | RVLLKLMHEIRSAARRTHGVERIELVYKDCHAVRLHG* |
| Ga0062384_1002759291 | 3300004082 | Bog Forest Soil | EPRLSASPEVNTRVLLKLMHEIRSAARRTRGVDRIELVYKDCHAVRLHG* |
| Ga0062384_1004121771 | 3300004082 | Bog Forest Soil | PRLSATPEVNTRVLLKLMHEIRSAARRTHGVDRIELVYKDRHAVRLHG* |
| Ga0062389_1017505011 | 3300004092 | Bog Forest Soil | TPEINTRVLLKLMHEIRGAARRTRGVDRIELVYKDRHAVRLHV* |
| Ga0062386_1007032801 | 3300004152 | Bog Forest Soil | TAETNTRVLLKLMHEIRSAARRTQGVDRIELVYRNRPAVRLHV* |
| Ga0070766_105111502 | 3300005921 | Soil | GVQPEPNVTPDVNRRVLLKLMHEIRRAARRTRGVDKIELVYKHRHAARVHG* |
| Ga0075018_102248281 | 3300006172 | Watersheds | SNPVLLRLMHEIRRAARVTRGVDRIELVYKQANPVRLQVSRI* |
| Ga0070765_1002982971 | 3300006176 | Soil | LKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG* |
| Ga0116229_112667301 | 3300009500 | Host-Associated | VATPRFAAPDSSTRVLLKLMHEIRGAARRTQGVEHIDLVYKDHHALRLHD* |
| Ga0116230_100416647 | 3300009510 | Host-Associated | LLKLMHEIRGAARRTQGVQGIDLVYKHHHAMRLHG* |
| Ga0116214_11885952 | 3300009520 | Peatlands Soil | NTRVLLKLMHEIRSAARRTRGVERIELVYRDRHPVRLHV* |
| Ga0116105_12116982 | 3300009624 | Peatland | LKLMHEIRSAARRTRGVDRIELVYKDRHAVRLHC* |
| Ga0116135_11938062 | 3300009665 | Peatland | LKLMHEIRSTARRTRGVARIELVYKERHTVRLNV* |
| Ga0116228_102393122 | 3300009701 | Host-Associated | PVLLKLMHEIRRAARRTRGVDRIELVYKQERHAVRSNA* |
| Ga0116228_106805811 | 3300009701 | Host-Associated | LNTRVLLRLMHEIRSTARRTRGVDCIEMAYKARHRMRLHAMRLHG* |
| Ga0116226_119639071 | 3300009787 | Host-Associated | LMHEIRGAARRTRGVDTIELVYKDRGAARHATARP* |
| Ga0126351_10079491 | 3300010860 | Boreal Forest Soil | PRLSTTPEFNTRVLLKLMHEIRSTARRTRGVDCIELVYKDCHAVRLHC* |
| Ga0137393_101317121 | 3300011271 | Vadose Zone Soil | LKLMHEIRSAARRTRGVDRIELVYKDRHAVRLHG* |
| Ga0137362_114933131 | 3300012205 | Vadose Zone Soil | LGVEPRLSVTPELNTRVLLKLMHEIRSAARRTRGVDRIELVYKDCHAVRLHG* |
| Ga0137398_102142151 | 3300012683 | Vadose Zone Soil | PRFGRARALDVNTPVLLKLMHEIRSAARRTRGVHQIELVYKGRHAVRLNV* |
| Ga0137394_100633531 | 3300012922 | Vadose Zone Soil | EPRLSATPEVNTRVLLKLMHEIRSAARRTRGVDRIELVYKDRHAVRLHG* |
| Ga0137413_116088411 | 3300012924 | Vadose Zone Soil | SLTTDLSTRVLLKLMHEIRSTARRTRGVDRIELAYKDRHAVRLHV* |
| Ga0181532_107394112 | 3300014164 | Bog | NTRVLLKLMHEIRSAARRTRGVERIELVYRDRHAVRLHV* |
| Ga0181534_104155941 | 3300014168 | Bog | MNTRVLLKLMHEIRSAARRTEGVDRIELVYKNRHPVRLHV* |
| Ga0181534_106445971 | 3300014168 | Bog | SPDVNTRVLLKLMHEIRSAARRTRGVDRIELVYKDYHAVRLHG* |
| Ga0181534_109925962 | 3300014168 | Bog | DLNTRVLLKLMHEIRSTARRTHGVDRIELVYRDRPAVRLHG* |
| Ga0182018_103326972 | 3300014489 | Palsa | VLLKLMHEIRSAARRTRGVDRIELPYKDRHAVRLHV* |
| Ga0182024_121138041 | 3300014501 | Permafrost | LGVEPHLNARPDVNTRVLLKLMHEIRRAARRTRGVDRIELVYKDRHAVHLHG* |
| Ga0181536_101921533 | 3300014638 | Bog | HLGVEPRLTATPEINTRVLLKLMHEIRSAARRTRGVDRIELVYKNRHAVRLHV* |
| Ga0182030_111275872 | 3300014838 | Bog | RLSLTADLSTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHV* |
| Ga0137420_14294144 | 3300015054 | Vadose Zone Soil | LSATPEVNTRVLLKLMHEIRSAARRTRGVDRIELVYKDRHAVRLHA* |
| Ga0167642_10024085 | 3300015160 | Glacier Forefield Soil | FSLTSDQSTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG* |
| Ga0187801_104338301 | 3300017933 | Freshwater Sediment | ATPELNTRVLLKLMHEIRGAARRTRGVDRIELVYKDRHAVRLHV |
| Ga0182025_13238664 | 3300019786 | Permafrost | RRVLLKLMHEIRSAARRTHGVDRIELVYKQRHAVRLHV |
| Ga0193752_10795781 | 3300020027 | Soil | LGVEPRLSLTTDLSTRVLLKLMHEIRSTARRTRGVDRIELAYKDRHAVRLHV |
| Ga0193717_11990681 | 3300020060 | Soil | TMEFNTRVLLKLMHEIRSAARRTRGVDRIELVYKDSHAVRLHG |
| Ga0210403_105872811 | 3300020580 | Soil | RVLLKLMHEIRSAARRTRGVDRIELVYKDCHAVRLHC |
| Ga0210403_109868852 | 3300020580 | Soil | TRVLLKLMHEIRSAARRTRGVDRIELVYKDRHAVRLHG |
| Ga0210399_108919752 | 3300020581 | Soil | TRVLLKLMHEIRSAARRTRGVDRIELVYKDCHAVRLHG |
| Ga0179596_102767982 | 3300021086 | Vadose Zone Soil | DVNTPVLLKLMHEIRSAARRTRGVHRIELVYKGRHAVRLNV |
| Ga0210405_100228851 | 3300021171 | Soil | DPRLSTTPEVNTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG |
| Ga0210388_105280693 | 3300021181 | Soil | VLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG |
| Ga0213876_104278251 | 3300021384 | Plant Roots | LTPELNTRVLLKLMHEVRSAARRARGVQRIELVYKERHAVRLHG |
| Ga0210385_100980583 | 3300021402 | Soil | MTPELNTRVLLKLMHEIRSTARRTRGVDCIELVYKDSHAVRLHG |
| Ga0210385_103719693 | 3300021402 | Soil | LSATPDVNTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG |
| Ga0210385_109665702 | 3300021402 | Soil | GVDPKLSLTADLSTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHV |
| Ga0210386_105350281 | 3300021406 | Soil | LMKLMHEIRGAARRTHGVDRIELVYKDRHAVRLHV |
| Ga0210394_108897931 | 3300021420 | Soil | FNTRVLLKLMHEIRSTARRTRGVDCIELVYKDCHAVRLHC |
| Ga0210392_111013961 | 3300021475 | Soil | LLKLMHEIRSTARRTRGVDCIELAYKVRHAVRLHG |
| Ga0210402_110630621 | 3300021478 | Soil | EVNTRVLLKLMHEIRSTARRTRGVDCIELVYKDCHAVRIHG |
| Ga0210410_102526113 | 3300021479 | Soil | RLSMTPELNTRVLLKLMHEIRSTARRTRGVDCIELVYKDSHAVRLHG |
| Ga0213854_12148962 | 3300021855 | Watersheds | RVLLKLMHEIRTTARRTRGVDCIELVYKVRHAVRLHG |
| Ga0222728_10885122 | 3300022508 | Soil | VEPRFGRARALDVNTPVLLKLMHEIRSAARRTRGVHRIELVYKGRHAVRLNV |
| Ga0179589_102539341 | 3300024288 | Vadose Zone Soil | DVNTPVLLRLMHEIRSAARRTHGVHRIELVYRGRNAARLNV |
| Ga0208587_10514043 | 3300025484 | Arctic Peat Soil | RVLLKLMHEIRGAARRTRGVDCIELVYRDRHAVRLHV |
| Ga0207927_100017629 | 3300025579 | Arctic Peat Soil | APELNTRVLLKLMHEIRGAARRTRGVDCIELVYRDRHAVRLHV |
| Ga0209647_10444523 | 3300026319 | Grasslands Soil | VLLKLMHEIRSAARRTRGVHRIELVYKGRHAVCLNV |
| Ga0208987_10052041 | 3300027496 | Forest Soil | STRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG |
| Ga0209422_10566972 | 3300027629 | Forest Soil | SITPEVNTRVLLKLMHEIRSAARRTRGVDRIELVYKVRHAARLAAKQRGHNV |
| Ga0209009_10890231 | 3300027667 | Forest Soil | PRLCLTTDLSTRVLLKLMHEIRSTARRTRGVDCIELAYKVRHAVRLHG |
| Ga0209118_12228602 | 3300027674 | Forest Soil | LLKLMHEIRSAARRTRGVDRIELVYKDRHAVRLHG |
| Ga0209530_12040242 | 3300027692 | Forest Soil | LGVEPRLSLTPEVNTRVLLKLMHEIRSAARRTRGVERIELVYKDSHAVRLHG |
| Ga0209447_100389593 | 3300027701 | Bog Forest Soil | PDLNTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG |
| Ga0209328_100657583 | 3300027727 | Forest Soil | LLKLMHEIRSAARRTRGVHRIELVYKGRHAVRLNV |
| Ga0209248_100025657 | 3300027729 | Bog Forest Soil | LGVDPNLSATPDVNTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG |
| Ga0209208_101053881 | 3300027807 | Host-Associated | EENNTPVLLKLMHGIRTAARRTRGVDRIELVYKGHNAMRLHGAVRLEG |
| Ga0209166_1000288416 | 3300027857 | Surface Soil | PRFGRALDVNNPVLLRLMHEIRSAARRTHGVHRIELVYKGRHTMPVNV |
| Ga0209380_103540442 | 3300027889 | Soil | LGKVNVTPDVNRRVLLKLMHEIRRAARRTRGVDKIELVYKHRHAARVHG |
| Ga0209624_109893261 | 3300027895 | Forest Soil | VLLKLMHEIRSAARRTRGVERIELVYKDSHAVRLHG |
| Ga0209006_102471311 | 3300027908 | Forest Soil | MNTRVLLKLMHEIRSAARRTQGVDRIEMVYRNRPAVRLHV |
| Ga0265357_10263321 | 3300028023 | Rhizosphere | LSMTPELNTRVLLKLMHEIRSTARRTRGVDCIELVYKDSHAVRLHG |
| Ga0302147_102920652 | 3300028566 | Bog | RANSFILIKLMHEIRGAARRTRGVDRIELVYKDRNPMRLHGALRMPG |
| Ga0302220_101041113 | 3300028742 | Palsa | EMNTRVLLKLMHEIRSAARRTQGVDRIELVYKNRPAVRLHV |
| Ga0302154_101868962 | 3300028882 | Bog | GAPDVNAPVLRRLMYEIRRAARLTRGVDRIELVYKDCHSMRVTG |
| Ga0311361_106603751 | 3300029911 | Bog | VVQPEPGLSADMNRRVLLKLMHEIRRTARRTRGVDRIELVYKHRHPVRVHG |
| Ga0311359_105162821 | 3300029914 | Bog | NRRVLLKLMHEIRRTARRTRGVERIELVYKDRHAVRVHG |
| Ga0311358_106777451 | 3300029915 | Bog | RVLLKLMHEIRGAARRTHGVDRIEFVYKDRHAVRLHG |
| Ga0311326_104839101 | 3300029917 | Bog | SFILIKLMHEIRGAARRTRGVDRIELVYKDRNPMRLHGALRMPG |
| Ga0311363_105203713 | 3300029922 | Fen | LTPELNTRVLLKLMHEIRSAARRTHGVDRIELVYKDSHAVRLHA |
| Ga0311363_111033051 | 3300029922 | Fen | LLKLMHEIRSTARRTHGVDRIELVYRDRPAVRLHG |
| Ga0311328_101838202 | 3300029939 | Bog | VDVNAPVLLKLMHEIRAAARRTHGVQRIELVYNDRPAMRLHV |
| Ga0311346_106153633 | 3300029952 | Bog | VAGDLNTRVLLKLMHEIRSAARRTHGVDRIELVYRDRHAMRLNG |
| Ga0311338_104106221 | 3300030007 | Palsa | RVLIKLMHEIRSAARRTRGVDCIELVYKDCHAVRLHG |
| Ga0302270_102917631 | 3300030011 | Bog | RRVLLKLMHEIRRTARRTRGVERIELVYKDRHAVRVHG |
| Ga0302181_105171891 | 3300030056 | Palsa | VLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRVHG |
| Ga0302179_102110631 | 3300030058 | Palsa | SLSLTADQSTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRVHG |
| Ga0302196_103728322 | 3300030225 | Bog | ALDVNTAVLLRLMHEIRGAARRTRGVARIELVYKERHPMRLNS |
| Ga0311353_114966961 | 3300030399 | Palsa | SIAREVNTRVLLKLMHEIRSAARRTRGVDRIELVYKDCHAVRLHG |
| Ga0311372_127210801 | 3300030520 | Palsa | APDLNTRVLLKLMHEIRSTARRTQGVQRIELVYKDRPVRLHG |
| Ga0311357_107881061 | 3300030524 | Palsa | VNTRVLIKLMHEIRSAARRTRGVDCIELVYKDCHAVRLHG |
| Ga0311357_113403452 | 3300030524 | Palsa | RVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG |
| Ga0311355_118172831 | 3300030580 | Palsa | RPDTNTRVLLKLMHEIRGAARRTRGVDRIELVYKHRHAVRLHV |
| Ga0302317_103999732 | 3300030677 | Palsa | VLLKLMHEIRRTARRTRGVDRIELVYKHRHAVRVHG |
| Ga0302180_100967473 | 3300031028 | Palsa | TPEVNTRVLLKLMHEIRSTARRTRGVDRIELVYKDSHAVRLHG |
| Ga0073995_119805122 | 3300031047 | Soil | VEPRLSATPELNTRVLIKLMHEIRSAARRTHGVDRIELVYKDCHAVRLHG |
| Ga0170824_1061711661 | 3300031231 | Forest Soil | PRLSLTPELNTRVLLKLMHEIRSAARRTHGVDCIELVYKVRHAVRLHV |
| Ga0302325_111400643 | 3300031234 | Palsa | EFNTRVLLKLMHEIRSAARRTRGVDRIELVYKDCHAVRLHG |
| Ga0302325_120593641 | 3300031234 | Palsa | AEMNTRVLLKLMHGIRRGAARRTQGVERIELVYKNRHAVRLHV |
| Ga0302324_1023973822 | 3300031236 | Palsa | LTTDLNTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHV |
| Ga0302324_1031476732 | 3300031236 | Palsa | EIRGAARRTQGVERIDLVYKDHHAVRVNGHAVRLPG |
| Ga0302324_1031668151 | 3300031236 | Palsa | VQHPHRLMPEVNTRVLLKLMHEIRSAARRTHGVDRIELVYKDRHAVRLHV |
| Ga0265340_101777691 | 3300031247 | Rhizosphere | LSATPEINTRVLLKLMHEIRSAARRTRGVDRIELVYKDRHAVRLHG |
| Ga0302326_124242741 | 3300031525 | Palsa | EVNTRVLLKLMHEIRSAARRTHGVDRIELVYRQHHAVRLHV |
| Ga0307508_106125522 | 3300031616 | Ectomycorrhiza | GRAVDVNAPVLLRLMHEIRSAARRTRGVQQIELVYKGRHAVRLNV |
| Ga0307476_103297413 | 3300031715 | Hardwood Forest Soil | HLGVQQPHAVTPDLNTRVLLKLMHEIRSAAKRTQGVDRIELVYKSRHAVRLHV |
| Ga0307476_107372042 | 3300031715 | Hardwood Forest Soil | QSTRVLLKLMHEIRSTARRTRGVDCIELVYKVRHAVRLHG |
| Ga0307474_105466993 | 3300031718 | Hardwood Forest Soil | RALDVNTPVLLRLMHEIRGAARRTRGVHRIELVYKGRHAVRLNV |
| Ga0307474_115474231 | 3300031718 | Hardwood Forest Soil | DPRLCLTTDLSTRVLLKLMHEIRSTARRTRGVDCIELAYKVRHAVRLHG |
| Ga0302319_104426993 | 3300031788 | Bog | HLGLEPHLSLTPELNTRVLLKLMHEIRSAARRTHGVDRIELVYKDSHAVRLHA |
| Ga0302319_111529562 | 3300031788 | Bog | ILIKLMHEIRGAARRTRGVDRIELVYKDRNPMRLHGALRMPG |
| Ga0307479_105390741 | 3300031962 | Hardwood Forest Soil | EVNTRVLLKLMHEIRSAARRTRGVDRIEFVYKDRHAVRLHG |
| Ga0307472_1022033261 | 3300032205 | Hardwood Forest Soil | PDVNTRVLLKLMHEIRSAARRTHGVDRNELVYKDRHAVRLHG |
| Ga0335075_103245981 | 3300032896 | Soil | LLKLMHEIRSAARRAQGVDRIELVYKHRHPVRLHV |
| Ga0335072_106626783 | 3300032898 | Soil | YRLAPEVNVRVLLKLMHEIRGAARRTHGVDRIELMYKDRHAVRLHL |
| Ga0335072_112791621 | 3300032898 | Soil | VTPDLNTRVLLKLMHEIRSAARRTQGVDRIELVYRRRRAVRLHVSSA |
| Ga0326724_0543271_468_587 | 3300034091 | Peat Soil | NAPVLLKLMHEIRSTARRTRGVARIELVYKERHAVRLNV |
| Ga0370515_0145722_892_1014 | 3300034163 | Untreated Peat Soil | VNTRVLLKLMHEIRSAARRTHGVDRIELVYKDRPPVRLHV |
| Ga0370514_183178_404_526 | 3300034199 | Untreated Peat Soil | MNRRVLLKLMHEIRRTARRTRGVDRIELVYKHRHAVRVHG |
| ⦗Top⦘ |