| Basic Information | |
|---|---|
| Family ID | F076427 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLPAEPPQNAGYMVAAYIVAPVILVGYLVSLVRRVRRALRR |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.11 % |
| % of genes near scaffold ends (potentially truncated) | 24.58 % |
| % of genes from short scaffolds (< 2000 bps) | 82.20 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.068 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.864 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.508 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.051 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01578 | Cytochrom_C_asm | 52.54 |
| PF00230 | MIP | 22.88 |
| PF03379 | CcmB | 10.17 |
| PF02801 | Ketoacyl-synt_C | 2.54 |
| PF00005 | ABC_tran | 1.69 |
| PF00072 | Response_reg | 0.85 |
| PF03544 | TonB_C | 0.85 |
| PF01479 | S4 | 0.85 |
| PF13466 | STAS_2 | 0.85 |
| PF13490 | zf-HC2 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 22.88 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 10.17 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.07 % |
| Unclassified | root | N/A | 5.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01D3AJW | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 585 | Open in IMG/M |
| 2199352024|deeps__Contig_118632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 960 | Open in IMG/M |
| 3300000891|JGI10214J12806_10823702 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
| 3300000953|JGI11615J12901_11329538 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300000956|JGI10216J12902_100951763 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300003992|Ga0055470_10091002 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300004114|Ga0062593_102546204 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300004463|Ga0063356_100605429 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1482 | Open in IMG/M |
| 3300004463|Ga0063356_100684776 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300004463|Ga0063356_100786429 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1325 | Open in IMG/M |
| 3300004479|Ga0062595_100320522 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300004479|Ga0062595_100904329 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300004643|Ga0062591_100468968 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1069 | Open in IMG/M |
| 3300004780|Ga0062378_10058947 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300004782|Ga0062382_10502833 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005093|Ga0062594_101842861 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005332|Ga0066388_104475272 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 712 | Open in IMG/M |
| 3300005332|Ga0066388_106099021 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005332|Ga0066388_107938072 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005434|Ga0070709_10772780 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 752 | Open in IMG/M |
| 3300005437|Ga0070710_10211351 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300005526|Ga0073909_10061391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1394 | Open in IMG/M |
| 3300005546|Ga0070696_101241197 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005841|Ga0068863_100050563 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3939 | Open in IMG/M |
| 3300005844|Ga0068862_102747687 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005873|Ga0075287_1007248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1317 | Open in IMG/M |
| 3300005874|Ga0075288_1015870 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1036 | Open in IMG/M |
| 3300005875|Ga0075293_1048300 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005886|Ga0075286_1046895 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006173|Ga0070716_100443621 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300006175|Ga0070712_100448121 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300006574|Ga0074056_11315619 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006579|Ga0074054_11608722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 514 | Open in IMG/M |
| 3300006755|Ga0079222_10137659 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300006755|Ga0079222_10436907 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300006804|Ga0079221_11711201 | Not Available | 513 | Open in IMG/M |
| 3300006845|Ga0075421_100645679 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300006852|Ga0075433_10036852 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4216 | Open in IMG/M |
| 3300006852|Ga0075433_10851208 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300006852|Ga0075433_11257673 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006903|Ga0075426_10121270 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1879 | Open in IMG/M |
| 3300006904|Ga0075424_102568130 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006954|Ga0079219_10009173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3228 | Open in IMG/M |
| 3300006954|Ga0079219_10770972 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300009090|Ga0099827_10416874 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300009137|Ga0066709_102288939 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300009162|Ga0075423_11638722 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300010039|Ga0126309_10143424 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300010040|Ga0126308_11307289 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010041|Ga0126312_11286609 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010044|Ga0126310_11549120 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010396|Ga0134126_10601879 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300012201|Ga0137365_10577283 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012208|Ga0137376_11444995 | Not Available | 579 | Open in IMG/M |
| 3300012353|Ga0137367_10956098 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012354|Ga0137366_10269424 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1259 | Open in IMG/M |
| 3300012355|Ga0137369_11098428 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012360|Ga0137375_10346348 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1321 | Open in IMG/M |
| 3300012668|Ga0157216_10504142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 522 | Open in IMG/M |
| 3300012917|Ga0137395_10532994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 847 | Open in IMG/M |
| 3300012930|Ga0137407_11151481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 736 | Open in IMG/M |
| 3300012955|Ga0164298_10044527 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2092 | Open in IMG/M |
| 3300012955|Ga0164298_10094894 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300012955|Ga0164298_10464266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 836 | Open in IMG/M |
| 3300012957|Ga0164303_10117821 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1348 | Open in IMG/M |
| 3300012960|Ga0164301_11929591 | Not Available | 500 | Open in IMG/M |
| 3300012989|Ga0164305_10357206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1103 | Open in IMG/M |
| 3300014314|Ga0075316_1088653 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300015371|Ga0132258_10126292 | All Organisms → cellular organisms → Bacteria | 6090 | Open in IMG/M |
| 3300015371|Ga0132258_11809243 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1539 | Open in IMG/M |
| 3300015372|Ga0132256_100973956 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300015372|Ga0132256_101090547 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300017936|Ga0187821_10435747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 541 | Open in IMG/M |
| 3300018027|Ga0184605_10447896 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300018027|Ga0184605_10516828 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 518 | Open in IMG/M |
| 3300018482|Ga0066669_10941828 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300019255|Ga0184643_1297806 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300019458|Ga0187892_10001780 | All Organisms → cellular organisms → Bacteria | 47122 | Open in IMG/M |
| 3300019879|Ga0193723_1122535 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 720 | Open in IMG/M |
| 3300025165|Ga0209108_10580979 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300025318|Ga0209519_10470674 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300025324|Ga0209640_11414323 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 507 | Open in IMG/M |
| 3300025327|Ga0209751_10955775 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025910|Ga0207684_10123198 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
| 3300025910|Ga0207684_11048441 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300025993|Ga0208415_1010356 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300025993|Ga0208415_1013326 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300026088|Ga0207641_10059966 | All Organisms → cellular organisms → Bacteria | 3242 | Open in IMG/M |
| 3300026118|Ga0207675_101247608 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 764 | Open in IMG/M |
| 3300027716|Ga0209682_10006887 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300027840|Ga0209683_10029990 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300027840|Ga0209683_10213475 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300027903|Ga0209488_10665472 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300027909|Ga0209382_11341297 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300028587|Ga0247828_10694998 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300028715|Ga0307313_10216366 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300028812|Ga0247825_10573312 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300028878|Ga0307278_10110574 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10170100 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031576|Ga0247727_10117794 | All Organisms → cellular organisms → Bacteria | 2697 | Open in IMG/M |
| 3300031576|Ga0247727_10363226 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300031576|Ga0247727_10488061 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300031716|Ga0310813_10263402 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300031716|Ga0310813_12259232 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031824|Ga0307413_10805172 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031852|Ga0307410_10029878 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3476 | Open in IMG/M |
| 3300031938|Ga0308175_100102446 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
| 3300031965|Ga0326597_10011548 | All Organisms → cellular organisms → Bacteria | 11702 | Open in IMG/M |
| 3300031995|Ga0307409_100023156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4297 | Open in IMG/M |
| 3300032005|Ga0307411_10073120 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
| 3300032126|Ga0307415_100383556 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300032421|Ga0310812_10113632 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300034164|Ga0364940_0099942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 816 | Open in IMG/M |
| 3300034817|Ga0373948_0045892 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.93% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 5.08% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.24% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.24% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.39% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.39% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.54% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 2.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.85% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.85% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.85% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.85% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_01173380 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MLQAEPPQNVGYMVAAYVIAPVILVGYLMSLVARARKAAGR |
| deeps_02135400 | 2199352024 | Soil | MSPETPHNAGYMVAAYVVAPVILVGYLVSLWRRVQRALGE |
| JGI10214J12806_108237022 | 3300000891 | Soil | MPADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALGHTKGA* |
| JGI11615J12901_113295381 | 3300000953 | Soil | MVADVPQNGGYLVAAYVVTPVILVGYLVSLWRRGTR |
| JGI10216J12902_1009517632 | 3300000956 | Soil | MLPADPPQNAGYMVVAYIVAPVILVGYLAGLMRRVRRVVRK* |
| Ga0055470_100910022 | 3300003992 | Natural And Restored Wetlands | MPPDTPHNAGYLAAAYVVAPVILLGYLGALWRRVRKAMRE* |
| Ga0055438_100898882 | 3300003995 | Natural And Restored Wetlands | MPPETPQNAGYMLAAYIVAPVILVGYLLSLWARVRKALIGGRSGGRTVER* |
| Ga0062593_1025462041 | 3300004114 | Soil | MLQVEPPHNVGYMVAAYVVAPVILVGYLMSLVARAKKTERR* |
| Ga0063356_1006054292 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPPENSGYMVAAYVVTAVVLVGYAVLLVRRARRALGRAGREAVREGPESGRT* |
| Ga0063356_1006847762 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALGNARGA* |
| Ga0063356_1007864291 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MHETPQNAGYMITAYVVTAVVLVGYWLRLAGKIRRGIRD* |
| Ga0063356_1018423342 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLPAEPPQNAGYMVAAYLVAPAILVGYLVSLVSRVRKAIGRSDGRMVGWSGDRTVGR* |
| Ga0062595_1003205222 | 3300004479 | Soil | MLQAEPPHNVGYMVAAYVVAPVILVGYLMSLLRRARRACKPIGR* |
| Ga0062595_1009043292 | 3300004479 | Soil | MLPAEPPQNAGYMVAAYLVAPAILVGYLVSLVSRVRKAIGRSDGRMV |
| Ga0062591_1004689681 | 3300004643 | Soil | MLPVEPPQNSGYMIAAYIVAPVILVGYLASLVGRVRRAMGGR* |
| Ga0062378_100589472 | 3300004780 | Wetland Sediment | MSPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVKRTLGRK* |
| Ga0062382_105028332 | 3300004782 | Wetland Sediment | MPAETPQNAGYMIAAYVVAPVILVGYLVSLWARVRRTLDRE* |
| Ga0062594_1018428611 | 3300005093 | Soil | MPAETPHNVGYLVAAYVVAPVILAGYLAALWGRVRKADGRADGQA |
| Ga0066388_1044752721 | 3300005332 | Tropical Forest Soil | MLPAEPPQNAGYMVAAYIVAPVILVGYLVSLVRRVRRALRR* |
| Ga0066388_1060990212 | 3300005332 | Tropical Forest Soil | MLPADPPHNVGYMVAAYIVAPLILVGYLMSLVRRVAQAERAIGRTGDQGAGGR* |
| Ga0066388_1079380722 | 3300005332 | Tropical Forest Soil | MLPAEPPHNVGYMVAAYIVAPVILVGYLVSLIGRARKAIGW* |
| Ga0070709_107727802 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPETPHNAGYMVAAYVVAPVILVGYLVSLWRRVRRALGE* |
| Ga0070710_102113512 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPETPQNAGYMVAAYVVAPVILVGYLVSLWRRVQRALGE* |
| Ga0073909_100613913 | 3300005526 | Surface Soil | MPAETPENAGYMIAAYVVAPVILVGYLASLWGRVKR |
| Ga0070696_1012411972 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAETPQNAGYMIAAYVVAPVILVGYLASLWRRVRRSLRE* |
| Ga0068863_1000505633 | 3300005841 | Switchgrass Rhizosphere | MLPAEPPQNGGYMVAAYIVAPVILVGYLVSLVGRVRKAMGGR* |
| Ga0068862_1027476872 | 3300005844 | Switchgrass Rhizosphere | MPAETPENAGYMIAAYVVAPVILVGYLASLWGRVRRAVRRSGGQA |
| Ga0075287_10072482 | 3300005873 | Rice Paddy Soil | MPADVPQNGGYLLAAYVVAPVILVGYMGMLWRRLVRGRRR* |
| Ga0075288_10158701 | 3300005874 | Rice Paddy Soil | MLPADPPHNAGYMVAAYTVAPVILVGYLLSLVGRVRRALEVRGRNVESESP* |
| Ga0075293_10483001 | 3300005875 | Rice Paddy Soil | MPADVPENGGYLLAAYVVAPVILVGYMGMLWRRLVR |
| Ga0075286_10468951 | 3300005886 | Rice Paddy Soil | MPPETPHNVGYLVAAYVVAPVILAGYLAALWGRMR |
| Ga0070716_1004436212 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPADPPHNVGYMVAAYIAAPLILVGYLLGLVRRLRKAIGR* |
| Ga0070712_1004481212 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPETPHNAGYMVAAYVVAPVILVGYLVSLWRRVRRALGE* |
| Ga0074056_113156192 | 3300006574 | Soil | MLSEPPHNAGYMLAAYIVAPVILVGYLVSLVGRVKRALRE* |
| Ga0074054_116087222 | 3300006579 | Soil | RRPMLPAEPPHNAGYMLAAYIVAPVILVGYLVSLVGRVKRALRG* |
| Ga0079222_101376592 | 3300006755 | Agricultural Soil | MLQAEPPQNVGYMVAAYVIAPVILVGYLMSLVGRARKAAGR* |
| Ga0079222_104369071 | 3300006755 | Agricultural Soil | MLQAEPPHNVGYMVAAYIVAPVILVGYLMSLVARVRKTEGR* |
| Ga0079221_117112012 | 3300006804 | Agricultural Soil | MLPVDPPRNSGYMVAAYIVAPVILVGYLLTLLGRVRRALGKNGGK* |
| Ga0075421_1006456792 | 3300006845 | Populus Rhizosphere | MAPETPQNAGYMVAAYVVAPVILGGYLVTLWRRVRRAVGR* |
| Ga0075433_100368525 | 3300006852 | Populus Rhizosphere | MLPAEPPQNAGYMVAAYLVAPAILVGYLVSLVGRVRKAIGR* |
| Ga0075433_108512081 | 3300006852 | Populus Rhizosphere | MLAEAPHNVGYMVAAYIVAPVILVGYLVGLVRRARRAMKG |
| Ga0075433_112576731 | 3300006852 | Populus Rhizosphere | MAAELPQNGGYLIAAYIVTPVILVGYLVSLWRRVKRAGH* |
| Ga0075426_101212704 | 3300006903 | Populus Rhizosphere | MSPETPQNAGYMVAAYVVAPVILVGYLVSLWRRVQRAL |
| Ga0075424_1025681302 | 3300006904 | Populus Rhizosphere | MLPADPPHNVGYMVAAYIAAPLILVGYLLGLVRRLRRAIGRTGVEGDKAI |
| Ga0079219_100091733 | 3300006954 | Agricultural Soil | MLPAEPPHNVGYMVAAYTVAPVILVGYLISLVQRARRAIGGGGR* |
| Ga0079219_107709722 | 3300006954 | Agricultural Soil | MLQAEPPQNVGYMVAAYVIAPVILVGYLMSLVARARKAAGR* |
| Ga0099827_104168742 | 3300009090 | Vadose Zone Soil | MLPEPPANGGYMVAAYIVAPVILVGYLLGLWRRARRALGRE* |
| Ga0066709_1022889391 | 3300009137 | Grasslands Soil | MLAEPPANGGYMVAAYIAAPAILVGYLLTLWRRARKAL |
| Ga0075423_116387222 | 3300009162 | Populus Rhizosphere | MPPEPPQNAGYMIAAYVVAPVILVGYLVSLWTRVRRVLGKAER* |
| Ga0126309_101434242 | 3300010039 | Serpentine Soil | MLPADTPQNAGYMVAAYVVAPVILVGYLAILWGRLRQAGEHKDG* |
| Ga0126308_113072892 | 3300010040 | Serpentine Soil | MLADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALASL* |
| Ga0126312_112866091 | 3300010041 | Serpentine Soil | MASEIPQNAGYMLAAYIITPVILGGYLLSLWRRAKRAIEREGVKA* |
| Ga0126310_115491201 | 3300010044 | Serpentine Soil | MPPEPPHNGGYMLAAYIVTSVILLGYLVALWLRARSLGQETPP |
| Ga0134126_106018792 | 3300010396 | Terrestrial Soil | MLQAEPPHNVGYMVAAYIVAPVILVGYLVSLVGRVRRVLGGR* |
| Ga0137365_105772832 | 3300012201 | Vadose Zone Soil | MLAEPPANGGYMVAAYIAAPAILVGYLLTLWRRARRALGRE* |
| Ga0137376_114449951 | 3300012208 | Vadose Zone Soil | MLPEPPANGGYMVAAYIAAPAILVGYLLTLWRRARRALGRE* |
| Ga0137367_109560982 | 3300012353 | Vadose Zone Soil | MLPAEPPQNAGYMVAAYVVAPVILVGYLLSLVRRVRRALR* |
| Ga0137366_102694243 | 3300012354 | Vadose Zone Soil | MPAEPPANGGYLVAAYLAAPAILVGYLLSLWRRARRALGREGREGRE* |
| Ga0137369_110984282 | 3300012355 | Vadose Zone Soil | MLTEPPTNGGYMVAAYIAAPAILVGYLLTLWRRARRALGREGREGRE |
| Ga0137375_103463481 | 3300012360 | Vadose Zone Soil | MLTEPPTNGGYMVAAYIAAPAILVGYLLTLWRRARRALGRE* |
| Ga0157216_105041422 | 3300012668 | Glacier Forefield Soil | MLPAETPQNAGYMVAAYIVAPVILAGYLAVLWRRLRREVGRTGGR* |
| Ga0137395_105329942 | 3300012917 | Vadose Zone Soil | MLAEPPANGGYMVAAYIAAPVILVGYLLALWRRAQRALGRE* |
| Ga0137407_111514812 | 3300012930 | Vadose Zone Soil | PQNAGYMIAAYVVAPVILVGYLASLWRRVRRAVGRTDGRTRG* |
| Ga0164298_100445273 | 3300012955 | Soil | MLAEPPHNVGYMVAAYIVAPVILVGYLVGLIGRVRRTMKGR* |
| Ga0164298_100948941 | 3300012955 | Soil | RTCETRRPMLSEPPHNAGYMLAAYIVAPVILVGYLVSLVGRVKRALRE* |
| Ga0164298_104642662 | 3300012955 | Soil | MLPADPPHHVGYMVAAYIAAPLILVGYLLGLVRRLRKAIGR* |
| Ga0164303_101178213 | 3300012957 | Soil | MLPAELPRNAGYMVAAYIVAPVILVGYLVSLVGRVRRAMGGR* |
| Ga0164301_119295911 | 3300012960 | Soil | MLPAEPPQNAGYMVAAYIVAPVILVGYLVSLVGRVRKAMGGR* |
| Ga0164305_103572061 | 3300012989 | Soil | MLPTEPPQNGGYMVAAYIVAPVILVGYLVSLVGRV |
| Ga0075316_10886531 | 3300014314 | Natural And Restored Wetlands | MTPETPHNAGYLIAAYVVAPVILVGYLGSLWRRLRRSM |
| Ga0132258_101262926 | 3300015371 | Arabidopsis Rhizosphere | MLPVEPPQNSGYMIAAYIVAPVILVGYLVSLVGRVRRAMGGR* |
| Ga0132258_118092433 | 3300015371 | Arabidopsis Rhizosphere | MLPADPPHNVGYMVAAYIAAPLILVGYLLGLVRRLRKAIGDRANGR* |
| Ga0132256_1009739562 | 3300015372 | Arabidopsis Rhizosphere | MLPAEPPQSGGYMVAAYIVAPVILVGYLVSLVGRVRRAMGGR* |
| Ga0132256_1010905472 | 3300015372 | Arabidopsis Rhizosphere | MLPADPPHNVGYMVAAYIAAPLILVGYLLGLVRRMRRAIGDRANGR* |
| Ga0187821_104357472 | 3300017936 | Freshwater Sediment | MLQAEPPHNVGYMVAAYIVAPVILVGYLVSLVGRVRRVLGGR |
| Ga0184605_104478961 | 3300018027 | Groundwater Sediment | AMLPEPPANGGYMVAAYIAAPAILGGYLLTLWRRARRALGRE |
| Ga0184605_105168281 | 3300018027 | Groundwater Sediment | MLPEPPANGGYMLAAYIVAPVILVGYLLALWRRARRVLGRD |
| Ga0066669_109418281 | 3300018482 | Grasslands Soil | MLLAELPQNAGYMVAAYIVAPVILVGYLVSLVGRVRKTIGR |
| Ga0184643_12978061 | 3300019255 | Groundwater Sediment | MLPEPPANGGYMVAAYIVAPVILVGYLLALWRRARRALGREGREGREGR |
| Ga0187892_1000178015 | 3300019458 | Bio-Ooze | MPDTPQNAGYMIAAYVVAGVVLVAYAVALWLRTRRTDE |
| Ga0193723_11225352 | 3300019879 | Soil | MLPEPPANGGYMVAAYIAAPAILVGYLLTLWRRARRALGRE |
| Ga0209108_105809792 | 3300025165 | Soil | LPETPQNAGYLIAAYIVAAVVLVGYALALWLRTRRTDA |
| Ga0209519_104706741 | 3300025318 | Soil | MPPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVKRTLDRK |
| Ga0209640_114143232 | 3300025324 | Soil | MPPETPQNAGYMIAAYVVTPVILVGYLVSLWGRVRRTLDRK |
| Ga0209751_109557751 | 3300025327 | Soil | MPPETPQNAGYMIAAYVVAPVILVGYLVSLWGGVKRTLDRK |
| Ga0210094_10628952 | 3300025549 | Natural And Restored Wetlands | MPPETPQNAGYMLAAYIVAPVILVGYLLSLWARVRKALIGGRSGGRTVER |
| Ga0207684_101231981 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAETPQNAGYMIAAYVVAPVILVGYLASLWGRVKRAVGRSDGRW |
| Ga0207684_110484412 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAETPQNAGYMVAAYVVAPVILAGYLGMLWGRVKRT |
| Ga0208415_10103562 | 3300025993 | Rice Paddy Soil | MPADVPQNGGYLLAAYVVAPVILVGYMGMLWRRLVRGRRR |
| Ga0208415_10133262 | 3300025993 | Rice Paddy Soil | MLPADPPHNAGYMVAAYTVAPVILVGYLLSLVGRVRRALEVRGRNVESESP |
| Ga0207641_100599662 | 3300026088 | Switchgrass Rhizosphere | MLPAEPPQNGGYMVAAYIVAPVILVGYLVSLVGRVRKAMGGR |
| Ga0207675_1012476082 | 3300026118 | Switchgrass Rhizosphere | MPAETPQNAGYMVAAYVVAPTILGGYLLMLWRRVRQAVGR |
| Ga0209682_100068875 | 3300027716 | Wetland Sediment | MSPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVKRTLGRK |
| Ga0209683_100299903 | 3300027840 | Wetland Sediment | MSPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVRRTLGRK |
| Ga0209683_102134752 | 3300027840 | Wetland Sediment | MPAETPQNAGYMIAAYVVAPVILVGYLVSLWARVRRTLDRE |
| Ga0209488_106654721 | 3300027903 | Vadose Zone Soil | MPAETPQNAGYMVAAYVVAPVILAGYLGMLWGRVKRTE |
| Ga0209382_113412972 | 3300027909 | Populus Rhizosphere | MAPETPQNAGYMVAAYVVAPVILGGYLVTLWRRVRRAVGR |
| Ga0247828_106949981 | 3300028587 | Soil | MLPAEPPQNGGYMVAAYIVAPVILVGYLVSLLGRVRKAV |
| Ga0307313_102163662 | 3300028715 | Soil | MLPEPPANGGYMVAAYIAAPAILVGYLLTLWRRARRVLGRE |
| Ga0307284_101991331 | 3300028799 | Soil | MLAETPGNVGYMIAAYVVAPVILVGYLGSLWRRVKRAGGRSGCQAVR |
| Ga0247825_105733121 | 3300028812 | Soil | MLPAEPPQNGGYMVAAYIVAPVILVGYLVSLLGRVRKAVRGR |
| Ga0307278_101105742 | 3300028878 | Soil | MPADPPANGGYMVAAYIVAPAILVGYLLTLWRRARKALGRE |
| (restricted) Ga0255310_101701001 | 3300031197 | Sandy Soil | MPPETPQNAGFMLAAYIVAPAILVGYLLSLWMRVRRALTG |
| Ga0247727_101177945 | 3300031576 | Biofilm | LPETPQNAGYLIAAYVVAAIVLVAYAVALWLRARRTDE |
| Ga0247727_103632262 | 3300031576 | Biofilm | LPETPQNAGYLIAAYLVAAAVLVAYAVALWLRARRTDA |
| Ga0247727_104880612 | 3300031576 | Biofilm | MPETPQNTGYLIAAYVVAAAVLVTYAVALWLRTRRTTD |
| Ga0310813_102634022 | 3300031716 | Soil | MLPAEPPQNAGYMLAAYIVAPVILVGYLVSLVGRVRRTMRGR |
| Ga0310813_122592322 | 3300031716 | Soil | MPAETPHNVGYLVAAYVVAPVILAGYLAALWGRVRKADGRADG |
| Ga0307413_108051722 | 3300031824 | Rhizosphere | MSPETPQNAAYMIAAYVVAPVILLGYLVSLWGRVRRALGGG |
| Ga0307410_100298784 | 3300031852 | Rhizosphere | MQADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALSSL |
| Ga0308175_1001024461 | 3300031938 | Soil | MLQVEPPHNVGYMVAAYVVAPVILVGYLMSLVARAKKAERR |
| Ga0326597_100115484 | 3300031965 | Soil | MPPDIPQNAGYMVAAYIVTPVILVGYLLSLWRRARRARRMSS |
| Ga0307409_1000231567 | 3300031995 | Rhizosphere | TPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALSSL |
| Ga0307411_100731205 | 3300032005 | Rhizosphere | MPLETPDNTGYMIAAYIVVPVILVGYLGSLWGRVRRTGGWAAG |
| Ga0307415_1003835561 | 3300032126 | Rhizosphere | RRASMLADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALSSL |
| Ga0310812_101136322 | 3300032421 | Soil | MLPVEPPQNSGYMIAAYIVAPVILVGYLVSLVGRVRRAMGGR |
| Ga0364940_0099942_609_734 | 3300034164 | Sediment | MPPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVRRVLGGK |
| Ga0373948_0045892_179_304 | 3300034817 | Rhizosphere Soil | MLAEPPHNVGYMVAAYIVAPVILVGYLVGLIGRVRRTMKGR |
| ⦗Top⦘ |