Basic Information | |
---|---|
Family ID | F076347 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 118 |
Average Sequence Length | 45 residues |
Representative Sequence | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 118 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 38.14 % |
% of genes near scaffold ends (potentially truncated) | 64.41 % |
% of genes from short scaffolds (< 2000 bps) | 92.37 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.034 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.814 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.763 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.63% β-sheet: 0.00% Coil/Unstructured: 94.37% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 118 Family Scaffolds |
---|---|---|
PF01987 | AIM24 | 87.29 |
PF13421 | Band_7_1 | 4.24 |
PF00005 | ABC_tran | 2.54 |
PF12730 | ABC2_membrane_4 | 0.85 |
PF02595 | Gly_kinase | 0.85 |
PF00892 | EamA | 0.85 |
COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
---|---|---|---|
COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 87.29 |
COG1929 | Glycerate kinase | Carbohydrate transport and metabolism [G] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig99690 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
2166559005|cont_contig51558 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300001867|JGI12627J18819_10369924 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300004082|Ga0062384_100683621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
3300006028|Ga0070717_10823718 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300006032|Ga0066696_10906773 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300006175|Ga0070712_100355705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1200 | Open in IMG/M |
3300006358|Ga0068871_101715643 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300006797|Ga0066659_10562889 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300007255|Ga0099791_10488093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
3300007788|Ga0099795_10007012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 3115 | Open in IMG/M |
3300009011|Ga0105251_10030416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 2712 | Open in IMG/M |
3300009090|Ga0099827_11165426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
3300009101|Ga0105247_10799870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jiangxiensis | 719 | Open in IMG/M |
3300009101|Ga0105247_11789885 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300009137|Ga0066709_102219635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
3300009665|Ga0116135_1202350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jiangxiensis | 759 | Open in IMG/M |
3300009672|Ga0116215_1142028 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300009792|Ga0126374_10216219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jiangxiensis | 1225 | Open in IMG/M |
3300009792|Ga0126374_10223749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jiangxiensis | 1209 | Open in IMG/M |
3300010043|Ga0126380_10045171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 2341 | Open in IMG/M |
3300010043|Ga0126380_12102992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jiangxiensis | 519 | Open in IMG/M |
3300010047|Ga0126382_10443576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jiangxiensis | 1026 | Open in IMG/M |
3300010159|Ga0099796_10430458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
3300010322|Ga0134084_10196608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
3300010335|Ga0134063_10442320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
3300010358|Ga0126370_10684139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 899 | Open in IMG/M |
3300010361|Ga0126378_10266075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1811 | Open in IMG/M |
3300010373|Ga0134128_10880893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jiangxiensis | 991 | Open in IMG/M |
3300010379|Ga0136449_102787567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 690 | Open in IMG/M |
3300010379|Ga0136449_103077056 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300010401|Ga0134121_10839386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
3300010866|Ga0126344_1292477 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300010867|Ga0126347_1135702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1655 | Open in IMG/M |
3300011107|Ga0151490_1735718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1407 | Open in IMG/M |
3300011120|Ga0150983_10000187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
3300011404|Ga0153951_1061503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
3300012096|Ga0137389_11015759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 711 | Open in IMG/M |
3300012201|Ga0137365_10162336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1675 | Open in IMG/M |
3300012201|Ga0137365_10982544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
3300012204|Ga0137374_11128860 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012205|Ga0137362_10494051 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300012206|Ga0137380_10415626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1193 | Open in IMG/M |
3300012210|Ga0137378_10222073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1759 | Open in IMG/M |
3300012351|Ga0137386_11252723 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300012357|Ga0137384_10293232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia vaccinii | 1353 | Open in IMG/M |
3300012357|Ga0137384_10512786 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300012359|Ga0137385_10405200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1162 | Open in IMG/M |
3300012359|Ga0137385_11322679 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300012409|Ga0134045_1343626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300012410|Ga0134060_1179586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
3300012489|Ga0157349_1027198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
3300012496|Ga0157353_1003948 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300012506|Ga0157324_1033804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jiangxiensis | 593 | Open in IMG/M |
3300012508|Ga0157315_1073061 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300012532|Ga0137373_10163045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1869 | Open in IMG/M |
3300012683|Ga0137398_10548160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 797 | Open in IMG/M |
3300012685|Ga0137397_10237655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia vaccinii | 1357 | Open in IMG/M |
3300012923|Ga0137359_10582384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 983 | Open in IMG/M |
3300012925|Ga0137419_10312406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1205 | Open in IMG/M |
3300012925|Ga0137419_11425700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
3300012929|Ga0137404_10799951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 856 | Open in IMG/M |
3300012930|Ga0137407_10035337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 3940 | Open in IMG/M |
3300012951|Ga0164300_10827350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jiangxiensis | 577 | Open in IMG/M |
3300012955|Ga0164298_10218123 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300012971|Ga0126369_11058385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 900 | Open in IMG/M |
3300013105|Ga0157369_10525384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1224 | Open in IMG/M |
3300013306|Ga0163162_12626978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 579 | Open in IMG/M |
3300013307|Ga0157372_12005937 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300014150|Ga0134081_10186221 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300014154|Ga0134075_10386771 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300014201|Ga0181537_10415521 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300014499|Ga0182012_10521761 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300014501|Ga0182024_11110680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 933 | Open in IMG/M |
3300015077|Ga0173483_10485391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300015265|Ga0182005_1038759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
3300015356|Ga0134073_10064405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1014 | Open in IMG/M |
3300015371|Ga0132258_13448229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
3300015372|Ga0132256_102932527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
3300017932|Ga0187814_10068695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1300 | Open in IMG/M |
3300018043|Ga0187887_10934197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
3300018062|Ga0187784_11455390 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300018085|Ga0187772_10459212 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300018431|Ga0066655_10778892 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300020581|Ga0210399_11172855 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300020582|Ga0210395_10999816 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300021171|Ga0210405_11084436 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300021388|Ga0213875_10560487 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300021404|Ga0210389_10650181 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300021478|Ga0210402_11767472 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300022498|Ga0242644_1040060 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300024219|Ga0247665_1042030 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300025928|Ga0207700_10911136 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300025939|Ga0207665_10326791 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300026984|Ga0208732_1007807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
3300027076|Ga0208860_1000974 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
3300027812|Ga0209656_10043934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2567 | Open in IMG/M |
3300027882|Ga0209590_10602928 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300027884|Ga0209275_10611424 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300028138|Ga0247684_1044455 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300028536|Ga0137415_10104408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2685 | Open in IMG/M |
3300028877|Ga0302235_10011903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5193 | Open in IMG/M |
3300028879|Ga0302229_10375723 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300029951|Ga0311371_10127836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3957 | Open in IMG/M |
3300029951|Ga0311371_11260560 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300030007|Ga0311338_10938451 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300030490|Ga0302184_10004536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8523 | Open in IMG/M |
3300030524|Ga0311357_11682864 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300031231|Ga0170824_122966623 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300031708|Ga0310686_107807097 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
3300031747|Ga0318502_10320242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
3300031846|Ga0318512_10666929 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300031939|Ga0308174_11509574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
3300031962|Ga0307479_11081081 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300032074|Ga0308173_10828039 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300032180|Ga0307471_102300428 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300032515|Ga0348332_11025994 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300032782|Ga0335082_11029203 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.93% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.39% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.39% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.39% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.54% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.69% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.69% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.69% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.69% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.69% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.85% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.85% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.85% | |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.85% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011404 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_00418030 | 2124908016 | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI | |
cont_0558.00003710 | 2166559005 | Simulated | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLG |
JGI12627J18819_103699241 | 3300001867 | Forest Soil | LIGGCSTQPESLTTDLMSTGAPHIGQVGEPGSLGCLQ* |
Ga0062384_1006836211 | 3300004082 | Bog Forest Soil | PAIWQWDWPNCSRAMSLIAGCSTHPEPLTEDLMSTGAPHIGQVGEFGSLGCLQYRHI* |
Ga0070717_108237182 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QCDWPSCSRAMSLIGGCSTQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0066696_109067731 | 3300006032 | Soil | DWPSCSRAMSLIGGCLTQPESLTEDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0070712_1003557053 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | CSRAMSLIGGCSTQPEALTTDLMSTGAPHIGQVGEFGSLGCLQYRQM* |
Ga0068871_1017156431 | 3300006358 | Miscanthus Rhizosphere | AMSLIGGCSTQPESLTEDLMSTGAPHSGQVGELGSLGCLQYRQM* |
Ga0066659_105628891 | 3300006797 | Soil | RAMSLIGGCTTQPESLTEDLMSTGAPHSGQVGAFGSLGCLQYRQM* |
Ga0099791_104880931 | 3300007255 | Vadose Zone Soil | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0099795_100070123 | 3300007788 | Vadose Zone Soil | MSLIGGCSTQPESLTEDLMSTGAPHSGQVGAFGSLGCLQYRQM* |
Ga0105251_100304163 | 3300009011 | Switchgrass Rhizosphere | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI* |
Ga0099827_111654262 | 3300009090 | Vadose Zone Soil | MSLIGGCTTQPESLTEDLMSTGAPHSGQVGEFGSLG |
Ga0105247_107998702 | 3300009101 | Switchgrass Rhizosphere | MSLIGGCSTQPESLTEDLMSTGAPHSGQVGELGSLGCLQYRQM* |
Ga0105247_117898851 | 3300009101 | Switchgrass Rhizosphere | SAAGTVVPAIWQCDWPSWSRAMSLIGGCSTQPESLTTDLISTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0066709_1022196351 | 3300009137 | Grasslands Soil | MSLIGGCLTQPESLTEDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0116135_12023502 | 3300009665 | Peatland | MSLIAGCSTHPESLTEDRMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0116215_11420282 | 3300009672 | Peatlands Soil | GTRVPAIWTWDWPNWSRAMSLMGGCSTQPESLTEDLMSTGAPHSGQVGEFGSLGCRQYRQM* |
Ga0126374_102162192 | 3300009792 | Tropical Forest Soil | VTSVTGTVVPAICTWDWPNCSRAMSLIGGCSTQPDELTIDLMSTGAPHSGQVGDCGSLGWRQYRQM* |
Ga0126374_102237492 | 3300009792 | Tropical Forest Soil | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQM* |
Ga0126380_100451713 | 3300010043 | Tropical Forest Soil | CSRAMSLIGGCSTQPDSLTTDLMSTGAPHSGQVGAFGSLGCLQYRQT* |
Ga0126380_121029922 | 3300010043 | Tropical Forest Soil | MSLIGGCSTQPEPLTTDLMSTGAPHIGQVGEPGSLGCLQ* |
Ga0126382_104435762 | 3300010047 | Tropical Forest Soil | MSLIGGCSTQPDALTTDLMSTGAPHSGQVGALGSLGCRQYRQI* |
Ga0099796_104304582 | 3300010159 | Vadose Zone Soil | MSLIGGCSTQPDSLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0134084_101966082 | 3300010322 | Grasslands Soil | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYLQM* |
Ga0134063_104423202 | 3300010335 | Grasslands Soil | TVVPAIWQCDWPSWSRAMSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI |
Ga0126370_106841392 | 3300010358 | Tropical Forest Soil | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQ* |
Ga0126378_102660753 | 3300010361 | Tropical Forest Soil | MSLIGGCSIQPESLTTSLMSTGAPHSGQVGADGSLGCLQYRQTYVFIGGAR* |
Ga0134128_108808932 | 3300010373 | Terrestrial Soil | MSLIGGCSTQPESLTEDLMSTGAPHSGQVGAFGSLGCLQYRQI* |
Ga0136449_1027875672 | 3300010379 | Peatlands Soil | MSLIGGCSTHPESLTEDRMSTGAPHSGQVDELGSLGWRQYRHM* |
Ga0136449_1030770561 | 3300010379 | Peatlands Soil | SWSRAMSLIGGCSTQPESLTEDLMSTGAPHSGQVGEFGSLGCLQYRQI* |
Ga0134121_108393861 | 3300010401 | Terrestrial Soil | MSLIGGCSTQPDALTDDLMSTGAPHSGQVGELGSLGCLQYRQM* |
Ga0126344_12924772 | 3300010866 | Boreal Forest Soil | AMSLIGGCSTQPESVTEDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0126347_11357022 | 3300010867 | Boreal Forest Soil | MSLIGGCSTQPESLTEDLMSTGAPHIGQVGALGSLGCLQYRQM* |
Ga0151490_17357181 | 3300011107 | Soil | IGGCSTQPESLTTDLMSTGAPHIGQVGEPGSLGCLQ* |
Ga0150983_100001872 | 3300011120 | Forest Soil | MSLIGGCWTHPESLTEDLMSTGAPHSGQVGAFGSLGCLQYRQM* |
Ga0153951_10615031 | 3300011404 | Attine Ant Fungus Gardens | MSLIGGCSTHPESLTEDRMSTGAPHIGQVGELGSLGCRQYR |
Ga0137389_110157592 | 3300012096 | Vadose Zone Soil | VPAIWTCDWPNWIRAMSLIGGCATQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0137365_101623361 | 3300012201 | Vadose Zone Soil | AMSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI* |
Ga0137365_109825442 | 3300012201 | Vadose Zone Soil | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQ |
Ga0137374_111288602 | 3300012204 | Vadose Zone Soil | IGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQ* |
Ga0137362_104940511 | 3300012205 | Vadose Zone Soil | WIRAMSLIGGCATQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0137380_104156261 | 3300012206 | Vadose Zone Soil | MSLIGGCATQPESLTTDLMSTGAPHSGQVGAPGSLGCLQYLQMY |
Ga0137378_102220731 | 3300012210 | Vadose Zone Soil | PAIWQCDWPSWSRAMSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQ* |
Ga0137386_112527231 | 3300012351 | Vadose Zone Soil | LTQPESLTEDLMSTGAPHSGQVGAPGSLGCLQYRQM* |
Ga0137384_102932322 | 3300012357 | Vadose Zone Soil | MSLIGGCPTQPESLTEDLMSTGAPHSGQVGALGSLGCLQYRQM* |
Ga0137384_105127861 | 3300012357 | Vadose Zone Soil | AIWQCDWPSWSRAMSLIGGCSTQPESLTLCLMSVGAPHSGQLGWLGSLGCLQYRQT* |
Ga0137385_104052002 | 3300012359 | Vadose Zone Soil | MSLIGGCATQPESLTPDLISTGARTSAQVVEFASLGCLQYRQ |
Ga0137385_113226792 | 3300012359 | Vadose Zone Soil | CATQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0134045_13436262 | 3300012409 | Grasslands Soil | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEFGSLGC |
Ga0134060_11795862 | 3300012410 | Grasslands Soil | GTVVPAIWQCDWPICSRAMSLIGGCLTQPESLTEDLMSTGAPHSGQVGELGSLGCLQYRQM* |
Ga0157349_10271981 | 3300012489 | Unplanted Soil | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGAPGSLGC |
Ga0157353_10039481 | 3300012496 | Unplanted Soil | VVPSIWTCDWPNWSRAMSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI* |
Ga0157324_10338042 | 3300012506 | Arabidopsis Rhizosphere | MSLIGGCSTQPDALTTDLMSTGAPHSGQVGEPGSLGCLQYRQI* |
Ga0157315_10730611 | 3300012508 | Arabidopsis Rhizosphere | WSRAMSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI* |
Ga0137373_101630453 | 3300012532 | Vadose Zone Soil | IWQCDWQSWSRAMSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQ* |
Ga0137398_105481601 | 3300012683 | Vadose Zone Soil | MSLIGGCSTQPESLATDLMSTGAPHSGQVGAPGSLGCLQYLQM* |
Ga0137397_102376551 | 3300012685 | Vadose Zone Soil | WPSWSRAMSLIGGCSTQPDSLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0137359_105823842 | 3300012923 | Vadose Zone Soil | MSLIGGCATQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0137419_103124062 | 3300012925 | Vadose Zone Soil | MSLIGGCSTQPEPLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0137419_114257001 | 3300012925 | Vadose Zone Soil | MSLIGGCATQPESLTEDLMSTGAPHSGQVGALGSLGCLQYRQI* |
Ga0137404_107999512 | 3300012929 | Vadose Zone Soil | MSLIGGCATQPESLTEDLMSTGAPHSGQVGALGSLGCLQYRQM* |
Ga0137407_100353373 | 3300012930 | Vadose Zone Soil | MSLIGGCSTQPESLTEDLMSTGAPHSGQVGALGSLGCLQYRQM* |
Ga0164300_108273502 | 3300012951 | Soil | MSLIGGCSTQPEALTTDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0164298_102181232 | 3300012955 | Soil | VPAIWQCDWPSWSRAMSLIGGCWTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI* |
Ga0126369_110583852 | 3300012971 | Tropical Forest Soil | MSLIGGCSTQPDSLTTDLMSTGAPHSGQVGAFGSLGCLQYRQI* |
Ga0157369_105253842 | 3300013105 | Corn Rhizosphere | MSLIGGCSTQPESLTEDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0163162_126269782 | 3300013306 | Switchgrass Rhizosphere | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGAPGSLGCLQYRQM* |
Ga0157372_120059372 | 3300013307 | Corn Rhizosphere | AMSRIAGCSIHPESLITVLMSTGAPHSGHVGWEGSLGCRQYRQM* |
Ga0134081_101862211 | 3300014150 | Grasslands Soil | QPESLTEDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0134075_103867712 | 3300014154 | Grasslands Soil | MSLIGGCATQPESLTEDLMSTGAPHSGQVGEFGSLGCLQYRQM* |
Ga0181537_104155212 | 3300014201 | Bog | LIGGCSTQPESLTTSLMSTGAPHSGQVGWLGSLGCLQYGQT* |
Ga0182012_105217611 | 3300014499 | Bog | KSALGTIVPSIWQVDWPNWMRAMSRMAGCSDQPESLTTDRTSTLAPHRGQVTALGSLAWRQYRQM* |
Ga0182024_111106802 | 3300014501 | Permafrost | MSLIGGCLIQPESLTESLMSTGAPHSGQVGALGSLGWRQNRQT |
Ga0173483_104853913 | 3300015077 | Soil | SLIGGCSTQPESLTTDLMSTGAPHSGHVGEPGSLGCLQYRQI* |
Ga0182005_10387591 | 3300015265 | Rhizosphere | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGELGSLGCLQYRQM* |
Ga0134073_100644052 | 3300015356 | Grasslands Soil | MSLIGGCLTQPESLTEDLMSTGAPHSGQVGELGSLGCLQYRQM* |
Ga0132258_134482292 | 3300015371 | Arabidopsis Rhizosphere | MSLIGGCSTQPDALTTDLMSTGAPHSGQVGERGSLGCLQYRQM* |
Ga0132256_1029325272 | 3300015372 | Arabidopsis Rhizosphere | MSLIGGCSTQPDALTTDLMSTGAPHSGQVGELGSLGCLQYRQM* |
Ga0187814_100686953 | 3300017932 | Freshwater Sediment | SLIGGCSTHPESLTEDLTSTGAPHSGQVGEFGSLGCLQYRQM |
Ga0187887_109341971 | 3300018043 | Peatland | AVGTLVPAIWTCDWPNWSRAMSLIGGCATQPESLTDDLMSTGAPHSGHVGALGSLGCLQYRQM |
Ga0187784_114553901 | 3300018062 | Tropical Peatland | MSLTGGCSTQPESLTAELMSTGAPHSGQVGEAGSLGCLQYRQM |
Ga0187772_104592121 | 3300018085 | Tropical Peatland | THPESLTEDLMSTGAPHIGQVGEFGSLGCRQYRQI |
Ga0066655_107788922 | 3300018431 | Grasslands Soil | MSLIGGCATQPESLTEDLMSTGAPHSGQVGAPGSLGCLQYRQL |
Ga0210399_111728551 | 3300020581 | Soil | DWPSWSRAMSLIGGCSTQPESLTTDLMSTGAPHSGQVGAPGSLGCLQYLQM |
Ga0210395_109998161 | 3300020582 | Soil | SLIGGCLTQPEELIESLMSTGAPHSGQVGWLGSLGCRQKRQM |
Ga0210405_110844362 | 3300021171 | Soil | CSTQPEPLTTDLMSTGAPHSGQVGAPGSLGCLQYLQM |
Ga0213875_105604872 | 3300021388 | Plant Roots | SRAMSLIGGCSTQPESLTEDLMSTGAPHSGQVGAFGSLGCLQYRQM |
Ga0210389_106501811 | 3300021404 | Soil | RAISLTGGCSTQPESLTTDLMSTGAPHSGQVGAPGSLGCLQYLQM |
Ga0210402_117674721 | 3300021478 | Soil | AISLTGGCSTQPEPLTTDLMSTGAPHSGQVGAPGSLGCLQYLQM |
Ga0242644_10400602 | 3300022498 | Soil | GGCLIQPESLTESLMSTGAPHSGQVGWLGSLGCLQKRHT |
Ga0247665_10420301 | 3300024219 | Soil | TQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI |
Ga0207700_109111362 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VPAIWQCDWPSCNRAMSLIGGCSTQPDSLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM |
Ga0207665_103267911 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VVPAIWQCDWPSWSRAMSLIGGCSTQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM |
Ga0208732_10078072 | 3300026984 | Forest Soil | VTGTRVPAIWTWDWPNWSRAMSLIGGCSTHPESLTEDLMSTGAPHSGQVGAFRSLGCRQYRQM |
Ga0208860_10009741 | 3300027076 | Forest Soil | SRAMSLIGGCSTHPESLTEDRMSTGAPHIGQVGEFGSLGCLQYRQM |
Ga0209656_100439343 | 3300027812 | Bog Forest Soil | MSLIGGCSTQPESLTEDLTSTGAPHSGQVGEFGSLGCRQYRQM |
Ga0209590_106029282 | 3300027882 | Vadose Zone Soil | ATQPESLTTDLMSTGAPHSGQVGEFGSLGCLQYRQM |
Ga0209275_106114242 | 3300027884 | Soil | SFAMSLIGGCLTQPESLTESLMSTGAPHSGQVGWLGSLGCLQKRHT |
Ga0247684_10444552 | 3300028138 | Soil | SLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI |
Ga0137415_101044081 | 3300028536 | Vadose Zone Soil | MSLIGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQT |
Ga0302235_100119036 | 3300028877 | Palsa | MSLIAGCSTHPESLTEDRMSTGAPHSGHVGEFGSLGCLQYRQM |
Ga0302229_103757231 | 3300028879 | Palsa | MSLIAGCWTHPESLTEDLMSTGAPHSGQVGEFGSLGCLQYRQM |
Ga0311371_101278365 | 3300029951 | Palsa | MSLIAGCSTHPESLTEDRMSTGAPHSGQVGEFGSLGCLQYRQM |
Ga0311371_112605602 | 3300029951 | Palsa | MSLTGGCCTQPESLTLSLMSTGAPHSGQVGWLGSLGCRQNRQT |
Ga0311338_109384511 | 3300030007 | Palsa | DWPNCRRAMSLIAGCWTHPESLTEDLMSTGAPHSGQVGEFGSLGCLQYRQM |
Ga0302184_1000453611 | 3300030490 | Palsa | MSLIAGCSTHPESLTEDRMSTGAPHSGQVGEFGSLGCLQYR |
Ga0311357_116828641 | 3300030524 | Palsa | LIAGCWTHPESLTEDLMSTGAPHSGQVGEFGSLGCLQYRQM |
Ga0170824_1229666232 | 3300031231 | Forest Soil | DWPSWSRAMSLIGGCSTQPESLTTDLMSTGAPHSGQVGAPGSLGCLQYLHM |
Ga0310686_1078070971 | 3300031708 | Soil | IGGCSTQPESLTEDLMSTGAPHIGQVGELGSLGCLQYRQM |
Ga0318502_103202422 | 3300031747 | Soil | MSLTGGCSTQPESLTTDLMSTGAPHSGQVDEFGSLGCLQYRQM |
Ga0318512_106669291 | 3300031846 | Soil | AMSLIGGCSTHPESLTEDRMSTGAPHIGQVGEFGSLGCRQYRHM |
Ga0308174_115095741 | 3300031939 | Soil | DWPNWSRAMSLIGGCSTQPDALTTDLMSTGAPHSGQVGELGSLGCLQYRQM |
Ga0307479_110810811 | 3300031962 | Hardwood Forest Soil | GCSTQPDSLTEDLMSTGAPHIGQVGELGSLGCLQYRQM |
Ga0308173_108280391 | 3300032074 | Soil | SRAMSLIGGCSTHPDALTADLMSTGAPHSGQVGELGSLGCLQYRQM |
Ga0307471_1023004281 | 3300032180 | Hardwood Forest Soil | AIWQCDWPSWSRAMSLMGGCSTQPESLTTDLMSTGAPHSGQVGEPGSLGCLQYRQI |
Ga0348332_110259941 | 3300032515 | Plant Litter | NWSRAMSLIGGCSTQPESLTEDLMSTGAPHIGQVGEFGSLGCLQYRQM |
Ga0335082_110292032 | 3300032782 | Soil | MSLIGGYSTQPESLTADLMSTGAPHIGQVGGPGSLGCLQ |
⦗Top⦘ |