| Basic Information | |
|---|---|
| Family ID | F076395 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKATTSPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASPEIIE |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.22 % |
| % of genes near scaffold ends (potentially truncated) | 90.68 % |
| % of genes from short scaffolds (< 2000 bps) | 94.92 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.169 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.983 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.458 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.67% Coil/Unstructured: 83.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF03372 | Exo_endo_phos | 8.47 |
| PF02129 | Peptidase_S15 | 5.08 |
| PF00753 | Lactamase_B | 4.24 |
| PF04909 | Amidohydro_2 | 3.39 |
| PF07690 | MFS_1 | 2.54 |
| PF00083 | Sugar_tr | 1.69 |
| PF13340 | DUF4096 | 1.69 |
| PF01548 | DEDD_Tnp_IS110 | 1.69 |
| PF03992 | ABM | 1.69 |
| PF13458 | Peripla_BP_6 | 1.69 |
| PF13817 | DDE_Tnp_IS66_C | 0.85 |
| PF13577 | SnoaL_4 | 0.85 |
| PF08240 | ADH_N | 0.85 |
| PF02738 | MoCoBD_1 | 0.85 |
| PF00296 | Bac_luciferase | 0.85 |
| PF13551 | HTH_29 | 0.85 |
| PF07969 | Amidohydro_3 | 0.85 |
| PF03447 | NAD_binding_3 | 0.85 |
| PF00005 | ABC_tran | 0.85 |
| PF04191 | PEMT | 0.85 |
| PF01609 | DDE_Tnp_1 | 0.85 |
| PF13701 | DDE_Tnp_1_4 | 0.85 |
| PF13586 | DDE_Tnp_1_2 | 0.85 |
| PF07859 | Abhydrolase_3 | 0.85 |
| PF02775 | TPP_enzyme_C | 0.85 |
| PF01979 | Amidohydro_1 | 0.85 |
| PF00581 | Rhodanese | 0.85 |
| PF00496 | SBP_bac_5 | 0.85 |
| PF11066 | DUF2867 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.69 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.85 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.85 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.85 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.85 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.85 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.02 % |
| Unclassified | root | N/A | 38.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01BGKPZ | Not Available | 524 | Open in IMG/M |
| 3300001645|JGI20270J16353_101343 | Not Available | 553 | Open in IMG/M |
| 3300001867|JGI12627J18819_10099864 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300005343|Ga0070687_100964633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 616 | Open in IMG/M |
| 3300005451|Ga0066681_10215162 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005560|Ga0066670_10765448 | Not Available | 585 | Open in IMG/M |
| 3300005764|Ga0066903_102749341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
| 3300005764|Ga0066903_105849390 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300006173|Ga0070716_101371058 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006173|Ga0070716_101728458 | Not Available | 517 | Open in IMG/M |
| 3300006176|Ga0070765_101429563 | Not Available | 651 | Open in IMG/M |
| 3300006806|Ga0079220_11737975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 547 | Open in IMG/M |
| 3300006854|Ga0075425_102350208 | Not Available | 592 | Open in IMG/M |
| 3300009012|Ga0066710_101108049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1224 | Open in IMG/M |
| 3300009174|Ga0105241_12195428 | Not Available | 547 | Open in IMG/M |
| 3300010162|Ga0131853_11426183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300010358|Ga0126370_10185543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1556 | Open in IMG/M |
| 3300010360|Ga0126372_10934291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300010361|Ga0126378_10036205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4477 | Open in IMG/M |
| 3300010361|Ga0126378_10883505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300010361|Ga0126378_10969756 | Not Available | 955 | Open in IMG/M |
| 3300010361|Ga0126378_11506315 | Not Available | 763 | Open in IMG/M |
| 3300010361|Ga0126378_13472065 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010366|Ga0126379_11738303 | Not Available | 728 | Open in IMG/M |
| 3300010366|Ga0126379_11995354 | Not Available | 683 | Open in IMG/M |
| 3300010366|Ga0126379_12461706 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010376|Ga0126381_100967233 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300010376|Ga0126381_103813591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300010376|Ga0126381_104422492 | Not Available | 543 | Open in IMG/M |
| 3300010398|Ga0126383_11931055 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 678 | Open in IMG/M |
| 3300011269|Ga0137392_10123588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 2066 | Open in IMG/M |
| 3300012359|Ga0137385_10731169 | Not Available | 825 | Open in IMG/M |
| 3300012361|Ga0137360_11388919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300012361|Ga0137360_11755849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300012362|Ga0137361_10540126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300012469|Ga0150984_112059680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300012944|Ga0137410_11737860 | Not Available | 549 | Open in IMG/M |
| 3300012971|Ga0126369_12270893 | Not Available | 629 | Open in IMG/M |
| 3300012971|Ga0126369_12332083 | Not Available | 622 | Open in IMG/M |
| 3300012971|Ga0126369_12626408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300015358|Ga0134089_10556926 | Not Available | 508 | Open in IMG/M |
| 3300015374|Ga0132255_105016681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 560 | Open in IMG/M |
| 3300016270|Ga0182036_10551828 | Not Available | 919 | Open in IMG/M |
| 3300016357|Ga0182032_10085503 | Not Available | 2181 | Open in IMG/M |
| 3300016371|Ga0182034_10560787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis | 960 | Open in IMG/M |
| 3300016371|Ga0182034_12078406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300016387|Ga0182040_10319459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1194 | Open in IMG/M |
| 3300016387|Ga0182040_11039378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300016404|Ga0182037_11084922 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300016422|Ga0182039_11784455 | Not Available | 564 | Open in IMG/M |
| 3300016422|Ga0182039_12113555 | Not Available | 519 | Open in IMG/M |
| 3300016445|Ga0182038_10248494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1429 | Open in IMG/M |
| 3300018060|Ga0187765_10212569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1123 | Open in IMG/M |
| 3300020579|Ga0210407_10923964 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300020580|Ga0210403_10963937 | Not Available | 669 | Open in IMG/M |
| 3300020581|Ga0210399_10939604 | Not Available | 699 | Open in IMG/M |
| 3300021170|Ga0210400_10089505 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
| 3300021171|Ga0210405_10873610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300021432|Ga0210384_10286385 | Not Available | 1483 | Open in IMG/M |
| 3300021478|Ga0210402_11299170 | Not Available | 655 | Open in IMG/M |
| 3300022532|Ga0242655_10291098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300025928|Ga0207700_12000597 | Not Available | 506 | Open in IMG/M |
| 3300026359|Ga0257163_1059480 | Not Available | 612 | Open in IMG/M |
| 3300026547|Ga0209156_10409666 | Not Available | 565 | Open in IMG/M |
| 3300027376|Ga0209004_1059437 | Not Available | 644 | Open in IMG/M |
| 3300031543|Ga0318516_10443587 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300031544|Ga0318534_10324753 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300031545|Ga0318541_10326728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium limicola | 856 | Open in IMG/M |
| 3300031545|Ga0318541_10856148 | Not Available | 507 | Open in IMG/M |
| 3300031561|Ga0318528_10538456 | Not Available | 627 | Open in IMG/M |
| 3300031564|Ga0318573_10128830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1317 | Open in IMG/M |
| 3300031573|Ga0310915_10223470 | Not Available | 1321 | Open in IMG/M |
| 3300031573|Ga0310915_10429647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300031679|Ga0318561_10423100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300031680|Ga0318574_10834426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300031681|Ga0318572_10931920 | Not Available | 516 | Open in IMG/M |
| 3300031713|Ga0318496_10269524 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300031719|Ga0306917_10311461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1218 | Open in IMG/M |
| 3300031744|Ga0306918_10169429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1627 | Open in IMG/M |
| 3300031747|Ga0318502_10179091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1220 | Open in IMG/M |
| 3300031754|Ga0307475_10268911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1367 | Open in IMG/M |
| 3300031764|Ga0318535_10170635 | Not Available | 972 | Open in IMG/M |
| 3300031764|Ga0318535_10186968 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300031768|Ga0318509_10407825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 760 | Open in IMG/M |
| 3300031770|Ga0318521_10544044 | Not Available | 700 | Open in IMG/M |
| 3300031770|Ga0318521_10774576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 584 | Open in IMG/M |
| 3300031771|Ga0318546_10971028 | Not Available | 598 | Open in IMG/M |
| 3300031833|Ga0310917_10179162 | Not Available | 1411 | Open in IMG/M |
| 3300031846|Ga0318512_10059918 | Not Available | 1720 | Open in IMG/M |
| 3300031860|Ga0318495_10544179 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031893|Ga0318536_10148159 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300031897|Ga0318520_11016597 | Not Available | 524 | Open in IMG/M |
| 3300031910|Ga0306923_11523949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
| 3300031912|Ga0306921_10248276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2085 | Open in IMG/M |
| 3300031941|Ga0310912_10557326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 892 | Open in IMG/M |
| 3300031942|Ga0310916_11239813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300031945|Ga0310913_10483435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 879 | Open in IMG/M |
| 3300031947|Ga0310909_11265468 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031962|Ga0307479_10135617 | All Organisms → cellular organisms → Bacteria | 2409 | Open in IMG/M |
| 3300031981|Ga0318531_10354929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 663 | Open in IMG/M |
| 3300032010|Ga0318569_10057052 | Not Available | 1702 | Open in IMG/M |
| 3300032025|Ga0318507_10171717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 12-71-4 | 931 | Open in IMG/M |
| 3300032041|Ga0318549_10058461 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300032041|Ga0318549_10375885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 12-71-4 | 640 | Open in IMG/M |
| 3300032063|Ga0318504_10346679 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300032066|Ga0318514_10540154 | Not Available | 621 | Open in IMG/M |
| 3300032076|Ga0306924_11109586 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300032076|Ga0306924_12089166 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032094|Ga0318540_10376125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
| 3300032180|Ga0307471_101743226 | Not Available | 776 | Open in IMG/M |
| 3300032180|Ga0307471_102962159 | Not Available | 602 | Open in IMG/M |
| 3300032180|Ga0307471_103151388 | Not Available | 585 | Open in IMG/M |
| 3300032180|Ga0307471_103291154 | Not Available | 573 | Open in IMG/M |
| 3300032180|Ga0307471_104007669 | Not Available | 520 | Open in IMG/M |
| 3300032261|Ga0306920_100582303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1657 | Open in IMG/M |
| 3300032261|Ga0306920_101406373 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300032261|Ga0306920_102470721 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300033290|Ga0318519_10251438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis | 1023 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 3300001645 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_4702230 | 2035918004 | Soil | MKATTSPIYRWRVGEVEIIRVLEFEAALFEPAVIHPEVCAE |
| JGI20270J16353_1013431 | 3300001645 | Forest Soil | MTVIRSPLYRWRAGEVEITRVLEFEAALFEPTVLYP |
| JGI12627J18819_100998644 | 3300001867 | Forest Soil | MKATNSPIYRWRVGDVEITRVLEFEAALFEPTVIHPEASSEIIERHRAW |
| Ga0070687_1009646332 | 3300005343 | Switchgrass Rhizosphere | MMPTSGSRYRWRLGELEIVRVLEFEAALFEPAVLYPDVTS* |
| Ga0066681_102151622 | 3300005451 | Soil | MVASSSPIYRWRVGEIEITRVLEFETALFEPAVIHPEASLEIIQRHRTW |
| Ga0066670_107654481 | 3300005560 | Soil | MNATTSPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASPEIIARH |
| Ga0066903_1027493413 | 3300005764 | Tropical Forest Soil | MTTTSGSIYRWRVGEVEITRVLEFEAALFEPAVIHPDVTPEIIDR |
| Ga0066903_1058493902 | 3300005764 | Tropical Forest Soil | MKPTTGPIHRWRAGEVEITRVLEFEAALFEPAVIHPEASPEIVERHRTWL |
| Ga0070716_1013710582 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVTTSPIYRWRVGEVEITRVLEFEAALFEPVVLHPE |
| Ga0070716_1017284582 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PNYRWRVGEVEITRVLEFEAALFEPAVIHPEASAEM* |
| Ga0070765_1014295631 | 3300006176 | Soil | MTVISSPLYRWRVGEVEITRVLEFEAALFEPAVLYPEVS |
| Ga0079220_117379751 | 3300006806 | Agricultural Soil | MNRTTSTLYRWRAGEIEITRVLEFEAALFDPAVLYPDAPPELIER |
| Ga0075425_1023502081 | 3300006854 | Populus Rhizosphere | MTAISSPNYRWRVGEVEITRVLEFEAALFEPAVIHPEASAEM* |
| Ga0066710_1011080494 | 3300009012 | Grasslands Soil | MLTEQPMTTTGIPTYRWRVGEVEITRVLEFEAALFEPAVIHPE |
| Ga0105241_121954281 | 3300009174 | Corn Rhizosphere | MTVTSSPLYRWRVGEVEITRVLEFEAALFEPTVLYPEAS |
| Ga0131853_114261832 | 3300010162 | Termite Gut | EPAMIETNGPIYRWRVGEVEITRVLEFEAALFEPAVIHPRGVLGDHC* |
| Ga0126370_101855431 | 3300010358 | Tropical Forest Soil | MSTTGSPIYRWQVGEIEITRVLESEAALFEPAVLYPDASPEIIAQH |
| Ga0126372_109342912 | 3300010360 | Tropical Forest Soil | VNLTSAPTYRWRVGEIEIARVLEFEAALFEPTMLYPEATYETIDRHRT* |
| Ga0126378_100362051 | 3300010361 | Tropical Forest Soil | MMGTNCPIYRWRVGEVEITRVLEFEAALFEPAVIHPEAS |
| Ga0126378_108835052 | 3300010361 | Tropical Forest Soil | VRPTSNPIYRWRVGEIEIARVLEFEAALFEPTMLYPEAT |
| Ga0126378_109697561 | 3300010361 | Tropical Forest Soil | MRATSNPIYRWRVDEIEITRVLEFEAALFEPAVIHPEVSPEIIQQHRAWL |
| Ga0126378_115063151 | 3300010361 | Tropical Forest Soil | MMTSAPTYRWRVGEIQITRVLEFEAALFEPAVIHPDVAPEIIERHRSWLE |
| Ga0126378_134720651 | 3300010361 | Tropical Forest Soil | MKVTNPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASREIIERHRH |
| Ga0126379_117383031 | 3300010366 | Tropical Forest Soil | MLPTSGSGYCWRLGDIEITRVLEFEAALFEPAAIHPGVTAETLESHRS |
| Ga0126379_119953541 | 3300010366 | Tropical Forest Soil | MLPTSGSAYRWRLGDIEITRVLEFEAALFEPTVIHPDVTAEIIESHRGLA* |
| Ga0126379_124617062 | 3300010366 | Tropical Forest Soil | MQAGAGPIYRWRVGEAEITRVLEFEAALFEPTVIHPEVLPEVIERHRAWLEP |
| Ga0126381_1009672331 | 3300010376 | Tropical Forest Soil | MMGTNCPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEIIARHR |
| Ga0126381_1038135911 | 3300010376 | Tropical Forest Soil | MTGTNGLIYRWRVGEVKITRVLEFEAALFEPTVIHPEAS |
| Ga0126381_1044224921 | 3300010376 | Tropical Forest Soil | VRPTSNPVYRWRVGEIEIARVLEFEAALFEPTMLYPEITHE |
| Ga0126383_119310552 | 3300010398 | Tropical Forest Soil | MNATTGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASP |
| Ga0137392_101235881 | 3300011269 | Vadose Zone Soil | MTARSSPNYRWRVGEVEITRVLEFETALFKSAVLHPEASPEIIE |
| Ga0137385_107311691 | 3300012359 | Vadose Zone Soil | MTAISSPNYRWRVGEVEITRVLEFEAALFEPAVIHPEASP* |
| Ga0137360_113889191 | 3300012361 | Vadose Zone Soil | MTAMGSPIYRWRVGEVEITRVLEFEAALFEPAVLYPEAPSEIVERHR |
| Ga0137360_117558492 | 3300012361 | Vadose Zone Soil | MKATTSPIYRWRVGEVEIIRVLEFEAALFEPAVIHPEVCAEIIERHRI* |
| Ga0137361_105401263 | 3300012362 | Vadose Zone Soil | MTAMGSPIYRWRVGEVEITRVLEFEAALFEPAVLYPEAPSEI |
| Ga0150984_1120596801 | 3300012469 | Avena Fatua Rhizosphere | MKATGSPIYRWRVGEVEITRVLEFEDALFEPAVIHPEASPEVIRRHRS |
| Ga0137410_117378602 | 3300012944 | Vadose Zone Soil | MTAISSPNYRWRVGEVEITRVLEFEAALFEPAVIHPEAS |
| Ga0126369_122708931 | 3300012971 | Tropical Forest Soil | MTATTSPIYRWRVGEVEITRVLEFEAALFELAVIHPG |
| Ga0126369_123320832 | 3300012971 | Tropical Forest Soil | MTGTNGLIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEIIARHR |
| Ga0126369_126264081 | 3300012971 | Tropical Forest Soil | MTGTNGPIYRWRVGEVEITRVLEFEAALFDPAVIHPEASSEIIARHRAWL |
| Ga0134089_105569262 | 3300015358 | Grasslands Soil | MTAISNPNYRWRVGEVEITRVLEFEAALFEPAVIHPEASP |
| Ga0132255_1050166811 | 3300015374 | Arabidopsis Rhizosphere | QKEQSMTGTNGPIYRWRLGEVEITRVLEFEAALFEPAVIHPGASS* |
| Ga0182036_105518282 | 3300016270 | Soil | VKLTSDPIYRWRVGEIEIARVLEFEAALFEPTMLYPDATHEIIE |
| Ga0182032_100855031 | 3300016357 | Soil | MTGTNGLIYRWRVGEVEITRVLEFEAALFEPAVIHPEASS |
| Ga0182034_105607872 | 3300016371 | Soil | MKATTSPIYRWRVGDVEITPVLEFEAALFEPAVIH |
| Ga0182034_120784062 | 3300016371 | Soil | SPIYRWRVGEVEITRVIEFEAALFEPAVIHPEAPPR |
| Ga0182040_103194594 | 3300016387 | Soil | MLPTSGSYRWRLGEIEITRVLEFEAALFEPTVIHPYVTADIIERHRSWLE |
| Ga0182040_110393781 | 3300016387 | Soil | VRPTSDPIYRWRVGEIEIARVLEFEAALFEPTMLYPEATHEIIERHRTWL |
| Ga0182037_110849221 | 3300016404 | Soil | MTAATDPIYRWRVGEIEISRVLEFEAALFEPSVIHPES |
| Ga0182039_117844552 | 3300016422 | Soil | MTGTNGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEIIALHRAWL |
| Ga0182039_121135552 | 3300016422 | Soil | MTGTNGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEIIARHR |
| Ga0182038_102484941 | 3300016445 | Soil | VKLTSDPIYRWRVGEIEIARVLEFEAALFEPTMLY |
| Ga0187765_102125691 | 3300018060 | Tropical Peatland | VRLNSPTYRWRVGEVEISRVLEFEAALFEPAMLYPE |
| Ga0210407_109239642 | 3300020579 | Soil | MKATTSPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASPEIIE |
| Ga0210403_109639371 | 3300020580 | Soil | PMTVISSPLYRWRAGKVEITGVLEFEAALFEPTVLYPEASPEVVRRHRSWHC |
| Ga0210399_109396041 | 3300020581 | Soil | MKAASTPIYRWRIGEVEITRVLEFEAALFEPAVLHPEASP |
| Ga0210400_100895051 | 3300021170 | Soil | MTVMSSPLYRWRVGEVEITRVLEFEAALFEPAVLYPEAS |
| Ga0210405_108736102 | 3300021171 | Soil | MTAISSPNYRWRVGEIEITRVLEFEAALFEPAVIHPEASPEIIARHRSSSRH |
| Ga0210384_102863851 | 3300021432 | Soil | MKATTRPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASPEIIERHRAW |
| Ga0210402_112991702 | 3300021478 | Soil | MTAISSPTYRWRAGEVEITRVLEFEAALFDPAVIHPEASPE |
| Ga0242655_102910982 | 3300022532 | Soil | MRATTSPIYRWQVGEIEITRVLEFEAALFEPGVIHPEASPEIIEQHRT |
| Ga0207700_120005971 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATTSPIYRWRVGEVEITRVLEFEAALFEPAVIHPEAS |
| Ga0257163_10594802 | 3300026359 | Soil | MTVISSPLYRWRVGEVEITRVLEFEAALFEPAVLYPEVSREV |
| Ga0209156_104096662 | 3300026547 | Soil | MTAISSPNYRWRVGEVEITRVLEFEAALFEPAVIHPEASPEII |
| Ga0209004_10594371 | 3300027376 | Forest Soil | MTAISSPNYRWRVGEIEITRVLEFEAALFEPAVIHPEASPEIIARHRTCRLESL |
| Ga0318516_104435871 | 3300031543 | Soil | MSATTGPLYRWRIGEIEITRVLEFEAALFEPAVIHPEASHEIVE |
| Ga0318534_103247532 | 3300031544 | Soil | MSATTGPLYRWRIGEIEITRVLEFEAALFEPAVIHPEASHEIVERHRAW |
| Ga0318541_103267281 | 3300031545 | Soil | MEATNPIYRWRVGEIEITRVLEFEAALFEPAVIHPEASPEII |
| Ga0318541_108561482 | 3300031545 | Soil | VKLTSDPIYRWRVGEIEIARVLEFEAALFEPTMLYPEVTHEII |
| Ga0318528_105384562 | 3300031561 | Soil | MTGTNGLIYRWCVGEIEITRVLEFEAALFEPTVIHPEASSEII |
| Ga0318573_101288303 | 3300031564 | Soil | MTGIHGPIYRWRAGEVEITRVLEFEAALFEPAVIHPEASSEIIARHRAWLE |
| Ga0310915_102234701 | 3300031573 | Soil | MTATNSPIYRWRVGEIEITRVLEFEAALFEPAVIHPEAPPEIIERHRAW |
| Ga0310915_104296471 | 3300031573 | Soil | VRPTSNPIYRWRVGEIEIARVLEFEAALFEPTMLYPKATHEIIERHRT |
| Ga0318561_104231002 | 3300031679 | Soil | MTGTNGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEII |
| Ga0318574_108344262 | 3300031680 | Soil | LTAATSPIYRWRVDEVEITRVLEFEAALFEPAVIHPEASREIIERHRS |
| Ga0318572_109319201 | 3300031681 | Soil | MTGTNGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEIIARHRA |
| Ga0318496_102695242 | 3300031713 | Soil | MTATNSPIYRWRVGEIEITRVLEFEAALFEPAVIHPEAPPE |
| Ga0306917_103114611 | 3300031719 | Soil | MKAITSPAYRWRAGEVEITRVLEFEAALFEPAVIHPEASPEIIERHRSWL |
| Ga0306918_101694293 | 3300031744 | Soil | MTGTNGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEIIARHRAWL |
| Ga0318502_101790911 | 3300031747 | Soil | MTGTNGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEIIALHR |
| Ga0307475_102689113 | 3300031754 | Hardwood Forest Soil | MTATATTSPIYRWRVGEIEITRVLEFEAALFEPAVIHPEVCPEI |
| Ga0318535_101706351 | 3300031764 | Soil | MKATTSPIYRWRVGEVEITRVVEFEAALFEPAVIHPEASPKIIEPNV |
| Ga0318535_101869681 | 3300031764 | Soil | VKTTASPIYRWRIGGVEIIRVLEFEAALFDPAVIHPEVSSEIIERHQ |
| Ga0318509_104078251 | 3300031768 | Soil | VKLTSDPIYRWRVGEIEIARVPEFEAALFEPTMLY |
| Ga0318521_105440441 | 3300031770 | Soil | MTGTNGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEIIAR |
| Ga0318521_107745761 | 3300031770 | Soil | MKTTSGSRYRWRVGEIEITRVLEFEAALFEPAVIHPDVTPEIIERHR |
| Ga0318546_109710281 | 3300031771 | Soil | MNGTSTPIYRWRVGEVEITRVLEFEAALFEPPVLYPG |
| Ga0310917_101791621 | 3300031833 | Soil | MLPTSGSYRWRLGEIEITRVLEFEAALFEPTVIHPYITADIIERHRS |
| Ga0318512_100599181 | 3300031846 | Soil | MTGTNGLIYRWRVGEVEITRVLEFEAALFEAALFEPAVIHPEASSEIIARHRAWLE |
| Ga0318495_105441792 | 3300031860 | Soil | VKTTASPIYRWRIGGVEITRVLEFEAALFDPAVIHPEVSSE |
| Ga0318536_101481591 | 3300031893 | Soil | MEATSPIYRWRVGDVEITRVLEFEAALFEPAIIHPEASPELIERHRSWL |
| Ga0318520_110165972 | 3300031897 | Soil | VRPTSNPIYRWRVGEIEIARVLEFEAALFEPTMLYPEATHE |
| Ga0306923_115239492 | 3300031910 | Soil | VKLTSDPIYRWRVGEIEIARVLEFEAALFEPTMLYPEVTHEIIER |
| Ga0306921_102482761 | 3300031912 | Soil | MKAITSPAYRWRAGEVEITRVLEFEAALFEPAVIHPEASPEIIE |
| Ga0310912_105573263 | 3300031941 | Soil | MKATNSPIYRWRVGDVEITRVLEFEAALFEPAVIHPEASSE |
| Ga0310916_112398131 | 3300031942 | Soil | VRPTSNPIYRWRVGEIEIARVLEFEAALFEPTMLYPKATHEIIE |
| Ga0310913_104834352 | 3300031945 | Soil | MNATTGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASPE |
| Ga0310909_112654681 | 3300031947 | Soil | VRPTSNPIYRWRVGEIEIARVLEFEAALFEPTMLYPEATH |
| Ga0307479_101356175 | 3300031962 | Hardwood Forest Soil | MKATTSPIYRWRVGEVEIIRVLEFEAALFEPAVIHPEVCAEIIERHRI |
| Ga0318531_103549291 | 3300031981 | Soil | VKLTSDPIYRWRVGEIEIARVLEFEAALFEPTMLYPEVTHEI |
| Ga0318569_100570521 | 3300032010 | Soil | MTGTNGLIYRWRVGEVEITRVLEFEAALFEPAVIH |
| Ga0318507_101717172 | 3300032025 | Soil | MEATNPIYRWRVGEIEITRVLEFEAALFEPAVIHPET |
| Ga0318549_100584611 | 3300032041 | Soil | MGPTISPIYRWQVGEIESTRVLEFEAALFEPGVIHPEASPEIIEQHRT |
| Ga0318549_103758852 | 3300032041 | Soil | MEATSPIYRWRVGDVEITRVLEFEAALFEPAIIHP |
| Ga0318504_103466791 | 3300032063 | Soil | MGPTISPIYRWQVGEIEITRVLEFEAALFEPGVIHPEAS |
| Ga0318514_105401542 | 3300032066 | Soil | MTGIHGPIYRWRAGEVEITRVLEFEAALFEPAVIHPEASSEI |
| Ga0306924_111095861 | 3300032076 | Soil | MIATSASTYHWRVGEIEITRVLEFEAALFEPVVIHPE |
| Ga0306924_120891662 | 3300032076 | Soil | LTAATSPIYRWRVDEIEITRVLEFEAALFEPAVIHPEASREIIERHRS |
| Ga0318540_103761251 | 3300032094 | Soil | MTGTNGPIYRWRVGEVEITRVLEFEAALFEPAVIHPEASSEIIARHRAWLE |
| Ga0307471_1017432261 | 3300032180 | Hardwood Forest Soil | MKATTSPIYRWRVGEVEITRVLEFEAALFEPAVIHPEA |
| Ga0307471_1029621592 | 3300032180 | Hardwood Forest Soil | MTAMGSPIYRWRVSEVEITRVLEFEAALFEPAVIHPEASPEIIAR |
| Ga0307471_1031513881 | 3300032180 | Hardwood Forest Soil | MTAISSPNYRWRVGEVEITRVLEFEAALFEPAVIHPEASAEM |
| Ga0307471_1032911542 | 3300032180 | Hardwood Forest Soil | MTAIDSPIYRWRVGEVEITRVLEFEAALFEPAVIHPE |
| Ga0307471_1040076691 | 3300032180 | Hardwood Forest Soil | MTASSSPNYRWRVGEVEITRVLEFEAALFEPAVIHPEASPE |
| Ga0306920_1005823033 | 3300032261 | Soil | VRTTSNPIYHWHVGEVEITRVLEFEAALFEPTMLYPEASSEIIEPHRGLNGSCQSRA |
| Ga0306920_1014063732 | 3300032261 | Soil | MTATTSPIYRWRVGEIEITRVLEFEAALFEPAVIHP |
| Ga0306920_1024707212 | 3300032261 | Soil | VKTIASPIYRWRIGGVEITRALEFEAALFDPAVIHPEVSSEIIERHQRWLAPTS |
| Ga0318519_102514381 | 3300033290 | Soil | MKATTSPIYRWRVGDVEITPVLEFEAALFEPAVIHPEATSAIIE |
| ⦗Top⦘ |