NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076427

Metagenome / Metatranscriptome Family F076427

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076427
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 42 residues
Representative Sequence MLPAEPPQNAGYMVAAYIVAPVILVGYLVSLVRRVRRALRR
Number of Associated Samples 97
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.11 %
% of genes near scaffold ends (potentially truncated) 24.58 %
% of genes from short scaffolds (< 2000 bps) 82.20 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.068 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.864 % of family members)
Environment Ontology (ENVO) Unclassified
(30.508 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(33.051 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 44.93%    β-sheet: 0.00%    Coil/Unstructured: 55.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF01578Cytochrom_C_asm 52.54
PF00230MIP 22.88
PF03379CcmB 10.17
PF02801Ketoacyl-synt_C 2.54
PF00005ABC_tran 1.69
PF00072Response_reg 0.85
PF03544TonB_C 0.85
PF01479S4 0.85
PF13466STAS_2 0.85
PF13490zf-HC2 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 22.88
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 10.17
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.07 %
UnclassifiedrootN/A5.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01D3AJWAll Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium585Open in IMG/M
2199352024|deeps__Contig_118632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi960Open in IMG/M
3300000891|JGI10214J12806_10823702All Organisms → cellular organisms → Bacteria2749Open in IMG/M
3300000953|JGI11615J12901_11329538All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300000956|JGI10216J12902_100951763All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300003992|Ga0055470_10091002All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300004114|Ga0062593_102546204All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300004463|Ga0063356_100605429All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1482Open in IMG/M
3300004463|Ga0063356_100684776All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300004463|Ga0063356_100786429All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1325Open in IMG/M
3300004479|Ga0062595_100320522All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300004479|Ga0062595_100904329All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300004643|Ga0062591_100468968All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1069Open in IMG/M
3300004780|Ga0062378_10058947All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300004782|Ga0062382_10502833All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005093|Ga0062594_101842861All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300005332|Ga0066388_104475272All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis712Open in IMG/M
3300005332|Ga0066388_106099021All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300005332|Ga0066388_107938072All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005434|Ga0070709_10772780All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium752Open in IMG/M
3300005437|Ga0070710_10211351All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300005526|Ga0073909_10061391All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1394Open in IMG/M
3300005546|Ga0070696_101241197All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005841|Ga0068863_100050563All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3939Open in IMG/M
3300005844|Ga0068862_102747687All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005873|Ga0075287_1007248All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1317Open in IMG/M
3300005874|Ga0075288_1015870All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1036Open in IMG/M
3300005875|Ga0075293_1048300All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300005886|Ga0075286_1046895All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300006173|Ga0070716_100443621All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300006175|Ga0070712_100448121All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300006574|Ga0074056_11315619All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006579|Ga0074054_11608722All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium514Open in IMG/M
3300006755|Ga0079222_10137659All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300006755|Ga0079222_10436907All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300006804|Ga0079221_11711201Not Available513Open in IMG/M
3300006845|Ga0075421_100645679All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300006852|Ga0075433_10036852All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4216Open in IMG/M
3300006852|Ga0075433_10851208All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300006852|Ga0075433_11257673All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300006903|Ga0075426_10121270All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1879Open in IMG/M
3300006904|Ga0075424_102568130All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300006954|Ga0079219_10009173All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3228Open in IMG/M
3300006954|Ga0079219_10770972All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300009090|Ga0099827_10416874All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300009137|Ga0066709_102288939All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300009162|Ga0075423_11638722All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300010039|Ga0126309_10143424All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300010040|Ga0126308_11307289All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300010041|Ga0126312_11286609All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010044|Ga0126310_11549120All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010396|Ga0134126_10601879All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300012201|Ga0137365_10577283All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300012208|Ga0137376_11444995Not Available579Open in IMG/M
3300012353|Ga0137367_10956098All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300012354|Ga0137366_10269424All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1259Open in IMG/M
3300012355|Ga0137369_11098428All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012360|Ga0137375_10346348All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1321Open in IMG/M
3300012668|Ga0157216_10504142All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium522Open in IMG/M
3300012917|Ga0137395_10532994All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis847Open in IMG/M
3300012930|Ga0137407_11151481All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium736Open in IMG/M
3300012955|Ga0164298_10044527All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2092Open in IMG/M
3300012955|Ga0164298_10094894All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300012955|Ga0164298_10464266All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium836Open in IMG/M
3300012957|Ga0164303_10117821All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1348Open in IMG/M
3300012960|Ga0164301_11929591Not Available500Open in IMG/M
3300012989|Ga0164305_10357206All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1103Open in IMG/M
3300014314|Ga0075316_1088653All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300015371|Ga0132258_10126292All Organisms → cellular organisms → Bacteria6090Open in IMG/M
3300015371|Ga0132258_11809243All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1539Open in IMG/M
3300015372|Ga0132256_100973956All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300015372|Ga0132256_101090547All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300017936|Ga0187821_10435747All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium541Open in IMG/M
3300018027|Ga0184605_10447896All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300018027|Ga0184605_10516828All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium518Open in IMG/M
3300018482|Ga0066669_10941828All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300019255|Ga0184643_1297806All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300019458|Ga0187892_10001780All Organisms → cellular organisms → Bacteria47122Open in IMG/M
3300019879|Ga0193723_1122535All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium720Open in IMG/M
3300025165|Ga0209108_10580979All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300025318|Ga0209519_10470674All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300025324|Ga0209640_11414323All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium507Open in IMG/M
3300025327|Ga0209751_10955775All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300025910|Ga0207684_10123198All Organisms → cellular organisms → Bacteria2223Open in IMG/M
3300025910|Ga0207684_11048441All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300025993|Ga0208415_1010356All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300025993|Ga0208415_1013326All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300026088|Ga0207641_10059966All Organisms → cellular organisms → Bacteria3242Open in IMG/M
3300026118|Ga0207675_101247608All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium764Open in IMG/M
3300027716|Ga0209682_10006887All Organisms → cellular organisms → Bacteria2957Open in IMG/M
3300027840|Ga0209683_10029990All Organisms → cellular organisms → Bacteria2314Open in IMG/M
3300027840|Ga0209683_10213475All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300027903|Ga0209488_10665472All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300027909|Ga0209382_11341297All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300028587|Ga0247828_10694998All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300028715|Ga0307313_10216366All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300028812|Ga0247825_10573312All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300028878|Ga0307278_10110574All Organisms → cellular organisms → Bacteria1235Open in IMG/M
(restricted) 3300031197|Ga0255310_10170100All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300031576|Ga0247727_10117794All Organisms → cellular organisms → Bacteria2697Open in IMG/M
3300031576|Ga0247727_10363226All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300031576|Ga0247727_10488061All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300031716|Ga0310813_10263402All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300031716|Ga0310813_12259232All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031824|Ga0307413_10805172All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300031852|Ga0307410_10029878All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3476Open in IMG/M
3300031938|Ga0308175_100102446All Organisms → cellular organisms → Bacteria2640Open in IMG/M
3300031965|Ga0326597_10011548All Organisms → cellular organisms → Bacteria11702Open in IMG/M
3300031995|Ga0307409_100023156All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4297Open in IMG/M
3300032005|Ga0307411_10073120All Organisms → cellular organisms → Bacteria2331Open in IMG/M
3300032126|Ga0307415_100383556All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300032421|Ga0310812_10113632All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300034164|Ga0364940_0099942All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium816Open in IMG/M
3300034817|Ga0373948_0045892All Organisms → cellular organisms → Bacteria927Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.86%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.93%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil5.08%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment4.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.24%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.24%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere4.24%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.39%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.39%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.54%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm2.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.69%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.85%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.85%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.85%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.85%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.85%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.85%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300003995Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027716Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
4MG_011733802170459019Switchgrass, Maize And Mischanthus LitterMLQAEPPQNVGYMVAAYVIAPVILVGYLMSLVARARKAAGR
deeps_021354002199352024SoilMSPETPHNAGYMVAAYVVAPVILVGYLVSLWRRVQRALGE
JGI10214J12806_1082370223300000891SoilMPADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALGHTKGA*
JGI11615J12901_1132953813300000953SoilMVADVPQNGGYLVAAYVVTPVILVGYLVSLWRRGTR
JGI10216J12902_10095176323300000956SoilMLPADPPQNAGYMVVAYIVAPVILVGYLAGLMRRVRRVVRK*
Ga0055470_1009100223300003992Natural And Restored WetlandsMPPDTPHNAGYLAAAYVVAPVILLGYLGALWRRVRKAMRE*
Ga0055438_1008988823300003995Natural And Restored WetlandsMPPETPQNAGYMLAAYIVAPVILVGYLLSLWARVRKALIGGRSGGRTVER*
Ga0062593_10254620413300004114SoilMLQVEPPHNVGYMVAAYVVAPVILVGYLMSLVARAKKTERR*
Ga0063356_10060542923300004463Arabidopsis Thaliana RhizosphereMPPENSGYMVAAYVVTAVVLVGYAVLLVRRARRALGRAGREAVREGPESGRT*
Ga0063356_10068477623300004463Arabidopsis Thaliana RhizosphereMPADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALGNARGA*
Ga0063356_10078642913300004463Arabidopsis Thaliana RhizosphereMHETPQNAGYMITAYVVTAVVLVGYWLRLAGKIRRGIRD*
Ga0063356_10184233423300004463Arabidopsis Thaliana RhizosphereMLPAEPPQNAGYMVAAYLVAPAILVGYLVSLVSRVRKAIGRSDGRMVGWSGDRTVGR*
Ga0062595_10032052223300004479SoilMLQAEPPHNVGYMVAAYVVAPVILVGYLMSLLRRARRACKPIGR*
Ga0062595_10090432923300004479SoilMLPAEPPQNAGYMVAAYLVAPAILVGYLVSLVSRVRKAIGRSDGRMV
Ga0062591_10046896813300004643SoilMLPVEPPQNSGYMIAAYIVAPVILVGYLASLVGRVRRAMGGR*
Ga0062378_1005894723300004780Wetland SedimentMSPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVKRTLGRK*
Ga0062382_1050283323300004782Wetland SedimentMPAETPQNAGYMIAAYVVAPVILVGYLVSLWARVRRTLDRE*
Ga0062594_10184286113300005093SoilMPAETPHNVGYLVAAYVVAPVILAGYLAALWGRVRKADGRADGQA
Ga0066388_10447527213300005332Tropical Forest SoilMLPAEPPQNAGYMVAAYIVAPVILVGYLVSLVRRVRRALRR*
Ga0066388_10609902123300005332Tropical Forest SoilMLPADPPHNVGYMVAAYIVAPLILVGYLMSLVRRVAQAERAIGRTGDQGAGGR*
Ga0066388_10793807223300005332Tropical Forest SoilMLPAEPPHNVGYMVAAYIVAPVILVGYLVSLIGRARKAIGW*
Ga0070709_1077278023300005434Corn, Switchgrass And Miscanthus RhizosphereMLPETPHNAGYMVAAYVVAPVILVGYLVSLWRRVRRALGE*
Ga0070710_1021135123300005437Corn, Switchgrass And Miscanthus RhizosphereMSPETPQNAGYMVAAYVVAPVILVGYLVSLWRRVQRALGE*
Ga0073909_1006139133300005526Surface SoilMPAETPENAGYMIAAYVVAPVILVGYLASLWGRVKR
Ga0070696_10124119723300005546Corn, Switchgrass And Miscanthus RhizosphereMPAETPQNAGYMIAAYVVAPVILVGYLASLWRRVRRSLRE*
Ga0068863_10005056333300005841Switchgrass RhizosphereMLPAEPPQNGGYMVAAYIVAPVILVGYLVSLVGRVRKAMGGR*
Ga0068862_10274768723300005844Switchgrass RhizosphereMPAETPENAGYMIAAYVVAPVILVGYLASLWGRVRRAVRRSGGQA
Ga0075287_100724823300005873Rice Paddy SoilMPADVPQNGGYLLAAYVVAPVILVGYMGMLWRRLVRGRRR*
Ga0075288_101587013300005874Rice Paddy SoilMLPADPPHNAGYMVAAYTVAPVILVGYLLSLVGRVRRALEVRGRNVESESP*
Ga0075293_104830013300005875Rice Paddy SoilMPADVPENGGYLLAAYVVAPVILVGYMGMLWRRLVR
Ga0075286_104689513300005886Rice Paddy SoilMPPETPHNVGYLVAAYVVAPVILAGYLAALWGRMR
Ga0070716_10044362123300006173Corn, Switchgrass And Miscanthus RhizosphereMLPADPPHNVGYMVAAYIAAPLILVGYLLGLVRRLRKAIGR*
Ga0070712_10044812123300006175Corn, Switchgrass And Miscanthus RhizosphereMSPETPHNAGYMVAAYVVAPVILVGYLVSLWRRVRRALGE*
Ga0074056_1131561923300006574SoilMLSEPPHNAGYMLAAYIVAPVILVGYLVSLVGRVKRALRE*
Ga0074054_1160872223300006579SoilRRPMLPAEPPHNAGYMLAAYIVAPVILVGYLVSLVGRVKRALRG*
Ga0079222_1013765923300006755Agricultural SoilMLQAEPPQNVGYMVAAYVIAPVILVGYLMSLVGRARKAAGR*
Ga0079222_1043690713300006755Agricultural SoilMLQAEPPHNVGYMVAAYIVAPVILVGYLMSLVARVRKTEGR*
Ga0079221_1171120123300006804Agricultural SoilMLPVDPPRNSGYMVAAYIVAPVILVGYLLTLLGRVRRALGKNGGK*
Ga0075421_10064567923300006845Populus RhizosphereMAPETPQNAGYMVAAYVVAPVILGGYLVTLWRRVRRAVGR*
Ga0075433_1003685253300006852Populus RhizosphereMLPAEPPQNAGYMVAAYLVAPAILVGYLVSLVGRVRKAIGR*
Ga0075433_1085120813300006852Populus RhizosphereMLAEAPHNVGYMVAAYIVAPVILVGYLVGLVRRARRAMKG
Ga0075433_1125767313300006852Populus RhizosphereMAAELPQNGGYLIAAYIVTPVILVGYLVSLWRRVKRAGH*
Ga0075426_1012127043300006903Populus RhizosphereMSPETPQNAGYMVAAYVVAPVILVGYLVSLWRRVQRAL
Ga0075424_10256813023300006904Populus RhizosphereMLPADPPHNVGYMVAAYIAAPLILVGYLLGLVRRLRRAIGRTGVEGDKAI
Ga0079219_1000917333300006954Agricultural SoilMLPAEPPHNVGYMVAAYTVAPVILVGYLISLVQRARRAIGGGGR*
Ga0079219_1077097223300006954Agricultural SoilMLQAEPPQNVGYMVAAYVIAPVILVGYLMSLVARARKAAGR*
Ga0099827_1041687423300009090Vadose Zone SoilMLPEPPANGGYMVAAYIVAPVILVGYLLGLWRRARRALGRE*
Ga0066709_10228893913300009137Grasslands SoilMLAEPPANGGYMVAAYIAAPAILVGYLLTLWRRARKAL
Ga0075423_1163872223300009162Populus RhizosphereMPPEPPQNAGYMIAAYVVAPVILVGYLVSLWTRVRRVLGKAER*
Ga0126309_1014342423300010039Serpentine SoilMLPADTPQNAGYMVAAYVVAPVILVGYLAILWGRLRQAGEHKDG*
Ga0126308_1130728923300010040Serpentine SoilMLADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALASL*
Ga0126312_1128660913300010041Serpentine SoilMASEIPQNAGYMLAAYIITPVILGGYLLSLWRRAKRAIEREGVKA*
Ga0126310_1154912013300010044Serpentine SoilMPPEPPHNGGYMLAAYIVTSVILLGYLVALWLRARSLGQETPP
Ga0134126_1060187923300010396Terrestrial SoilMLQAEPPHNVGYMVAAYIVAPVILVGYLVSLVGRVRRVLGGR*
Ga0137365_1057728323300012201Vadose Zone SoilMLAEPPANGGYMVAAYIAAPAILVGYLLTLWRRARRALGRE*
Ga0137376_1144499513300012208Vadose Zone SoilMLPEPPANGGYMVAAYIAAPAILVGYLLTLWRRARRALGRE*
Ga0137367_1095609823300012353Vadose Zone SoilMLPAEPPQNAGYMVAAYVVAPVILVGYLLSLVRRVRRALR*
Ga0137366_1026942433300012354Vadose Zone SoilMPAEPPANGGYLVAAYLAAPAILVGYLLSLWRRARRALGREGREGRE*
Ga0137369_1109842823300012355Vadose Zone SoilMLTEPPTNGGYMVAAYIAAPAILVGYLLTLWRRARRALGREGREGRE
Ga0137375_1034634813300012360Vadose Zone SoilMLTEPPTNGGYMVAAYIAAPAILVGYLLTLWRRARRALGRE*
Ga0157216_1050414223300012668Glacier Forefield SoilMLPAETPQNAGYMVAAYIVAPVILAGYLAVLWRRLRREVGRTGGR*
Ga0137395_1053299423300012917Vadose Zone SoilMLAEPPANGGYMVAAYIAAPVILVGYLLALWRRAQRALGRE*
Ga0137407_1115148123300012930Vadose Zone SoilPQNAGYMIAAYVVAPVILVGYLASLWRRVRRAVGRTDGRTRG*
Ga0164298_1004452733300012955SoilMLAEPPHNVGYMVAAYIVAPVILVGYLVGLIGRVRRTMKGR*
Ga0164298_1009489413300012955SoilRTCETRRPMLSEPPHNAGYMLAAYIVAPVILVGYLVSLVGRVKRALRE*
Ga0164298_1046426623300012955SoilMLPADPPHHVGYMVAAYIAAPLILVGYLLGLVRRLRKAIGR*
Ga0164303_1011782133300012957SoilMLPAELPRNAGYMVAAYIVAPVILVGYLVSLVGRVRRAMGGR*
Ga0164301_1192959113300012960SoilMLPAEPPQNAGYMVAAYIVAPVILVGYLVSLVGRVRKAMGGR*
Ga0164305_1035720613300012989SoilMLPTEPPQNGGYMVAAYIVAPVILVGYLVSLVGRV
Ga0075316_108865313300014314Natural And Restored WetlandsMTPETPHNAGYLIAAYVVAPVILVGYLGSLWRRLRRSM
Ga0132258_1012629263300015371Arabidopsis RhizosphereMLPVEPPQNSGYMIAAYIVAPVILVGYLVSLVGRVRRAMGGR*
Ga0132258_1180924333300015371Arabidopsis RhizosphereMLPADPPHNVGYMVAAYIAAPLILVGYLLGLVRRLRKAIGDRANGR*
Ga0132256_10097395623300015372Arabidopsis RhizosphereMLPAEPPQSGGYMVAAYIVAPVILVGYLVSLVGRVRRAMGGR*
Ga0132256_10109054723300015372Arabidopsis RhizosphereMLPADPPHNVGYMVAAYIAAPLILVGYLLGLVRRMRRAIGDRANGR*
Ga0187821_1043574723300017936Freshwater SedimentMLQAEPPHNVGYMVAAYIVAPVILVGYLVSLVGRVRRVLGGR
Ga0184605_1044789613300018027Groundwater SedimentAMLPEPPANGGYMVAAYIAAPAILGGYLLTLWRRARRALGRE
Ga0184605_1051682813300018027Groundwater SedimentMLPEPPANGGYMLAAYIVAPVILVGYLLALWRRARRVLGRD
Ga0066669_1094182813300018482Grasslands SoilMLLAELPQNAGYMVAAYIVAPVILVGYLVSLVGRVRKTIGR
Ga0184643_129780613300019255Groundwater SedimentMLPEPPANGGYMVAAYIVAPVILVGYLLALWRRARRALGREGREGREGR
Ga0187892_10001780153300019458Bio-OozeMPDTPQNAGYMIAAYVVAGVVLVAYAVALWLRTRRTDE
Ga0193723_112253523300019879SoilMLPEPPANGGYMVAAYIAAPAILVGYLLTLWRRARRALGRE
Ga0209108_1058097923300025165SoilLPETPQNAGYLIAAYIVAAVVLVGYALALWLRTRRTDA
Ga0209519_1047067413300025318SoilMPPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVKRTLDRK
Ga0209640_1141432323300025324SoilMPPETPQNAGYMIAAYVVTPVILVGYLVSLWGRVRRTLDRK
Ga0209751_1095577513300025327SoilMPPETPQNAGYMIAAYVVAPVILVGYLVSLWGGVKRTLDRK
Ga0210094_106289523300025549Natural And Restored WetlandsMPPETPQNAGYMLAAYIVAPVILVGYLLSLWARVRKALIGGRSGGRTVER
Ga0207684_1012319813300025910Corn, Switchgrass And Miscanthus RhizosphereMPAETPQNAGYMIAAYVVAPVILVGYLASLWGRVKRAVGRSDGRW
Ga0207684_1104844123300025910Corn, Switchgrass And Miscanthus RhizosphereMPAETPQNAGYMVAAYVVAPVILAGYLGMLWGRVKRT
Ga0208415_101035623300025993Rice Paddy SoilMPADVPQNGGYLLAAYVVAPVILVGYMGMLWRRLVRGRRR
Ga0208415_101332623300025993Rice Paddy SoilMLPADPPHNAGYMVAAYTVAPVILVGYLLSLVGRVRRALEVRGRNVESESP
Ga0207641_1005996623300026088Switchgrass RhizosphereMLPAEPPQNGGYMVAAYIVAPVILVGYLVSLVGRVRKAMGGR
Ga0207675_10124760823300026118Switchgrass RhizosphereMPAETPQNAGYMVAAYVVAPTILGGYLLMLWRRVRQAVGR
Ga0209682_1000688753300027716Wetland SedimentMSPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVKRTLGRK
Ga0209683_1002999033300027840Wetland SedimentMSPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVRRTLGRK
Ga0209683_1021347523300027840Wetland SedimentMPAETPQNAGYMIAAYVVAPVILVGYLVSLWARVRRTLDRE
Ga0209488_1066547213300027903Vadose Zone SoilMPAETPQNAGYMVAAYVVAPVILAGYLGMLWGRVKRTE
Ga0209382_1134129723300027909Populus RhizosphereMAPETPQNAGYMVAAYVVAPVILGGYLVTLWRRVRRAVGR
Ga0247828_1069499813300028587SoilMLPAEPPQNGGYMVAAYIVAPVILVGYLVSLLGRVRKAV
Ga0307313_1021636623300028715SoilMLPEPPANGGYMVAAYIAAPAILVGYLLTLWRRARRVLGRE
Ga0307284_1019913313300028799SoilMLAETPGNVGYMIAAYVVAPVILVGYLGSLWRRVKRAGGRSGCQAVR
Ga0247825_1057331213300028812SoilMLPAEPPQNGGYMVAAYIVAPVILVGYLVSLLGRVRKAVRGR
Ga0307278_1011057423300028878SoilMPADPPANGGYMVAAYIVAPAILVGYLLTLWRRARKALGRE
(restricted) Ga0255310_1017010013300031197Sandy SoilMPPETPQNAGFMLAAYIVAPAILVGYLLSLWMRVRRALTG
Ga0247727_1011779453300031576BiofilmLPETPQNAGYLIAAYVVAAIVLVAYAVALWLRARRTDE
Ga0247727_1036322623300031576BiofilmLPETPQNAGYLIAAYLVAAAVLVAYAVALWLRARRTDA
Ga0247727_1048806123300031576BiofilmMPETPQNTGYLIAAYVVAAAVLVTYAVALWLRTRRTTD
Ga0310813_1026340223300031716SoilMLPAEPPQNAGYMLAAYIVAPVILVGYLVSLVGRVRRTMRGR
Ga0310813_1225923223300031716SoilMPAETPHNVGYLVAAYVVAPVILAGYLAALWGRVRKADGRADG
Ga0307413_1080517223300031824RhizosphereMSPETPQNAAYMIAAYVVAPVILLGYLVSLWGRVRRALGGG
Ga0307410_1002987843300031852RhizosphereMQADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALSSL
Ga0308175_10010244613300031938SoilMLQVEPPHNVGYMVAAYVVAPVILVGYLMSLVARAKKAERR
Ga0326597_1001154843300031965SoilMPPDIPQNAGYMVAAYIVTPVILVGYLLSLWRRARRARRMSS
Ga0307409_10002315673300031995RhizosphereTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALSSL
Ga0307411_1007312053300032005RhizosphereMPLETPDNTGYMIAAYIVVPVILVGYLGSLWGRVRRTGGWAAG
Ga0307415_10038355613300032126RhizosphereRRASMLADTPQNAGYMVAAYVVAPVILVGYLVLLWRRVRRALSSL
Ga0310812_1011363223300032421SoilMLPVEPPQNSGYMIAAYIVAPVILVGYLVSLVGRVRRAMGGR
Ga0364940_0099942_609_7343300034164SedimentMPPETPQNAGYMIAAYVVAPVILVGYLVSLWGRVRRVLGGK
Ga0373948_0045892_179_3043300034817Rhizosphere SoilMLAEPPHNVGYMVAAYIVAPVILVGYLVGLIGRVRRTMKGR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.