| Basic Information | |
|---|---|
| Family ID | F076307 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MPSSAVRTFTDPDDYTAAIRQGTSELTVTERGDFTAKLT |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.40 % |
| % of genes near scaffold ends (potentially truncated) | 92.37 % |
| % of genes from short scaffolds (< 2000 bps) | 86.44 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.475 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (46.610 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.475 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.847 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 0.00% Coil/Unstructured: 86.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF12833 | HTH_18 | 72.03 |
| PF00501 | AMP-binding | 0.85 |
| PF07690 | MFS_1 | 0.85 |
| PF01609 | DDE_Tnp_1 | 0.85 |
| PF13463 | HTH_27 | 0.85 |
| PF14559 | TPR_19 | 0.85 |
| PF08388 | GIIM | 0.85 |
| PF03992 | ABM | 0.85 |
| PF13683 | rve_3 | 0.85 |
| PF13495 | Phage_int_SAM_4 | 0.85 |
| PF08299 | Bac_DnaA_C | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.85 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.85 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.85 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.85 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.47 % |
| Unclassified | root | N/A | 41.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01BM0JL | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 520 | Open in IMG/M |
| 3300004091|Ga0062387_100353403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 971 | Open in IMG/M |
| 3300004092|Ga0062389_102601520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300004152|Ga0062386_100774447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 790 | Open in IMG/M |
| 3300005332|Ga0066388_107109462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300005363|Ga0008090_15218699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 650 | Open in IMG/M |
| 3300005556|Ga0066707_10436489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
| 3300005764|Ga0066903_101310175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1354 | Open in IMG/M |
| 3300005764|Ga0066903_103024193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 911 | Open in IMG/M |
| 3300006176|Ga0070765_100314071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1451 | Open in IMG/M |
| 3300006804|Ga0079221_10947877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
| 3300006954|Ga0079219_10926658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 709 | Open in IMG/M |
| 3300009012|Ga0066710_104817073 | Not Available | 505 | Open in IMG/M |
| 3300010359|Ga0126376_11704004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
| 3300010361|Ga0126378_12096481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300010376|Ga0126381_101964218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300010376|Ga0126381_102902646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300010376|Ga0126381_103621502 | Not Available | 605 | Open in IMG/M |
| 3300010379|Ga0136449_102059297 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300011120|Ga0150983_11755777 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300011271|Ga0137393_10368521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1228 | Open in IMG/M |
| 3300012198|Ga0137364_11076165 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012210|Ga0137378_11362567 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300012362|Ga0137361_10897354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 804 | Open in IMG/M |
| 3300012971|Ga0126369_10865185 | Not Available | 988 | Open in IMG/M |
| 3300014495|Ga0182015_10882394 | Not Available | 561 | Open in IMG/M |
| 3300016270|Ga0182036_11551700 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300016319|Ga0182033_10025471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3689 | Open in IMG/M |
| 3300016319|Ga0182033_10487884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1057 | Open in IMG/M |
| 3300016341|Ga0182035_10872531 | Not Available | 793 | Open in IMG/M |
| 3300016341|Ga0182035_12014727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300016357|Ga0182032_11966134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300016371|Ga0182034_11811138 | Not Available | 538 | Open in IMG/M |
| 3300016404|Ga0182037_10244662 | Not Available | 1416 | Open in IMG/M |
| 3300016404|Ga0182037_11533813 | Not Available | 591 | Open in IMG/M |
| 3300016445|Ga0182038_10667876 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300016445|Ga0182038_10941333 | Not Available | 763 | Open in IMG/M |
| 3300018060|Ga0187765_10670450 | Not Available | 677 | Open in IMG/M |
| 3300020582|Ga0210395_10489287 | Not Available | 926 | Open in IMG/M |
| 3300021170|Ga0210400_10770669 | Not Available | 789 | Open in IMG/M |
| 3300021171|Ga0210405_10441702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1023 | Open in IMG/M |
| 3300021178|Ga0210408_10326214 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300021178|Ga0210408_11106596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300021477|Ga0210398_11613768 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300021478|Ga0210402_11588343 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021560|Ga0126371_11156250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 912 | Open in IMG/M |
| 3300021953|Ga0213880_10178605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300027812|Ga0209656_10141665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1215 | Open in IMG/M |
| 3300027812|Ga0209656_10209696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 940 | Open in IMG/M |
| 3300027829|Ga0209773_10046238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
| 3300027829|Ga0209773_10418138 | Not Available | 555 | Open in IMG/M |
| 3300028906|Ga0308309_10877839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300031231|Ga0170824_105528871 | Not Available | 633 | Open in IMG/M |
| 3300031543|Ga0318516_10635165 | Not Available | 608 | Open in IMG/M |
| 3300031543|Ga0318516_10683394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300031561|Ga0318528_10533843 | Not Available | 630 | Open in IMG/M |
| 3300031572|Ga0318515_10214633 | Not Available | 1032 | Open in IMG/M |
| 3300031573|Ga0310915_10451683 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300031573|Ga0310915_10543877 | Not Available | 824 | Open in IMG/M |
| 3300031573|Ga0310915_11085236 | Not Available | 556 | Open in IMG/M |
| 3300031680|Ga0318574_10154531 | Not Available | 1304 | Open in IMG/M |
| 3300031680|Ga0318574_10932264 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031719|Ga0306917_11473918 | Not Available | 524 | Open in IMG/M |
| 3300031723|Ga0318493_10518305 | Not Available | 660 | Open in IMG/M |
| 3300031724|Ga0318500_10369120 | Not Available | 711 | Open in IMG/M |
| 3300031724|Ga0318500_10649693 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031736|Ga0318501_10724012 | Not Available | 549 | Open in IMG/M |
| 3300031747|Ga0318502_10256910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1021 | Open in IMG/M |
| 3300031763|Ga0318537_10049270 | Not Available | 1526 | Open in IMG/M |
| 3300031778|Ga0318498_10193480 | Not Available | 923 | Open in IMG/M |
| 3300031778|Ga0318498_10250566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
| 3300031780|Ga0318508_1067089 | Not Available | 968 | Open in IMG/M |
| 3300031796|Ga0318576_10031109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2209 | Open in IMG/M |
| 3300031799|Ga0318565_10217147 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031819|Ga0318568_10110378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1654 | Open in IMG/M |
| 3300031833|Ga0310917_10304581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1078 | Open in IMG/M |
| 3300031879|Ga0306919_11537533 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031890|Ga0306925_10558216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1213 | Open in IMG/M |
| 3300031893|Ga0318536_10046678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2080 | Open in IMG/M |
| 3300031896|Ga0318551_10246234 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300031897|Ga0318520_10674036 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300031910|Ga0306923_10153889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2626 | Open in IMG/M |
| 3300031912|Ga0306921_10140342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2822 | Open in IMG/M |
| 3300031912|Ga0306921_10775862 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300031941|Ga0310912_11193387 | Not Available | 579 | Open in IMG/M |
| 3300031942|Ga0310916_10835944 | Not Available | 774 | Open in IMG/M |
| 3300031942|Ga0310916_11206302 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031942|Ga0310916_11649290 | Not Available | 520 | Open in IMG/M |
| 3300031946|Ga0310910_10405626 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300031946|Ga0310910_10421212 | Not Available | 1058 | Open in IMG/M |
| 3300031981|Ga0318531_10439354 | Not Available | 591 | Open in IMG/M |
| 3300032001|Ga0306922_10571068 | Not Available | 1201 | Open in IMG/M |
| 3300032025|Ga0318507_10137397 | Not Available | 1040 | Open in IMG/M |
| 3300032025|Ga0318507_10332422 | Not Available | 661 | Open in IMG/M |
| 3300032039|Ga0318559_10135029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
| 3300032043|Ga0318556_10000556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 10792 | Open in IMG/M |
| 3300032043|Ga0318556_10156606 | Not Available | 1177 | Open in IMG/M |
| 3300032059|Ga0318533_10118420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1849 | Open in IMG/M |
| 3300032059|Ga0318533_10901017 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300032066|Ga0318514_10597717 | Not Available | 587 | Open in IMG/M |
| 3300032068|Ga0318553_10198090 | Not Available | 1047 | Open in IMG/M |
| 3300032090|Ga0318518_10013309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3466 | Open in IMG/M |
| 3300032094|Ga0318540_10037872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2119 | Open in IMG/M |
| 3300032094|Ga0318540_10428435 | Not Available | 639 | Open in IMG/M |
| 3300032180|Ga0307471_100723061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300032180|Ga0307471_102424831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300032261|Ga0306920_100812929 | Not Available | 1371 | Open in IMG/M |
| 3300032828|Ga0335080_11374383 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 703 | Open in IMG/M |
| 3300033158|Ga0335077_11536694 | Not Available | 636 | Open in IMG/M |
| 3300033290|Ga0318519_10012163 | Not Available | 3577 | Open in IMG/M |
| 3300033290|Ga0318519_10190534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1166 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 46.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.78% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_2996380 | 2035918004 | Soil | MPSSAVRTFTDPDDYAAAQRGVKSELTLIGRGHFTAK |
| Ga0062387_1003534032 | 3300004091 | Bog Forest Soil | MPSSAVRTFTDSDDYTSAIRNTRAELTVIGRGHFTASVTR |
| Ga0062389_1026015202 | 3300004092 | Bog Forest Soil | VPSNVLRTFSDPDDYAETIGATRAEMTVMGRGKFTAQLTRIDLHRLRMIQFSDNLP |
| Ga0062386_1007744471 | 3300004152 | Bog Forest Soil | MLSSAVRTFTDPDAYAAAIRAGPVELTVTENTAFTAKLTRVDLHRLWMQ |
| Ga0066388_1071094621 | 3300005332 | Tropical Forest Soil | MPSSVVRTFSDADDYVAAIRQGTVEATVTGRGDFAAKLTKIDLHRLW |
| Ga0008090_152186991 | 3300005363 | Tropical Rainforest Soil | MPSSAVRTFSDPDEYAAAIRAANPELTVTEPGKFTAKLIRIDL |
| Ga0066707_104364892 | 3300005556 | Soil | MPASVVQTFTDPDDYAAAIHPSVVALTVSGRGHFTAR |
| Ga0066903_1013101753 | 3300005764 | Tropical Forest Soil | MPSSAVLTFSDPDDFATAVRGGRVEFTITGRGVFAAKIVR |
| Ga0066903_1030241931 | 3300005764 | Tropical Forest Soil | MPSSAVRTFSDPDEYAAAIRQGNVELTITERGHFEAKLIRIDLPRL |
| Ga0070765_1003140711 | 3300006176 | Soil | MPSSAVHTFTDPDDYAAAIRAGTVELTVNGRGDFTAKL |
| Ga0068871_1019594262 | 3300006358 | Miscanthus Rhizosphere | MPSTTVRTFTDPDELAASARQGNVELTVTGKGTFRTELVRIDLHR |
| Ga0079221_109478772 | 3300006804 | Agricultural Soil | MPSSAVRTFTDPDDYAAAIRHGTYNLTVTECGDFGAKLTRIDLHRL* |
| Ga0079219_109266581 | 3300006954 | Agricultural Soil | MLSSAVRTFSDPDQYAAAIRATTVELTEIGSKQFNANLIRID |
| Ga0066710_1048170731 | 3300009012 | Grasslands Soil | MPSSAVRTFTDPHDYAAAIRATRAELTVMGRGRFTAKLTRIDLHRMEMPRFFDNL |
| Ga0126376_117040042 | 3300010359 | Tropical Forest Soil | MPSSTARTFSDPDDYAAAIRQGTVETTITERGCFNA |
| Ga0126378_120964813 | 3300010361 | Tropical Forest Soil | MPSSAVRTFTDPDDYAAAIRATKAEVVVTGWGQFTA |
| Ga0126381_1019642181 | 3300010376 | Tropical Forest Soil | MPSSAVQTFSDPDDYAASIRAGTAELTVTERGQFAAKLVKIDLHRLW |
| Ga0126381_1029026462 | 3300010376 | Tropical Forest Soil | MPSSAVRTFTDPYEYAAEFRATTAEWTITERGQFTAKLTRI |
| Ga0126381_1035798132 | 3300010376 | Tropical Forest Soil | MPSSAVHTFTDPDDYTAAFRTTTAECAITGRGRFAA |
| Ga0126381_1036215021 | 3300010376 | Tropical Forest Soil | MPSSAVRTFSDPDDYAAAIRATKAEVVITGRGQFT |
| Ga0136449_1020592971 | 3300010379 | Peatlands Soil | MPSSNVRSFTDPDRYAAAIRQGMVEMTVTGRGQFAAQ |
| Ga0150983_117557771 | 3300011120 | Forest Soil | MPSSAVRTFTDPDDYATSIRATRAEMTVMGRGHFTANLT |
| Ga0137393_103685214 | 3300011271 | Vadose Zone Soil | MPSSSVRRFSDPDDYAASIRATRAELTVVGRGSFTAKLV |
| Ga0137364_110761651 | 3300012198 | Vadose Zone Soil | MPSSAVRTFSDPDDYAAAIRQGTYELTVTERGDFTASLTRIDLHH |
| Ga0137378_113625672 | 3300012210 | Vadose Zone Soil | MSSSAVRTFTDPDDYAASARATRAELTVTGRGEFAA |
| Ga0137361_108973541 | 3300012362 | Vadose Zone Soil | MPSSAVRTFIDSDDYVSAIRATRAEMTVTGRGRFRAKL |
| Ga0126369_108651851 | 3300012971 | Tropical Forest Soil | MPSSAVQTFSDPDDYAVAIRQGTVETTITERGRFNAKI |
| Ga0182015_108823941 | 3300014495 | Palsa | MLSSAVRTFTDPDDYAASVRATTVELTIIERGLFAAKL |
| Ga0182036_115517002 | 3300016270 | Soil | MPSSAVRTFTDPDEYAAVIRQGTVEPTTTGHGQFTAKLTRIDL |
| Ga0182033_100254711 | 3300016319 | Soil | MPSSAVRTFTDHDEYAAVIRNTTAEMTITGRGVFNAKLT |
| Ga0182033_104878842 | 3300016319 | Soil | MPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFAAKLTRIDLHRLWMQ |
| Ga0182035_108725311 | 3300016341 | Soil | MPSSVVQTFTDPDDYATAIRNTKAELTITERGHFSGKLTRIDLH |
| Ga0182035_120147271 | 3300016341 | Soil | MPESAVRTFSDPDDYAASIRSGSTEVTVVGSGQFTAKLISLGL |
| Ga0182032_119661342 | 3300016357 | Soil | MPSSAVRTFSDPEEYAASTRATRAELTVTGRGRFTAKLIRI |
| Ga0182034_118111381 | 3300016371 | Soil | MPSNAVQTFTDPDDFEASIRAGEVEVTVTGRGQFCAEATRIE |
| Ga0182037_102446623 | 3300016404 | Soil | MPSSVVQTFTDPDDYATAIRNTKAELTITERGHFSGKL |
| Ga0182037_115338132 | 3300016404 | Soil | MPESAVRTFSDPDDYAASITGGTVQLTAVERGDFHAKLTGIYL |
| Ga0182038_106678762 | 3300016445 | Soil | MPSSAVRTFTDPDEYAAVIRNTTAEMTITGRGVFNAK |
| Ga0182038_109413331 | 3300016445 | Soil | MPSSAVRTFSDPDDYASWIRNTQAEMTVTGRGQFAGKLTRIDFHRLWIQR |
| Ga0187765_106704501 | 3300018060 | Tropical Peatland | MPSSAVRTFSDPDQYAASIRQGTVDLTITERGQFKAKLVRI |
| Ga0210399_100669224 | 3300020581 | Soil | MPLSAMQTFSDPDEYAAAIRAANTEFAVTGRGHFTAKLIR |
| Ga0210395_104892872 | 3300020582 | Soil | MPSSAVRTFTDPDDYAAAIRQGTYELTVTERGHFTAE |
| Ga0210400_107706691 | 3300021170 | Soil | MPDSAVRTFTDADDYGSAMRATRAEMTVMGRGRFTA |
| Ga0210405_104417022 | 3300021171 | Soil | MPSSAVRTFTDPDDYTAAIRQGTSELTVTERGDFTAKLT |
| Ga0210408_103262141 | 3300021178 | Soil | MPLSAVRTFTDPDDYAAAIRQGTYELTVTERGEFTAKLTRI |
| Ga0210408_111065961 | 3300021178 | Soil | MPSSAVRTFTDPDDYAAAQRGVKSELTVIGRGHFTAK |
| Ga0210398_116137681 | 3300021477 | Soil | VPSSVVRTFTDPDDYTTSLRGVTSELTILGRGCFAAQLVGVNLQ |
| Ga0210402_115883432 | 3300021478 | Soil | MPSSTVRNFTDPDDYAAAIRQGTHELTVTERGHFTATLTRIDLHRL |
| Ga0126371_111562501 | 3300021560 | Tropical Forest Soil | MPSSAVRRFADPDDYAAAIRQGNVELAVTQRGVFAAK |
| Ga0213880_101786052 | 3300021953 | Exposed Rock | MPSSAVRTFSDPYDYAAAMRAATTELTVTGRGRFAAKLIRIDLHRMWMQRLSDSLPRVLHAAH |
| Ga0209656_101416651 | 3300027812 | Bog Forest Soil | MPSSDVRAFSDPDDYATAIRATKAEMTVTGRGRFAAKLVRIDLH |
| Ga0209656_102096962 | 3300027812 | Bog Forest Soil | MPSSMVGSFTDPDDYAAAIRATTAELTVTGRGQFA |
| Ga0209773_100462381 | 3300027829 | Bog Forest Soil | MPSSTVRTFTDPEDYAAAIRQGTVELTVTRPGNFTANL |
| Ga0209773_104181382 | 3300027829 | Bog Forest Soil | MPSSAVRNFSDPDDYAAAIRATTSELTLVGRGRFT |
| Ga0308309_108778391 | 3300028906 | Soil | MPSSAVRTFTDPDDYAAAQRGVKSELTLIGRGHFTA |
| Ga0170824_1055288711 | 3300031231 | Forest Soil | MPSSAVRTFSHPDDYTAAMRATRAELTVTGRGDFTAKLIR |
| Ga0318516_106351652 | 3300031543 | Soil | MPSSVVQTFTDPDDYATAIRNTKAELTITERGHFSGKLTRIDLHRL |
| Ga0318516_106833942 | 3300031543 | Soil | MPSSAVRTFTDPDDYAASMRRATAVLTVTEHGDFNAKLSRIDLH |
| Ga0318528_105338431 | 3300031561 | Soil | MPSSAVRTFTDPDDYATAFRTTRAECTITGRGRFTAKL |
| Ga0318515_102146331 | 3300031572 | Soil | MPSSVVRTFSDADDYAAAIRQGTVEVTVTGRGNFAAKLTK |
| Ga0310915_104516831 | 3300031573 | Soil | MPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLTRIDLH |
| Ga0310915_105438771 | 3300031573 | Soil | MPSSVVRTFSDADDYAAAIRQGTVEVTVTGRGNFAAKLTKIDLHRL |
| Ga0310915_110852361 | 3300031573 | Soil | MPSSAVRTFTDPDEYAAVIRQGTVEPTTTGHGQFTAKLTRIDLHRLWM |
| Ga0318574_101545312 | 3300031680 | Soil | MPSSAVRTFSDPDDYAASIRGGTVEMTVVGRGDFSAKLTRIQLHRLW |
| Ga0318574_109322641 | 3300031680 | Soil | MPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFAAKLTRIDLH |
| Ga0306917_114739181 | 3300031719 | Soil | MPSSAVRTFSDPDDYAASIRNTKAEVTVTGRGQFTA |
| Ga0318493_105183051 | 3300031723 | Soil | MPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLTRID |
| Ga0318500_103691202 | 3300031724 | Soil | MPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSA |
| Ga0318500_106496932 | 3300031724 | Soil | MPSSAVRTFSDPDEFSASVRGGTLESTITERGNFNATQVRIDL |
| Ga0318501_107240122 | 3300031736 | Soil | MPSSAVRTFTDPDDYADLIRNTKAEFTITERGHFS |
| Ga0306918_114465411 | 3300031744 | Soil | MPSSAVCKFTDPDDYTAAILGTTAELTVTERGDFAAEIVRI |
| Ga0318502_102569101 | 3300031747 | Soil | MPSSAVRTFSDPDDYAASIRGTSAEMTVMGRGHFRAKLIQ |
| Ga0318537_100492702 | 3300031763 | Soil | MPSSAVRTFTDADDYAACIRNSTAEMTITGRGIFNAKLTRIDLHRL |
| Ga0318498_101934801 | 3300031778 | Soil | MPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLTRIDLHRLWMQ |
| Ga0318498_102505662 | 3300031778 | Soil | MPSSAVQIFSDPDDYASSIRATTIEMMVMERGRFTAK |
| Ga0318508_10670892 | 3300031780 | Soil | MPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLT |
| Ga0318576_100311093 | 3300031796 | Soil | MPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLTRI |
| Ga0318565_102171472 | 3300031799 | Soil | MPSSAVRTFIDSDDYAAAIRATRAEITVTGRGHFTAKLTGSTCIAC |
| Ga0318497_103949671 | 3300031805 | Soil | MPSSTVRTFTDPDAYAAAFRAGTHELTITKRGQFAAK |
| Ga0318568_101103783 | 3300031819 | Soil | MPSSVVRTFSDADDYAAAIRQGTVEVTVTGRGNFAAKLTKIDLHRLWM |
| Ga0310917_103045812 | 3300031833 | Soil | MPSSAVRTFTDPDDYAASIRAGEVELTVIGRGQFSAKGTR |
| Ga0306919_115375331 | 3300031879 | Soil | MPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFA |
| Ga0306925_105582161 | 3300031890 | Soil | MPSSAVRTFSDPDDYAASIRNTKAEVTVTGRGQFTAKIISIGLHRLW |
| Ga0318536_100466783 | 3300031893 | Soil | MPSSAVRTFSDPDDYAAYIRNSTAEMIITGRGAFKAKLTRIDLHSLW |
| Ga0318551_102462341 | 3300031896 | Soil | MPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLTRIDLHRLW |
| Ga0318520_106740362 | 3300031897 | Soil | MPSSAVRTFTDPDEYAAVIRQGTVEPTTTGQGQFTA |
| Ga0306923_101538893 | 3300031910 | Soil | MPSSAVRTFTEPDDYAAAIRYSTTEITVTGRGQFAAKFIRVD |
| Ga0306921_101403424 | 3300031912 | Soil | MPSSAVRTFTDADDYAACIRNSTAEMTITGRGIFNAKLT |
| Ga0306921_107758621 | 3300031912 | Soil | MLSSDVRSFTDPDSYAAAIRQGTVELTLTGRGQFAAQLI |
| Ga0306921_121854971 | 3300031912 | Soil | MPSSAVRTFTDPDEYAASIRGGEVELTVAARGDFRAKLIRIDLHCLWM |
| Ga0310912_111933871 | 3300031941 | Soil | MPSSAVQTFSDPEAYTASIRSTKAELTVLGRGQFAAKLSRI |
| Ga0310916_108359441 | 3300031942 | Soil | MPSSAVRTFTDPDDYAALIRNTKAEFTITERGHFSAKLTRID |
| Ga0310916_112063022 | 3300031942 | Soil | MPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLTRIDL |
| Ga0310916_116492901 | 3300031942 | Soil | MPESAVRTFSDPDDYAASHFSLSEVTLVGRGRFTAKLTRID |
| Ga0310910_104056262 | 3300031946 | Soil | MPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAK |
| Ga0310910_104212121 | 3300031946 | Soil | MPSSVVQTFTDPDDYATAIRNTKAELTITERGHFSGKLTRID |
| Ga0318531_104393541 | 3300031981 | Soil | MPSSAVRTFSDPDDYATSIRATKAEVTVSGRGKFTAK |
| Ga0306922_105710682 | 3300032001 | Soil | MPESAVRTFSDPDDYAASITGGTVQLTAVERGDFHAKLTGIYLQ |
| Ga0318507_101373971 | 3300032025 | Soil | MPSSAVRTFTDPDEYVAVIRQGTVEPTTTGHGQFTAKLTRIDLHRLW |
| Ga0318507_103324222 | 3300032025 | Soil | MPSSAVRTFTDADDYAACIRNSTAEMTITGRGIFNAKLTRIDLHR |
| Ga0318559_101350291 | 3300032039 | Soil | MPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLTR |
| Ga0318556_1000055615 | 3300032043 | Soil | MPSSAVRTFSDPDDYAASIRGGTVEMTVVGRGDFSAKLTRIQLHRL |
| Ga0318556_101566061 | 3300032043 | Soil | MPSSALRTFSDPDDYAALIRNTKAEFTITERGHFSAKLTRIDLHR |
| Ga0318533_101184204 | 3300032059 | Soil | MPSTAVRTFSDPDDYAASIRGTSAEMTVVGRGHFKAKLTQIELH |
| Ga0318533_109010171 | 3300032059 | Soil | MPSSAVRTYSDPEDYVAGIRQGTYELTVTERGRFTAKLT |
| Ga0318514_105977172 | 3300032066 | Soil | MPSSAVRTFTDLDDYAACIRNTTAEMTITGRGVFNAKLTRIDLHRLW |
| Ga0318553_101980901 | 3300032068 | Soil | MPSSAVRTFSDPDDYAASIRGGTVEMTVVGRGDFSA |
| Ga0306924_114392172 | 3300032076 | Soil | MPSSAVHTFTDPDDYTAAFRTTTAECAITGRGRFAAKL |
| Ga0318518_100133094 | 3300032090 | Soil | MPSSAVRTFTDADDYAACIRNSTAEMTITGRGIFNAKLTRIDLH |
| Ga0318540_100378721 | 3300032094 | Soil | MPSSAVRTFTDPDDHAASIRAGDVEVTVTGRGQFC |
| Ga0318540_104284351 | 3300032094 | Soil | MPSSAVHTFTDPAEYAEAIRQGTYELTVTERGDFIADLTRIDLH |
| Ga0307471_1007230611 | 3300032180 | Hardwood Forest Soil | MPSSAVRTFTDPDDYAAAQRGVKSELTVIGRGHFTAKL |
| Ga0307471_1024248312 | 3300032180 | Hardwood Forest Soil | MPSSAVRTFTDPGDYAAAQRGVKSELTVIGRGHFTAKLIGI |
| Ga0306920_1008129293 | 3300032261 | Soil | MPSSAVRTFSDPDDYAAAIRQGTVELTITRRGQFSAKL |
| Ga0335080_113743832 | 3300032828 | Soil | MPSSAVRTFTDPDDYAVSARGTTAELSVTGRGVFRAKRIL |
| Ga0335077_115366941 | 3300033158 | Soil | MPSSSVQTFTDPDDYAGSLQATTVELTIIERGSFAAKLTRVK |
| Ga0318519_100121632 | 3300033290 | Soil | MPSSAVQTFTDPGDYATAIRNTKAELTITGRGHFSPNFTLF |
| Ga0318519_101905342 | 3300033290 | Soil | MPSSAVRTFSDPDDYAASIRGTSAEMTVIGRGHFEAK |
| ⦗Top⦘ |