| Basic Information | |
|---|---|
| Family ID | F076288 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 42 residues |
| Representative Sequence | SQILWVDTLDALLGRTVGVPMKPPTELRQLRKEDDTTWA |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.76 % |
| % of genes from short scaffolds (< 2000 bps) | 86.44 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.136 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (11.864 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.881 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.322 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.88% β-sheet: 0.00% Coil/Unstructured: 76.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00676 | E1_dh | 41.53 |
| PF02604 | PhdYeFM_antitox | 2.54 |
| PF12796 | Ank_2 | 2.54 |
| PF13290 | CHB_HEX_C_1 | 0.85 |
| PF02776 | TPP_enzyme_N | 0.85 |
| PF13442 | Cytochrome_CBB3 | 0.85 |
| PF13304 | AAA_21 | 0.85 |
| PF13857 | Ank_5 | 0.85 |
| PF02779 | Transket_pyr | 0.85 |
| PF02780 | Transketolase_C | 0.85 |
| PF03167 | UDG | 0.85 |
| PF07681 | DoxX | 0.85 |
| PF00069 | Pkinase | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 41.53 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 41.53 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.39 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 2.54 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 2.54 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.85 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.14 % |
| Unclassified | root | N/A | 11.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10103442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300001084|JGI12648J13191_1022019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300001166|JGI12694J13545_1022570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300001593|JGI12635J15846_10671911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300004082|Ga0062384_101055146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300004633|Ga0066395_10035218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2119 | Open in IMG/M |
| 3300005435|Ga0070714_101478452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300005534|Ga0070735_10433116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 786 | Open in IMG/M |
| 3300005542|Ga0070732_10043686 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300005557|Ga0066704_10648334 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005587|Ga0066654_10203497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300005591|Ga0070761_10915028 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005610|Ga0070763_10325460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 850 | Open in IMG/M |
| 3300005921|Ga0070766_10420809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300006176|Ga0070765_101506074 | Not Available | 633 | Open in IMG/M |
| 3300006176|Ga0070765_102049581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300006755|Ga0079222_12042901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300006796|Ga0066665_10650041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
| 3300009088|Ga0099830_10227101 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300009088|Ga0099830_10783759 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300009665|Ga0116135_1068980 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300009672|Ga0116215_1028536 | All Organisms → cellular organisms → Bacteria | 2572 | Open in IMG/M |
| 3300009672|Ga0116215_1266701 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300009683|Ga0116224_10427953 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300009698|Ga0116216_10438274 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300009700|Ga0116217_10524365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300009839|Ga0116223_10019611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 4797 | Open in IMG/M |
| 3300010376|Ga0126381_101178064 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae | 1107 | Open in IMG/M |
| 3300010376|Ga0126381_104590418 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010379|Ga0136449_102372051 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010398|Ga0126383_13021747 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300011271|Ga0137393_10846138 | Not Available | 781 | Open in IMG/M |
| 3300012210|Ga0137378_10804080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300012353|Ga0137367_11130314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012918|Ga0137396_10329191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
| 3300014168|Ga0181534_10812386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300014495|Ga0182015_10575672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300017822|Ga0187802_10204902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300017822|Ga0187802_10272316 | Not Available | 657 | Open in IMG/M |
| 3300017823|Ga0187818_10388122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300017931|Ga0187877_1346281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300017934|Ga0187803_10073904 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300017936|Ga0187821_10221172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300017943|Ga0187819_10443084 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300017943|Ga0187819_10860078 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300017955|Ga0187817_10909433 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300017966|Ga0187776_10711359 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300017972|Ga0187781_11044568 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300017975|Ga0187782_11004074 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300017975|Ga0187782_11037810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300017995|Ga0187816_10303764 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300018006|Ga0187804_10164595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300018007|Ga0187805_10095055 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300018009|Ga0187884_10417823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300018026|Ga0187857_10006996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7608 | Open in IMG/M |
| 3300018037|Ga0187883_10461417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → unclassified Caulobacter → Caulobacter sp. 17J80-11 | 653 | Open in IMG/M |
| 3300018047|Ga0187859_10466449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300018090|Ga0187770_10222042 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300020006|Ga0193735_1174249 | Not Available | 535 | Open in IMG/M |
| 3300020579|Ga0210407_10333375 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300020580|Ga0210403_10979260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300020582|Ga0210395_10383078 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300021088|Ga0210404_10048701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1983 | Open in IMG/M |
| 3300021088|Ga0210404_10163647 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300021180|Ga0210396_10338994 | Not Available | 1327 | Open in IMG/M |
| 3300021344|Ga0193719_10142210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300021432|Ga0210384_10537901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
| 3300021559|Ga0210409_11513465 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300021560|Ga0126371_12779392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300025414|Ga0208935_1056354 | Not Available | 527 | Open in IMG/M |
| 3300025910|Ga0207684_10131282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2150 | Open in IMG/M |
| 3300025916|Ga0207663_11574542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300026920|Ga0208575_1017182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300027297|Ga0208241_1032311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300027587|Ga0209220_1030428 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300027662|Ga0208565_1225869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300027727|Ga0209328_10214678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300027737|Ga0209038_10005509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3736 | Open in IMG/M |
| 3300027787|Ga0209074_10417385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300027855|Ga0209693_10425614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300027874|Ga0209465_10125857 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300027879|Ga0209169_10189085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
| 3300027889|Ga0209380_10752336 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300027905|Ga0209415_10774641 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027908|Ga0209006_10435243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300028021|Ga0265352_1017713 | Not Available | 502 | Open in IMG/M |
| 3300028759|Ga0302224_10001724 | All Organisms → cellular organisms → Bacteria | 9244 | Open in IMG/M |
| 3300028776|Ga0302303_10053579 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300028789|Ga0302232_10218165 | Not Available | 949 | Open in IMG/M |
| 3300028808|Ga0302228_10293713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300028906|Ga0308309_11393269 | Not Available | 601 | Open in IMG/M |
| 3300029882|Ga0311368_10506361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 867 | Open in IMG/M |
| 3300029907|Ga0311329_10580835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300029943|Ga0311340_11198722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300029954|Ga0311331_10183661 | All Organisms → cellular organisms → Bacteria | 2426 | Open in IMG/M |
| 3300029999|Ga0311339_11327344 | Not Available | 650 | Open in IMG/M |
| 3300030057|Ga0302176_10061179 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300030507|Ga0302192_10150868 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300030707|Ga0310038_10396424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300030838|Ga0311335_10437670 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031057|Ga0170834_103413695 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031708|Ga0310686_112389158 | All Organisms → cellular organisms → Bacteria | 3490 | Open in IMG/M |
| 3300031715|Ga0307476_11085069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300031753|Ga0307477_10341014 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300031754|Ga0307475_10008464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 6732 | Open in IMG/M |
| 3300031754|Ga0307475_10752840 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300031947|Ga0310909_11116763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300032160|Ga0311301_11054711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1065 | Open in IMG/M |
| 3300032180|Ga0307471_103278066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300032783|Ga0335079_10033678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5881 | Open in IMG/M |
| 3300032805|Ga0335078_12048307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300032896|Ga0335075_11538219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300033755|Ga0371489_0290538 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300034163|Ga0370515_0073933 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 9.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.63% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.24% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.54% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101034421 | 3300000567 | Peatlands Soil | SQSVARNFGRVFESQILWVDTLDALLGRTVGVPMELPDNLRELHDDETFWA* |
| JGI12648J13191_10220191 | 3300001084 | Forest Soil | ISRNSGVVFQSQMLWVDTLDALLGRTIGVPMSRPAEIRELHKEDDATWA* |
| JGI12694J13545_10225702 | 3300001166 | Forest Soil | WVETLDVLLGRTVGVPMKPPAELRGLHKENDTTWA* |
| JGI12635J15846_106719112 | 3300001593 | Forest Soil | CQMLWVGTLDALLGHPLGVPLRHPDELRKLHNEEENTWA* |
| Ga0062384_1010551462 | 3300004082 | Bog Forest Soil | FSSQMLWVDTLDALLGCTIGVPMQLPTEFRQLHKEDDSTWA* |
| Ga0066395_100352183 | 3300004633 | Tropical Forest Soil | FGVVFQSQILWVDTLDALLGRTVGVPMRPPSELRQIRKEDDFTWA* |
| Ga0070714_1014784521 | 3300005435 | Agricultural Soil | NFGVVFQSQILWVESLHALLGQTVGVPMKPPAELRHLHKEDETFWA* |
| Ga0070735_104331161 | 3300005534 | Surface Soil | GVVFQSQILWVDTLDALLGNDVGVPIKLPEEFRRFRKEDETRWA* |
| Ga0070732_100436865 | 3300005542 | Surface Soil | NFGVVFLSQMLWVETLDALLGRTVGVPMQPPAELRHLRKEDDTTWA* |
| Ga0066704_106483342 | 3300005557 | Soil | FGVVFQSQMLWVETLDALLGRTVGVPMRPPGEPRSLHQEEDIQRA* |
| Ga0066654_102034971 | 3300005587 | Soil | QILWVDTLDALLGRTIGVPMKPPAELRHLHKEDETSWA* |
| Ga0070761_109150282 | 3300005591 | Soil | RNVGVVFQSQILWLETIDALLGNTVGVPMKRPTELRQLNKEDGTTWA* |
| Ga0070763_103254603 | 3300005610 | Soil | QMLWVETLDALLGRTVGVPVQSPQELRKFHKEDDHTWA* |
| Ga0070766_104208091 | 3300005921 | Soil | QSQILWVDTLDALLGCTVGVPMKPPSELRKVHREDDTAWA* |
| Ga0070765_1015060741 | 3300006176 | Soil | RNVGTVFSSQMLWLETLDALLGHAVGVPMKPPVELRQLRKEDDSTWA* |
| Ga0070765_1020495811 | 3300006176 | Soil | SISRNFGTVFSSQMLWVDTLDALLGRSVGVPMERPSELRQFHKEDGTTWA* |
| Ga0079222_120429011 | 3300006755 | Agricultural Soil | ESLSRNFGLIFASQMLWVETLDALLAFPVGVPVREPEDLRKLHQRDETAWA* |
| Ga0066665_106500411 | 3300006796 | Soil | SSQMLWVETLDAVLGHTVGVPMQRPTALRRLHREDDTTWA* |
| Ga0099830_102271012 | 3300009088 | Vadose Zone Soil | VETLDALLGHKVGVPVQPPAELRELHKEDDTTWA* |
| Ga0099830_107837591 | 3300009088 | Vadose Zone Soil | QMLWVDTLDALLGRTVGVPMKLPAELRQLHKEDGTTWT* |
| Ga0116135_10689803 | 3300009665 | Peatland | SRNFGVVFQSQMLWVDTLDALLGHTVGVPMQMPGEMRRMHKRDDSSYV* |
| Ga0116215_10285361 | 3300009672 | Peatlands Soil | FGTVFSSQMLWVDTLDALLGHSVGVPMKPPTELRQLHKEDDTTWA* |
| Ga0116215_12667012 | 3300009672 | Peatlands Soil | VARNFGRVFESQILWVDTLDALLGRAVGVPMKLPENLRELDDDETFSG* |
| Ga0116224_104279532 | 3300009683 | Peatlands Soil | VSQSVARNFGRVFESQILWVDTLDALLGRTVGVPMELPDNLRELHDDETFWA* |
| Ga0116216_104382741 | 3300009698 | Peatlands Soil | RNFGRVFESQILWVDTLDALLGRTVGVPMELPDNLRELHDDETFWA* |
| Ga0116217_105243652 | 3300009700 | Peatlands Soil | SRNFGTVFSSQMLWVETLDALRGHTVGVPMQRPAELRRLHKEDDTTWA* |
| Ga0116223_100196111 | 3300009839 | Peatlands Soil | FGRVFESQILWVDTLDALLGRAVGVPMKLPENLRELDDDETFSA* |
| Ga0116223_103884222 | 3300009839 | Peatlands Soil | QMLWVETLDALFGHVVGVPLKTPEAVRRLRGEDDLALG* |
| Ga0126381_1011780642 | 3300010376 | Tropical Forest Soil | VDALDALLGRAVGIPMKPPAELRELRGEDETHWA* |
| Ga0126381_1045904181 | 3300010376 | Tropical Forest Soil | NQILWVDTLDALLGNTVGVPMQPPAELRKLREEDSTSWA* |
| Ga0136449_1023720512 | 3300010379 | Peatlands Soil | GRVFASEILWVDTLDALLGRTVGVPMKMPENLRELRDDETFWA* |
| Ga0126383_130217471 | 3300010398 | Tropical Forest Soil | VVFHRQILWVESLDGLLGQTMGVPLKEPRELLELRQQDETFWA* |
| Ga0137393_108461381 | 3300011271 | Vadose Zone Soil | RQILWVDTLDALLGRQVGVPIKSPAELRKLHQDDEATWA* |
| Ga0137363_106823911 | 3300012202 | Vadose Zone Soil | MLWVETLDALVGNVVGVPLKTPDSLRRLHGEDVLFLG* |
| Ga0137378_108040801 | 3300012210 | Vadose Zone Soil | VFQSQILWVDTLDALLGRTVGVPMKPPANLRHLRKEDDPTWV* |
| Ga0137367_111303141 | 3300012353 | Vadose Zone Soil | RNFGVVFHRQMLWVETLDALLGRTVGVPMKLPDELRRLHDESDITWG* |
| Ga0137396_103291913 | 3300012918 | Vadose Zone Soil | SSQMRWVETLDAVLGHTVGVPLQRPTALRKLHKEDDTTWA* |
| Ga0153915_117678262 | 3300012931 | Freshwater Wetlands | VVRNFGLVFGRQILWLETLDALLGRKVGVPMKPPKELRDLRGDEESFWA* |
| Ga0181534_108123862 | 3300014168 | Bog | FSSQMLWVDTLDALLGRAVGVPLLPPVKLRRFHEEDEATWA* |
| Ga0182015_105756721 | 3300014495 | Palsa | TVFSSQMLWVETLDALLGRAVGVPLRHPDELRQLHREDDTNWA* |
| Ga0187802_102049021 | 3300017822 | Freshwater Sediment | LWVETLDALLGHTVGVPMKPPAELRQLRQEDDTTWA |
| Ga0187802_102723162 | 3300017822 | Freshwater Sediment | ESISRNVGVVFQSQILWVETLDALLGRTVGVPVKPPAELRQLRKEDDSAWA |
| Ga0187818_103881221 | 3300017823 | Freshwater Sediment | HSQILWVDTLDALLGRTVGVPMKPPAELRQLHKKDDSTWA |
| Ga0187877_13462811 | 3300017931 | Peatland | QILWVDTLDALLGRAVGVPVKPPTDLRQLHKEDDTTWA |
| Ga0187803_100739041 | 3300017934 | Freshwater Sediment | VFSSDVLWVDTLDALLGRAVGVPVKPPANLRELHGDETSWA |
| Ga0187821_102211722 | 3300017936 | Freshwater Sediment | VVFQSQILWVDTLDALLGNTVGVPMKPPQELRELHKEDKTTWA |
| Ga0187819_104430841 | 3300017943 | Freshwater Sediment | ITRNFSTVFQSQILWLETLEALRGPTVGVPMKLPDELRQLRNEEDRHHA |
| Ga0187819_108600781 | 3300017943 | Freshwater Sediment | QILWVDTLDALLGRAVGVPMKLPENLRELPEDETFWA |
| Ga0187817_109094331 | 3300017955 | Freshwater Sediment | NFGRVFGSQVLWVDTLDALLGRSVGVPMKLPEDLRQLHEDETFWA |
| Ga0187776_107113591 | 3300017966 | Tropical Peatland | DRQTLWVDTLDALLGRAVGVPMRPPAHLRELHDDETFWA |
| Ga0187781_110445682 | 3300017972 | Tropical Peatland | NFGRVFNSQVSWVDTLDALLGRPVGVPMKLPENLHKLHEDETFWA |
| Ga0187782_110040742 | 3300017975 | Tropical Peatland | RNFGRAFGSEILWVETLDALLGHALGVPMKLPEDLRELHEDETFWA |
| Ga0187782_110378101 | 3300017975 | Tropical Peatland | NFGVVFESQILWVETLDALLGSVVGVPMRPPADLRHLHGSDEEDTFRA |
| Ga0187816_103037641 | 3300017995 | Freshwater Sediment | LWVGTLDALLGRAVGVPMKPPANLRELHDDETFWA |
| Ga0187804_101645952 | 3300018006 | Freshwater Sediment | SRNVGVIFQSQILWVDTLDALLGRTVGVPMKPPTELRQLRKEDDQTWA |
| Ga0187805_100950551 | 3300018007 | Freshwater Sediment | ESISRNVSVVFQSQILWVETLDALLGHAVGVPMKPPSELRQLHKEDDTTWA |
| Ga0187884_104178232 | 3300018009 | Peatland | LWVDTLDALLSRTVGIPMKPPVELRQLHKEDDTTWA |
| Ga0187857_100069969 | 3300018026 | Peatland | SRNFGTVFSSQILWVDTLDALLGRAVGVPLQHPTELRQLHKDDGTTWA |
| Ga0187883_104614173 | 3300018037 | Peatland | FGTVFSSQMLWVDTLDALLARKVGIPMKPPSELRRIHREEDTTWV |
| Ga0187859_104664491 | 3300018047 | Peatland | SQMLWVETLDALLGNTVGVPLQSPAEFRLLHKEDETTWT |
| Ga0187770_102220421 | 3300018090 | Tropical Peatland | AISRNFGVVFQSQMLWLETVDALLHSTVGVPMKPPAELRQLRREEDSFWG |
| Ga0193735_11742491 | 3300020006 | Soil | WVETLDAVLGHSVGVPMQRPTALRRLHREDDTTWA |
| Ga0210407_103333751 | 3300020579 | Soil | FGTVFSSQMLWVETLDAVLGHTVGVPMQRPTALRRLHKEDDTTWA |
| Ga0210403_109792602 | 3300020580 | Soil | GVVFSSQMLWVETLDVLLGRTVGVPMKPPAELRGLHKEDDTNWA |
| Ga0210395_103830781 | 3300020582 | Soil | FQSQILWVDTLDALLGRTVGVPTVGVPMKPPSELRKIHREDDTAWA |
| Ga0210404_100487013 | 3300021088 | Soil | WIETLEALLGESVGVPVKPPSEFQQLHREDDTFWA |
| Ga0210404_101636471 | 3300021088 | Soil | WVETLDALLKETLGVPARPAQELRRLHKEDETFWA |
| Ga0210396_103389941 | 3300021180 | Soil | FSSQMLWVDTLDALLGRIVGVPVKLPAELRQLHTEDDSTWA |
| Ga0193719_101422101 | 3300021344 | Soil | EAGLRNFGDVFANQMRWIETLDALLGNTVGVPLKLPTTLRQLHKEDDATWA |
| Ga0210384_105379012 | 3300021432 | Soil | WVDTLDALLGRAVGVPLQRPAEFRRLHKGDDTTWA |
| Ga0210409_115134651 | 3300021559 | Soil | ISRNFGTVFSSQILWVETLDALLGRTVGVPMKPPENLRKLRGEDGPAWA |
| Ga0126371_127793921 | 3300021560 | Tropical Forest Soil | GVVFQSQILWLETIDALLGHAVGVPMKPPAELRQLHEDDSAWA |
| Ga0208935_10563541 | 3300025414 | Peatland | SRNFGVVFQSQMLWVETLDALLGRTVGVPMKPPEELRQLRNEDDTAWA |
| Ga0207684_101312823 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GGFTLDALLGRTVGVPVKPPTEFRKLHQEDETTWA |
| Ga0207663_115745422 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VFQSQILWVDTIDALLGRTVGVPMTPPAELRHLHKEDETSWA |
| Ga0208575_10171821 | 3300026920 | Soil | SRNFGVVFQSQMLWVETLDALLGRVVGVPVKSPAEFRKLHQEDETTWA |
| Ga0208241_10323112 | 3300027297 | Forest Soil | LGTVFSSQMLWVDTLDVLLGNAVGIPMQRPAEFRQLHKEDDTTWA |
| Ga0209220_10304282 | 3300027587 | Forest Soil | SPMLWVETLDAVLGHTVGVPMQRPTSLRQLHKEDDTTWA |
| Ga0208565_12258692 | 3300027662 | Peatlands Soil | FGTVFSSQMLWVDTLDALLGHSVGVPMKPPTELRQLHKEDDTTWA |
| Ga0209328_102146781 | 3300027727 | Forest Soil | SQMLGVETLDALLGRTVGVPMQPPTELRELHKEDDTAWA |
| Ga0209038_100055091 | 3300027737 | Bog Forest Soil | SSQMLWVETLDALLGNTVGIPLRRPAEFRQLHKEDETTWT |
| Ga0209074_104173851 | 3300027787 | Agricultural Soil | ESLSRNFGLIFASQMLWVETLDALLAFPVGVPVREPEDLRKLHQRDETAWA |
| Ga0209693_104256141 | 3300027855 | Soil | QMLWVETLDALLGRTVGVPVQSPQELRKFHKEDDHTWA |
| Ga0209465_101258572 | 3300027874 | Tropical Forest Soil | NFGVVFQSQILWVDTLDALLGRTVGVPMRPPSELRQIRKEDDFTWA |
| Ga0209169_101890852 | 3300027879 | Soil | FSTQILWLETIDALLGRTVGVPMQPPAELRQLHKEDDTTWA |
| Ga0209380_107523361 | 3300027889 | Soil | FGTVFSSQMLWIETIDALLGRAVGVPMKPPTDLRQLHKEDDKAWA |
| Ga0209415_105954751 | 3300027905 | Peatlands Soil | WVETLDALFGHVVGVPLKTPEAVRRLRGEDDLALG |
| Ga0209415_107746411 | 3300027905 | Peatlands Soil | WVETLDALFGHVVGVPLKTPEAVRRLHGEDDLALG |
| Ga0209006_104352433 | 3300027908 | Forest Soil | FGTVFSSQMLWVDTLDALLGRSVGVPMKPPAELRRLHRDEDAIWT |
| Ga0265352_10177131 | 3300028021 | Soil | FGVVFSSQMLWVETLDVLLGRTVGVPMKPPAELRGLHKENDTSWA |
| Ga0302224_1000172413 | 3300028759 | Palsa | SISRNFGSVFSSQMLWVDTLDALLGRTVGVPMKPPAELRQLSSDDEINWA |
| Ga0302303_100535793 | 3300028776 | Palsa | LWVETLDALLGRTVGVPMRRPVELRQLHKEDDSSWA |
| Ga0302232_102181652 | 3300028789 | Palsa | NFGTVFSSQMLWVDTLDALLGHTVGVPMKPPAELRQLSSDDEVNWA |
| Ga0302228_102937132 | 3300028808 | Palsa | FGVVFSRQMLWVETLDALLGRAVGVPLQHPPELHPFRGEDDKTWA |
| Ga0308309_113932691 | 3300028906 | Soil | RNVGTVFSSQMLWLETLDALLGHAVGVPMKPPVELRQLRKEGDSTWA |
| Ga0311368_105063611 | 3300029882 | Palsa | SQMLWVDTLDALLGHTVGVPMKPPAELRQLSSDDEVNWA |
| Ga0311329_105808352 | 3300029907 | Bog | QMLWVETLDALLGHTVGVPLQRPDELRQLHKEDDTTWA |
| Ga0311340_111987221 | 3300029943 | Palsa | RNFGTVFSSQMLWVDTLDALLGRAVGVPVQRPDELQRLHKEDGTTWA |
| Ga0311331_101836614 | 3300029954 | Bog | TVFSSQMLWVDTLDVLLGRTVGVPMKPPAELRQLSNEDEVNWA |
| Ga0311339_113273442 | 3300029999 | Palsa | ESISRNFGTVFSSQMLWVETLDALLGRTVGVPMKPPGELRRLHHEKDTTWA |
| Ga0302176_100611792 | 3300030057 | Palsa | VFSSQMLWVETLDALLGRAVGVPMQRPTELRQIHKEDDATWA |
| Ga0302192_101508681 | 3300030507 | Bog | LWVETLDALLGHTVGVPLQRPDELRQLHKEDDTTWA |
| Ga0310038_103964241 | 3300030707 | Peatlands Soil | MLWVETLDALRGHTVGVPMQRPAELRRLHKEDDTTWA |
| Ga0311335_104376701 | 3300030838 | Fen | AHNIGAVFQSEILWRKNLDALLGQSTGVPMKPPAELRQLHGEDDTFKA |
| Ga0170834_1034136951 | 3300031057 | Forest Soil | QMLWVESLDALLGNTVGVPVKPPAELRQLHREDDTTWA |
| Ga0310686_1123891581 | 3300031708 | Soil | TVFTSQILWVETIDALLGRTVGVPMKTPPELRQIHKVDGTTWA |
| Ga0307476_110850691 | 3300031715 | Hardwood Forest Soil | QMLWVETLDALLGRTVGVPIKPPAEFRHLHKEDGTTWA |
| Ga0307477_103410141 | 3300031753 | Hardwood Forest Soil | DTLDALLGRTVGVPMKPPVELRELRKEKEEETNWA |
| Ga0307475_100084648 | 3300031754 | Hardwood Forest Soil | VFQSQILWVETLDALLGRAVGVPMRLPSEFRRLHKEEDPSWA |
| Ga0307475_107528401 | 3300031754 | Hardwood Forest Soil | QMLWVDTLDALLRRTVGVPVQPPAELRQLHKEDGTRWA |
| Ga0310909_111167632 | 3300031947 | Soil | WVDTLDALLGRFVGVPMKSPTELRAIHKEDDTTWA |
| Ga0311301_110547112 | 3300032160 | Peatlands Soil | GVVFQSQILWVETLDALLGRTVGVPVKPPAELRQLHKKDDTTWA |
| Ga0307471_1032780662 | 3300032180 | Hardwood Forest Soil | QSQVLWIETMDSLLGRAVGVPMQPPKELRQVRAEDDTTWA |
| Ga0335079_100336787 | 3300032783 | Soil | VFDRQIVWVETLDALLGRAVGVPMKPPDNLRKLHEDETFWA |
| Ga0335078_120483072 | 3300032805 | Soil | SQILWVDTLDALLGRTVGVPMKPPTELRQLRKEDDTTWA |
| Ga0335075_115382191 | 3300032896 | Soil | FQSQMLWVDTLDALLGRTVGVPMKAPEEFRKIHGEDGITWA |
| Ga0371489_0290538_3_155 | 3300033755 | Peat Soil | AQSVARNFGRVFNSQILWVETLDALLGRSLGVPLKAPEVRQLHEDDTFWA |
| Ga0370515_0073933_28_141 | 3300034163 | Untreated Peat Soil | MLWVETLDALLGHTVGVPLEHPTELRRLHHEDDNTWA |
| ⦗Top⦘ |