| Basic Information | |
|---|---|
| Family ID | F076376 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 46 residues |
| Representative Sequence | ATLVDASGKVVARVRFTDVFTYRDGRWQALAGQESLLSEASR |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.61 % |
| % of genes from short scaffolds (< 2000 bps) | 94.07 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.966 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.254 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.729 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.288 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.71% β-sheet: 41.43% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF02580 | Tyr_Deacylase | 79.66 |
| PF06941 | NT5C | 4.24 |
| PF03551 | PadR | 2.54 |
| PF00829 | Ribosomal_L21p | 2.54 |
| PF13231 | PMT_2 | 1.69 |
| PF00809 | Pterin_bind | 1.69 |
| PF03466 | LysR_substrate | 1.69 |
| PF11146 | DUF2905 | 0.85 |
| PF08006 | DUF1700 | 0.85 |
| PF01545 | Cation_efflux | 0.85 |
| PF00126 | HTH_1 | 0.85 |
| PF00578 | AhpC-TSA | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1490 | D-aminoacyl-tRNA deacylase | Translation, ribosomal structure and biogenesis [J] | 79.66 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 4.24 |
| COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 2.54 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.54 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.54 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.54 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.85 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.85 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.85 |
| COG4709 | Uncharacterized membrane protein | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.97 % |
| Unclassified | root | N/A | 22.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10267902 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300004091|Ga0062387_101318368 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300004092|Ga0062389_100536048 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300004092|Ga0062389_103391466 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005341|Ga0070691_10171328 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005434|Ga0070709_10034743 | All Organisms → cellular organisms → Bacteria | 3059 | Open in IMG/M |
| 3300005445|Ga0070708_101001370 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005468|Ga0070707_100195013 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300005468|Ga0070707_100463783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1228 | Open in IMG/M |
| 3300005518|Ga0070699_100653433 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300005536|Ga0070697_101574394 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005554|Ga0066661_10811129 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005577|Ga0068857_100420068 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300005602|Ga0070762_10173607 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300006047|Ga0075024_100129073 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300006059|Ga0075017_100103642 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300006102|Ga0075015_100375838 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300006174|Ga0075014_100355551 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300006755|Ga0079222_10626982 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300006796|Ga0066665_10380367 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300006797|Ga0066659_11580447 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009088|Ga0099830_10725614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 819 | Open in IMG/M |
| 3300009630|Ga0116114_1093353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 805 | Open in IMG/M |
| 3300009640|Ga0116126_1060966 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300010048|Ga0126373_10149233 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300010159|Ga0099796_10579521 | Not Available | 505 | Open in IMG/M |
| 3300010336|Ga0134071_10277500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300010375|Ga0105239_10914571 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300011269|Ga0137392_10423936 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300012199|Ga0137383_10722514 | Not Available | 727 | Open in IMG/M |
| 3300012205|Ga0137362_10154577 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300012206|Ga0137380_11497424 | Not Available | 559 | Open in IMG/M |
| 3300012208|Ga0137376_11721554 | Not Available | 518 | Open in IMG/M |
| 3300012917|Ga0137395_10223719 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300012927|Ga0137416_11211168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 680 | Open in IMG/M |
| 3300012929|Ga0137404_10171463 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300012929|Ga0137404_11859151 | Not Available | 560 | Open in IMG/M |
| 3300013100|Ga0157373_10467845 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300014200|Ga0181526_10889015 | Not Available | 560 | Open in IMG/M |
| 3300014493|Ga0182016_10564751 | Not Available | 650 | Open in IMG/M |
| 3300014654|Ga0181525_10142240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1316 | Open in IMG/M |
| 3300014654|Ga0181525_10183030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1146 | Open in IMG/M |
| 3300015078|Ga0167660_1033001 | Not Available | 563 | Open in IMG/M |
| 3300015241|Ga0137418_10995043 | Not Available | 607 | Open in IMG/M |
| 3300015242|Ga0137412_10153231 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
| 3300015264|Ga0137403_10028938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5879 | Open in IMG/M |
| 3300015264|Ga0137403_10463771 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300017927|Ga0187824_10305053 | Not Available | 564 | Open in IMG/M |
| 3300017938|Ga0187854_10264266 | Not Available | 743 | Open in IMG/M |
| 3300017955|Ga0187817_10252896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1123 | Open in IMG/M |
| 3300017998|Ga0187870_1104034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300018016|Ga0187880_1488914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300018030|Ga0187869_10525836 | Not Available | 561 | Open in IMG/M |
| 3300018038|Ga0187855_10293208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300018038|Ga0187855_10803881 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300018040|Ga0187862_10245168 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300018044|Ga0187890_10271015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 955 | Open in IMG/M |
| 3300018046|Ga0187851_10348673 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300018047|Ga0187859_10077827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1746 | Open in IMG/M |
| 3300018060|Ga0187765_10381735 | Not Available | 866 | Open in IMG/M |
| 3300018482|Ga0066669_11016887 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300020579|Ga0210407_10344781 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300020580|Ga0210403_11284276 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300020583|Ga0210401_10408574 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300021402|Ga0210385_10597242 | Not Available | 841 | Open in IMG/M |
| 3300021433|Ga0210391_10251601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1387 | Open in IMG/M |
| 3300022724|Ga0242665_10368936 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300024288|Ga0179589_10542077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300024330|Ga0137417_1217935 | All Organisms → cellular organisms → Bacteria | 3330 | Open in IMG/M |
| 3300025444|Ga0208189_1069447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 644 | Open in IMG/M |
| 3300025612|Ga0208691_1161986 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300025911|Ga0207654_10940009 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300025936|Ga0207670_11280145 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300026294|Ga0209839_10080292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1134 | Open in IMG/M |
| 3300027669|Ga0208981_1151617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 589 | Open in IMG/M |
| 3300027676|Ga0209333_1005371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4419 | Open in IMG/M |
| 3300027678|Ga0209011_1210105 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027748|Ga0209689_1408877 | Not Available | 520 | Open in IMG/M |
| 3300027783|Ga0209448_10127744 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300027855|Ga0209693_10439470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 628 | Open in IMG/M |
| 3300027884|Ga0209275_10236664 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300027894|Ga0209068_10934667 | Not Available | 514 | Open in IMG/M |
| 3300027908|Ga0209006_10908454 | Not Available | 706 | Open in IMG/M |
| 3300028036|Ga0265355_1016902 | Not Available | 621 | Open in IMG/M |
| 3300028536|Ga0137415_10620623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300028740|Ga0302294_10014012 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300028775|Ga0302231_10503756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300028779|Ga0302266_10330500 | Not Available | 553 | Open in IMG/M |
| 3300028780|Ga0302225_10101234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1408 | Open in IMG/M |
| 3300028780|Ga0302225_10297404 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300028828|Ga0307312_10665098 | Not Available | 690 | Open in IMG/M |
| 3300028857|Ga0302289_1070121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 814 | Open in IMG/M |
| 3300028906|Ga0308309_11798450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 518 | Open in IMG/M |
| 3300028909|Ga0302200_10274582 | Not Available | 816 | Open in IMG/M |
| 3300029910|Ga0311369_10672689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 854 | Open in IMG/M |
| 3300029913|Ga0311362_10243149 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300029951|Ga0311371_11786034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300030051|Ga0302195_10401201 | Not Available | 594 | Open in IMG/M |
| 3300030339|Ga0311360_11592859 | Not Available | 510 | Open in IMG/M |
| 3300030492|Ga0302212_1140004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 634 | Open in IMG/M |
| 3300030518|Ga0302275_10190620 | Not Available | 1229 | Open in IMG/M |
| 3300030580|Ga0311355_10995282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 754 | Open in IMG/M |
| 3300030707|Ga0310038_10459858 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031028|Ga0302180_10041063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2839 | Open in IMG/M |
| 3300031234|Ga0302325_11949974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 727 | Open in IMG/M |
| 3300031247|Ga0265340_10455302 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031525|Ga0302326_13281135 | Not Available | 544 | Open in IMG/M |
| 3300031720|Ga0307469_10768296 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300031722|Ga0311351_10284157 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300032805|Ga0335078_12735271 | Not Available | 502 | Open in IMG/M |
| 3300032828|Ga0335080_12128681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300032893|Ga0335069_10000129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 127027 | Open in IMG/M |
| 3300032893|Ga0335069_11748539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 662 | Open in IMG/M |
| 3300033158|Ga0335077_10626868 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300033433|Ga0326726_10817429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 902 | Open in IMG/M |
| 3300033433|Ga0326726_12374923 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300033829|Ga0334854_113838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum → Desulfotomaculum nigrificans | 650 | Open in IMG/M |
| 3300034124|Ga0370483_0084138 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.08% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.08% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.24% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.39% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.39% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.39% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.69% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015078 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028857 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030492 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_2 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102679021 | 3300000567 | Peatlands Soil | TLVDASGKVVARVRFTDVFTYRDGRWQAIAGQESLLSEAKR* |
| Ga0062387_1013183681 | 3300004091 | Bog Forest Soil | ATLVDASGKVVARVRFTDVFTYRDGRWQALAGQESLLSEASR* |
| Ga0062389_1005360484 | 3300004092 | Bog Forest Soil | DASGKVVARVRFTDVFTYRAGRWQVLAGQESLVILPEASR* |
| Ga0062389_1033914661 | 3300004092 | Bog Forest Soil | GNFGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGQESLLSEASR* |
| Ga0070691_101713281 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | ATLVDAQGKTMARVRFTDIYVYRGTRWLAVAGQETLLPEAAK* |
| Ga0070709_100347435 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LATLVDGQGKTLAQVRFTDIYVYRGQRWLAVAGQESLLSDPAK* |
| Ga0070708_1010013701 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RAHVEGDFGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGHETLLVLTEASR* |
| Ga0070707_1001950134 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VLDANGKILTRVRFTNIFAYRDGRWMAVAGQESLLSDAK* |
| Ga0070707_1004637833 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FGFVRGLNEVLDPAGKIAARVRFTDIFTYRDGRWQALAGHETLVGEASP* |
| Ga0070699_1006534331 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SGFTRGLATLVDASGKVIARVRFTDVFTYRDGRWQALAGHESLLGPTGARR* |
| Ga0070697_1015743942 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TRGLAELVDASGKVVARVRFTDVFTYRDGRWQALVGHETLIGEASR* |
| Ga0066661_108111291 | 3300005554 | Soil | TVVDPNGKVLARVRFTDIFVYRDGRWVAVAGQESLLSDTK* |
| Ga0068857_1004200683 | 3300005577 | Corn Rhizosphere | DAQGKTVARVRFTDIYVYRGTRWLAVAGQETLLPEAAK* |
| Ga0070762_101736073 | 3300005602 | Soil | ATLVDASGKVVARVRFTDVFTYRDGRWQALVGQESMLASAEDRH* |
| Ga0075024_1001290731 | 3300006047 | Watersheds | DTLVDAQGNTIARVRFTDIYVYRDHRWLAVAGQETLLPESTK* |
| Ga0075017_1001036424 | 3300006059 | Watersheds | QGNTIARVRFTDIYVYRDHRWQAVAGQETLLPESTK* |
| Ga0075015_1003758381 | 3300006102 | Watersheds | LVDGSGKVVARVRFTDVFVYRDGRWQALAGQESLLGEASR* |
| Ga0075014_1003555511 | 3300006174 | Watersheds | FGFVRGLNEVLDPAGKIKARVRFTDIFTYRDGRWQALAGHETLLSEASR* |
| Ga0079222_106269823 | 3300006755 | Agricultural Soil | VRGLNRVLDASGKEIARVRFTDVFVYRDGRWQAVAGHETLMPEEKK* |
| Ga0066665_103803673 | 3300006796 | Soil | FTRGLAELVDASGKVVARVRFTDVFTYRDGRWQALVGHETLIGEASR* |
| Ga0066659_115804471 | 3300006797 | Soil | RGLATLTDPQGKTVARVRFTDIFVYRDGRWMALAGQETLLPEAK* |
| Ga0099830_107256142 | 3300009088 | Vadose Zone Soil | RAHVEGDFGFTRGLATLVDASGKVVARVCFTDVFTYRDGRWQALAGHETLLVLTEASR* |
| Ga0116114_10933531 | 3300009630 | Peatland | HLSEMRAHVEGNSGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGHESPLALTEASR* |
| Ga0116126_10609663 | 3300009640 | Peatland | RGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGQESLLVLPEASR* |
| Ga0126373_101492333 | 3300010048 | Tropical Forest Soil | RGLNEVLDADGKVIARVRFTDIFAYRDGRWQALVGQETLLPEAKP* |
| Ga0099796_105795212 | 3300010159 | Vadose Zone Soil | FTRGLAELVDASGKVIARVRFTDVFTYRDGRWQALAGHESLLSQASR* |
| Ga0134071_102775001 | 3300010336 | Grasslands Soil | MRAHVEGNSGFTRGLAELVDASGKVVARVRFTDVFTYRDGRWQALVGHETLIGEAGR* |
| Ga0105239_109145713 | 3300010375 | Corn Rhizosphere | DAQGATIARVRFTDIYVYRDQRWLAVAGQESMIPAAK* |
| Ga0137392_104239361 | 3300011269 | Vadose Zone Soil | KLLAQVRFTDIFVYRDGRWQAVAGQETLVTKKAP* |
| Ga0137383_107225143 | 3300012199 | Vadose Zone Soil | DPNGKVLARVRFTDIFVYRDGRWVAVAGQESLLSDAK* |
| Ga0137362_101545771 | 3300012205 | Vadose Zone Soil | KVVARVRFTDVFTYRDGRWQALAGHETLLVLTEASR* |
| Ga0137380_114974241 | 3300012206 | Vadose Zone Soil | GFTRGLAELVDASGKVVARVRFTDVFTYRDGRWQALVGHETLIGEASR* |
| Ga0137376_117215542 | 3300012208 | Vadose Zone Soil | PNGKVLARVRFTDIFVYRDGRWVAVAGQESLLSDAK* |
| Ga0137395_102237191 | 3300012917 | Vadose Zone Soil | DAKGVILAKVRFTDIYVYRDGRWQAVAAHESMLPGTR* |
| Ga0137416_112111682 | 3300012927 | Vadose Zone Soil | LVDASGKVVARVRFTDVFTYRDGRWQALAGQETLLVLSEASR* |
| Ga0137404_101714631 | 3300012929 | Vadose Zone Soil | QGKTLARVRFTDIYVYRVQRWLAVAGQESLLSEPTK* |
| Ga0137404_118591511 | 3300012929 | Vadose Zone Soil | DVDPNGKVLARVRFTDIFVYRDGRWVAVAGQESLLSDAK* |
| Ga0157373_104678451 | 3300013100 | Corn Rhizosphere | LVDAQGKTVARVRFTDIYVYRGTRWLAVAGQETLLPEAAK* |
| Ga0181526_108890152 | 3300014200 | Bog | SGKVIARVRFTDVFAYRDGRWQALAGQETLLGEAAR* |
| Ga0182016_105647511 | 3300014493 | Bog | TAVDAQGKVVARVRFTDIYVYRDGRWQAVAAHESMLTATP* |
| Ga0181525_101422401 | 3300014654 | Bog | TAVDATGKVLARVRFTDIYVYRDGRWQAVAAHESMLAGTP* |
| Ga0181525_101830303 | 3300014654 | Bog | FARGLATLVDATGKVLARVRFTDVFTYRDGRWQALAGHDSLLSEASR* |
| Ga0167660_10330012 | 3300015078 | Glacier Forefield Soil | GDSGFTRGLATLVDASGKVIARVRFTDVWTYRDGRWQALAGQESLLSQASR* |
| Ga0137418_109950432 | 3300015241 | Vadose Zone Soil | FGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGHESLLGEVSR* |
| Ga0137412_101532311 | 3300015242 | Vadose Zone Soil | MRAYVEGNFGFTRGLAELVDASGKVIARVRFTDVFTYRDGRWQALAGHESLLSQATR* |
| Ga0137403_100289388 | 3300015264 | Vadose Zone Soil | RGLAELVDASGKVVARVRFTDVFTYRDGRWQALVGHETLIGEASR* |
| Ga0137403_104637711 | 3300015264 | Vadose Zone Soil | LAELVDVSGKIVARVRFTDVFTYRRGRWQALAGHETLIGQASH* |
| Ga0187824_103050531 | 3300017927 | Freshwater Sediment | LDVQGKILAKVRFTDVYVYRDGRWQCVAGHESILSEKTR |
| Ga0187854_102642661 | 3300017938 | Peatland | HLSEIRAHVEGNSGYTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGHESLLGEAS |
| Ga0187817_102528963 | 3300017955 | Freshwater Sediment | FTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGQESLLSEASR |
| Ga0187870_11040341 | 3300017998 | Peatland | MRAHVEGNSGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGQESLLVLPEASR |
| Ga0187880_14889142 | 3300018016 | Peatland | EGNLGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALVGQESLLSEASR |
| Ga0187869_105258361 | 3300018030 | Peatland | RGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGHESLLGEASR |
| Ga0187855_102932081 | 3300018038 | Peatland | TLVDASGKVVARVRFTDVFTYRDGRWQALAGQESLLVLPEASR |
| Ga0187855_108038812 | 3300018038 | Peatland | GFTRGLATLVDASGNVVARVRFTDVFTYRNGRWQALAGQETLIGEAAR |
| Ga0187862_102451681 | 3300018040 | Peatland | EMRAHVEGNSGFTRGLATLVDASGKIVARVRFTDVFTYRDGRWQAIAGHETLLGEASR |
| Ga0187890_102710153 | 3300018044 | Peatland | DASGKVVARVRFTDVFTYRDGRWQALAGQESLLVLPEASR |
| Ga0187851_103486733 | 3300018046 | Peatland | DASGNVKARVRFTDVYIYRDGRWQALVGQESLLGAASR |
| Ga0187859_100778271 | 3300018047 | Peatland | ATLVDASGKVVARVRFTDVFTYRDGRWQALAGQESLLVLPEASR |
| Ga0187765_103817351 | 3300018060 | Tropical Peatland | NEILDADGKVVARVRFTDIFTYRDGRWQALAGHESLLSEAHR |
| Ga0066669_110168871 | 3300018482 | Grasslands Soil | QGKTMARVSFTYIYDYRDQRWLAVAGQESLLSEPAK |
| Ga0210407_103447811 | 3300020579 | Soil | GLATLVDAQGNTIARVRFTDIYVYRNHRWLAVAGQETLLPEAAK |
| Ga0210403_112842762 | 3300020580 | Soil | DASGKVVARVRFTDVFAYRDGRWQALAGQESLLGEAHR |
| Ga0210401_104085744 | 3300020583 | Soil | LVDAQGKTVARVRFTDIYVYRDGRWLAVAGQESLLPQTAAK |
| Ga0210385_105972421 | 3300021402 | Soil | GDSGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGQESLVPEVSY |
| Ga0210391_102516013 | 3300021433 | Soil | GKVVARVRFTDVFTYRDGRWQALAGQESMLGEASR |
| Ga0242665_103689362 | 3300022724 | Soil | VDGNSGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGHETLLGEASR |
| Ga0179589_105420771 | 3300024288 | Vadose Zone Soil | LAELVDASSKVIARVRFTDVWTYRDGRWQALAGHESLLSQASR |
| Ga0137417_12179355 | 3300024330 | Vadose Zone Soil | QGKTLARVRFTDIYVYRVQRWLAVAGQESLLSEPAK |
| Ga0208189_10694472 | 3300025444 | Peatland | GFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALAGHESPLALTEASR |
| Ga0208691_11619862 | 3300025612 | Peatland | HVEGNFGFTRGLATLVDASGNVVARVRFTDVFTYRNGRWQALAGQETLIGEAAR |
| Ga0207654_109400092 | 3300025911 | Corn Rhizosphere | TLVDAQGKTVARVRFTDIYVYRGTRWLAVAGQETLLPEAAK |
| Ga0207670_112801452 | 3300025936 | Switchgrass Rhizosphere | LVDAQGKTVARVRFTDIYVYRGTRWLAVAGQETLLPEAAK |
| Ga0209839_100802923 | 3300026294 | Soil | GLATLVGETGKVKARVRFTDVFVYRDGRWQALAGQETLMGEASR |
| Ga0208981_11516171 | 3300027669 | Forest Soil | EGNCGFTRGLAELVDASGKVIARVRFTDVFTYRDGRWQALAGHESLLSQAAR |
| Ga0209333_10053711 | 3300027676 | Forest Soil | GKAVARVRFTDVFTYRDGRWQALAGQESLLAEAGSEAGH |
| Ga0209011_12101051 | 3300027678 | Forest Soil | EENSGFTRGLATLVDTSGKIVARVRFTDVFTYRDGRWQALAGHETLLGEASR |
| Ga0209689_14088772 | 3300027748 | Soil | VDPNGKVLARVRFTDIFVYRDGRWVAVAGQESLLSDTK |
| Ga0209448_101277441 | 3300027783 | Bog Forest Soil | DASGKVVARVRFTDVFTYRDGRWQALAGQESLLSEASR |
| Ga0209693_104394701 | 3300027855 | Soil | LVDASGKVVARVRFTDVFTYRDGRWQALVGQESMLASAEDRH |
| Ga0209275_102366643 | 3300027884 | Soil | TRGLATLVDASGKVVARVRFTDVFTYRDGRWQALVGQESMLASAEDRH |
| Ga0209068_109346671 | 3300027894 | Watersheds | SGKVVARVRFTDVFTYRDGRWQALAGHESLLGEASR |
| Ga0209006_109084541 | 3300027908 | Forest Soil | IVIDTSGKVVARVRFTDIFTYRDGRWQAIAGQETLLSGAKR |
| Ga0265355_10169021 | 3300028036 | Rhizosphere | ATAVGKQGKVLDRVRFTDIYVYRDGRWQAVAAHESMLPETPR |
| Ga0137415_106206232 | 3300028536 | Vadose Zone Soil | VDPSGKVVARVRFTDIFTYRDGRWQPLAGQESLLGGASR |
| Ga0302294_100140124 | 3300028740 | Fen | DGNFGFVRGLNEVMDAAGKVVAKVRFTDVFTYRDGRWQAILAHESLLGEASR |
| Ga0302231_105037561 | 3300028775 | Palsa | SGFTRGLATLVDASGKVVARVRFTDVFTYRDRRWQALAGQESLLGGAGR |
| Ga0302266_103305001 | 3300028779 | Bog | TNQLSEMRAYVDGNLGYTRGLATLVDASGNVKARVRFTDVYIYRDGRWQALVGQESLLGAASR |
| Ga0302225_101012344 | 3300028780 | Palsa | MRGHVEGDLGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALVGQESLLSAASR |
| Ga0302225_102974043 | 3300028780 | Palsa | LVDASGKVVARVRFTDVFTYRDRRWQALAGQESLLGGAGR |
| Ga0307312_106650982 | 3300028828 | Soil | QGKTLARVRFTDIYVYRDQRWLAVAGQESLLSEPAK |
| Ga0302289_10701211 | 3300028857 | Fen | RAHVDGNFGFVRGLNEVMDAAGKVVAKVRFTDVFTYRDGRWQAILAHESLLGEASR |
| Ga0308309_117984501 | 3300028906 | Soil | YFGYVRGLNEVGDPTGRIIRARVRFTDVFTYRDGRWQAILAHESLIGEASR |
| Ga0302200_102745821 | 3300028909 | Bog | LVDASGNVKARVRFTDVYIYREGRWQALVGQESLLGAASR |
| Ga0311369_106726893 | 3300029910 | Palsa | VDASGKVVARVRFTDVFTYRDRRWQALAGQESLLGGAGR |
| Ga0311362_102431495 | 3300029913 | Bog | QLSEMRAYVDGNLGYTRGLATLVDASGNVKARVRFTDVYIYREGRWQALVGQESLLGAAS |
| Ga0311371_117860342 | 3300029951 | Palsa | GDLGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALVGQESLLSAASR |
| Ga0302195_104012012 | 3300030051 | Bog | SGNVKARVRFTDVYIYRDGRWQALVGQESLLGAASR |
| Ga0311360_115928591 | 3300030339 | Bog | DASGKVVARVRFTDVFTYRDGRWQALVGHESLIGQAAR |
| Ga0302212_11400041 | 3300030492 | Fen | HLTELRAHVDGNFGFVRGLNEVMDAAGKVVAKVRFTDVFTYRDGRWQAILAHESLLGEAS |
| Ga0302275_101906201 | 3300030518 | Bog | QGKVLARVRFTDIYVYRDGRWQAVAAHESMLTATP |
| Ga0311355_109952823 | 3300030580 | Palsa | RGLATLVDASGKIVARVRFTDVFTYRDGRWQALAGQESLLGEASR |
| Ga0310038_104598582 | 3300030707 | Peatlands Soil | LNAVVDASGKAVARVRFTDIFTYRDGRWQALAGQETLLGEASR |
| Ga0302180_100410635 | 3300031028 | Palsa | RGHVEGDLGFTRGLATLVDASGKVVARVRFTDVFTYRDGRWQALVGQESLLSAASR |
| Ga0302325_119499742 | 3300031234 | Palsa | RAHVEGNCGFARGLATLVDAAGKVLARVRFTDVFTYRDGRWQALAGHDSLLREASR |
| Ga0265340_104553022 | 3300031247 | Rhizosphere | PSGKVVARVRFTDVFTYRDGRWQALAGHETLLGEASR |
| Ga0302326_132811351 | 3300031525 | Palsa | SEMRAHVEGDFGFTRGLATLLDTSGKVVARVRFTDIFTYRDGRWQALAGQESLLSKACR |
| Ga0307469_107682961 | 3300031720 | Hardwood Forest Soil | RAHVEGNSGFTRGLAELVDASGKVVARVRFTDVFTYRDGRWQALAGHETLIGEASR |
| Ga0311351_102841573 | 3300031722 | Fen | VRGLNEVLDAAGKVVAKVRFTDVFTYRDGRWQAILAHESLLGEASR |
| Ga0335078_127352712 | 3300032805 | Soil | RAFVNGEMGFTRGLATLVDASGKVVARVRFTDVFIYRGGRWQALAGQETLIGEAKR |
| Ga0335080_121286812 | 3300032828 | Soil | GLATLLDPQGKRVAQVRFTDIFLYQSGRWQALAGQETLIKQEK |
| Ga0335069_10000129105 | 3300032893 | Soil | MRAHVEGEFGYVRGLNTLGDPTGMTIRAQVRFTDVFLYRDGRWQAILAHESLIGGASR |
| Ga0335069_117485392 | 3300032893 | Soil | TDLRAHVEGNMGFTRGLNEILDADGKIVARVRFTDIFTYRDGRWQALAGHESLLGEAHR |
| Ga0335077_106268683 | 3300033158 | Soil | RAHVEGNMGFTRGLNTIVDAAGEIVARVRFTDVFTYRDGRWQALAGHETLLGEASR |
| Ga0326726_108174291 | 3300033433 | Peat Soil | MRAHVEGNFGFTRGLATLVDASGKVVARVRFTDVFAYRDGRWQALAGHESLLSQASR |
| Ga0326726_123749232 | 3300033433 | Peat Soil | GLAELVAPDGTIKARVRFTDVFTYRDGRWQALAGHETLLGEASR |
| Ga0334854_113838_1_123 | 3300033829 | Soil | LVDASGKIVARVRFTDVFTYRDGRWQALAGQESLLGEASR |
| Ga0370483_0084138_883_1035 | 3300034124 | Untreated Peat Soil | DFGFTRGLATLIDASGKVLARVRFTDVFTYRDGRWQALAGQESLLSDATR |
| ⦗Top⦘ |